Getting directions through the Directions API

For direction calculations that respond in real time to user input (for example, within a user interface element), you can use the Directions API or, if you're using the Maps JavaScript API, use the Directions service. For server-side use, you can use Java Client, Python Client, Go Client and Node.js Client for Google Maps Services.

With the Directions API, you can:

  • Search for directions for several modes of transportation, including transit, driving, walking or cycling.
  • Return multi-part directions using a series of waypoints.
  • Specify origins, destinations, and waypoints as text strings (e.g. "Chicago, IL" or "Darwin, NT, Australia"), as place IDs, or as latitude/longitude coordinates

The API returns the most efficient routes when calculating directions. Travel time is the primary factor optimized, but the API may also take into account other factors such as distance, number of turns and many more when deciding which route is the most efficient.

Before you begin

Before you start using the Directions API, you need a project with a billing account and the Directions API enabled. To learn more, see Set up in Cloud Console.

Building your Directions API requests

A Directions API request takes the following form:

https://maps.googleapis.com/maps/api/directions/outputFormat?parameters

where outputFormat may be either of the following values:

  • json (recommended) indicates output in JavaScript Object Notation (JSON)
  • xml indicates output as XML

Note: URLs must be properly encoded to be valid and are limited to 8192 characters for all web services. Be aware of this limit when constructing your URLs.

As is standard in URLs, all parameters are separated using the ampersand (&) character. All reserved characters (for example the plus sign "+") must be URL-encoded. The list of parameters and their possible values are enumerated below.

Required parameters

  • destination

    The place ID, address, or textual latitude/longitude value to which you wish to calculate directions. The options for the destination parameter are the same as for the origin parameter.

  • origin

    The place ID, address, or textual latitude/longitude value from which you wish to calculate directions.

    • Place IDs must be prefixed with place_id:. You can retrieve place IDs from the Geocoding API and the Places API (including Place Autocomplete). For an example using place IDs from Place Autocomplete, see Place Autocomplete and Directions. For more about place IDs, see the Place ID overview.

      origin=place_id:ChIJ3S-JXmauEmsRUcIaWtf4MzE
      
    • If you pass an address, the Directions service geocodes the string and converts it to a latitude/longitude coordinate to calculate directions. This coordinate may be different from that returned by the Geocoding API, for example a building entrance rather than its center.

      origin=24+Sussex+Drive+Ottawa+ON
      

      Using place IDs is preferred over using addresses or latitude/longitude coordinates. Using coordinates will always result in the point being snapped to the road nearest to those coordinates - which may not be an access point to the property, or even a road that will quickly or safely lead to the destination.

    • If you pass coordinates, the point will snap to the nearest road. Passing a place ID is preferred. If you do pass coordinates, ensure that no space exists between the latitude and longitude values.

      origin=41.43206,-81.38992
      
    • Plus codes must be formatted as a global code or a compound code. Format plus codes as shown here (plus signs are url-escaped to %2B and spaces are url-escaped to %20).

      • Global code is a 4 character area code and 6 character or longer local code (849VCWC8+R9 is 849VCWC8%2BR9).
      • Compound code is a 6 character or longer local code with an explicit location (CWC8+R9 Mountain View, CA, USA is CWC8%2BR9%20Mountain%20View%20CA%20USA).
    Note: For efficiency and accuracy, use place ID's when possible. These ID's are uniquely explicit like a lat/lng value pair and provide geocoding benefits for routing such as access points and traffic variables. Unlike an address, ID's do not require the service to perform a search or an intermediate request for place details; therefore, performance is better.

Optional parameters

  • alternatives

    If set to true, specifies that the Directions service may provide more than one route alternative in the response. Note that providing route alternatives may increase the response time from the server. This is only available for requests without intermediate waypoints. For more information, see the guide to waypoints.

  • arrival_time

    Specifies the desired time of arrival for transit directions, in seconds since midnight, January 1, 1970 UTC. You can specify either departure_time or arrival_time, but not both. Note that arrival_time must be specified as an integer.

  • avoid

    Indicates that the calculated route(s) should avoid the indicated features. This parameter supports the following arguments:

    • tolls indicates that the calculated route should avoid toll roads/bridges.
    • highways indicates that the calculated route should avoid highways.
    • ferries indicates that the calculated route should avoid ferries.
    • indoor indicates that the calculated route should avoid indoor steps for walking and transit directions.

    It's possible to request a route that avoids any combination of tolls, highways and ferries by passing multiple restrictions to the avoid parameter. For example:

    avoid=tolls|highways|ferries.
    
  • departure_time

    Specifies the desired time of departure. You can specify the time as an integer in seconds since midnight, January 1, 1970 UTC. If a departure_time later than 9999-12-31T23:59:59.999999999Z is specified, the API will fall back the departure_time to 9999-12-31T23:59:59.999999999Z. Alternatively, you can specify a value of now, which sets the departure time to the current time (correct to the nearest second). The departure time may be specified in two cases:

    • For requests where the travel mode is transit: You can optionally specify one of departure_time or arrival_time. If neither time is specified, the departure_time defaults to now (that is, the departure time defaults to the current time).
    • For requests where the travel mode is driving: You can specify the departure_time to receive a route and trip duration (response field: duration_in_traffic) that take traffic conditions into account. The departure_time must be set to the current time or some time in the future. It cannot be in the past.
    Note: If departure time is not specified, choice of route and duration are based on road network and average time-independent traffic conditions. Results for a given request may vary over time due to changes in the road network, updated average traffic conditions, and the distributed nature of the service. Results may also vary between nearly-equivalent routes at any time or frequency.
    Note: Distance Matrix requests specifying `departure_time` when `mode=driving` are limited to a maximum of 100 elements per request. The number of origins times the number of destinations defines the number of elements.
  • language

    The language in which to return results.

    • See the list of supported languages. Google often updates the supported languages, so this list may not be exhaustive.
    • If language is not supplied, the API attempts to use the preferred language as specified in the Accept-Language header.
    • The API does its best to provide a street address that is readable for both the user and locals. To achieve that goal, it returns street addresses in the local language, transliterated to a script readable by the user if necessary, observing the preferred language. All other addresses are returned in the preferred language. Address components are all returned in the same language, which is chosen from the first component.
    • If a name is not available in the preferred language, the API uses the closest match.
    • The preferred language has a small influence on the set of results that the API chooses to return, and the order in which they are returned. The geocoder interprets abbreviations differently depending on language, such as the abbreviations for street types, or synonyms that may be valid in one language but not in another. For example, utca and tér are synonyms for street in Hungarian.
  • mode

    For the calculation of distances and directions, you may specify the transportation mode to use. By default, DRIVING mode is used. By default, directions are calculated as driving directions. The following travel modes are supported:

    • driving (default) indicates standard driving directions or distance using the road network.
    • walking requests walking directions or distance via pedestrian paths & sidewalks (where available).
    • bicycling requests bicycling directions or distance via bicycle paths & preferred streets (where available).
    • transit requests directions or distance via public transit routes (where available). If you set the mode to transit, you can optionally specify either a departure_time or an arrival_time. If neither time is specified, the departure_time defaults to now (that is, the departure time defaults to the current time). You can also optionally include a transit_mode and/or a transit_routing_preference.
    Note: Both walking and bicycling directions may sometimes not include clear pedestrian or bicycling paths, so these directions will return warnings in the returned result which you must display to the user.
  • region

    The region code, specified as a ccTLD ("top-level domain") two-character value. Most ccTLD codes are identical to ISO 3166-1 codes, with some notable exceptions. For example, the United Kingdom's ccTLD is "uk" (.co.uk) while its ISO 3166-1 code is "gb" (technically for the entity of "The United Kingdom of Great Britain and Northern Ireland").

  • traffic_model

    Specifies the assumptions to use when calculating time in traffic. This setting affects the value returned in the duration_in_traffic field in the response, which contains the predicted time in traffic based on historical averages. The traffic_model parameter may only be specified for driving directions where the request includes a departure_time. The available values for this parameter are:

    • best_guess (default) indicates that the returned duration_in_traffic should be the best estimate of travel time given what is known about both historical traffic conditions and live traffic. Live traffic becomes more important the closer the departure_time is to now.
    • pessimistic indicates that the returned duration_in_traffic should be longer than the actual travel time on most days, though occasional days with particularly bad traffic conditions may exceed this value.
    • optimistic indicates that the returned duration_in_traffic should be shorter than the actual travel time on most days, though occasional days with particularly good traffic conditions may be faster than this value.

    The default value of best_guess will give the most useful predictions for the vast majority of use cases. It is possible the best_guess travel time prediction may be shorter than optimistic, or alternatively, longer than pessimistic, due to the way the best_guess prediction model integrates live traffic information.

  • transit_mode

    Specifies one or more preferred modes of transit. This parameter may only be specified for transit directions. The parameter supports the following arguments:

    • bus indicates that the calculated route should prefer travel by bus.
    • subway indicates that the calculated route should prefer travel by subway.
    • train indicates that the calculated route should prefer travel by train.
    • tram indicates that the calculated route should prefer travel by tram and light rail.
    • rail indicates that the calculated route should prefer travel by train, tram, light rail, and subway. This is equivalent to transit_mode=train|tram|subway.
  • transit_routing_preference

    Specifies preferences for transit routes. Using this parameter, you can bias the options returned, rather than accepting the default best route chosen by the API. This parameter may only be specified for transit directions. The parameter supports the following arguments:

    • less_walking indicates that the calculated route should prefer limited amounts of walking.
    • fewer_transfers indicates that the calculated route should prefer a limited number of transfers.
  • units

    Specifies the unit system to use when displaying results.

    Directions results contain text within distance fields that may be displayed to the user to indicate the distance of a particular "step" of the route. By default, this text uses the unit system of the origin's country or region.

    For example, a route from "Chicago, IL" to "Toronto, ONT" will display results in miles, while the reverse route will display results in kilometers. You may override this unit system by setting one explicitly within the request's units parameter, passing one of the following values:

    • metric specifies usage of the metric system. Textual distances are returned using kilometers and meters.
    • imperial specifies usage of the Imperial (English) system. Textual distances are returned using miles and feet.
    Note: this unit system setting only affects the text displayed within distance fields. The distance fields also contain values which are always expressed in meters.
  • waypoints

    Caution: Requests using more than 10 waypoints (between 11 and 25), or waypoint optimization, are billed at a higher rate. Learn more about billing for Google Maps Platform products.

    Specifies an array of intermediate locations to include along the route between the origin and destination points as pass through or stopover locations. Waypoints alter a route by directing it through the specified location(s). The API supports waypoints for these travel modes: driving, walking and bicycling; not transit. You can supply one or more locations separated by the pipe character (| or %7C), in the form of a place ID, an address, or latitude/longitude coordinates. By default, the Directions service calculates a route using the waypoints in the order they are given. The precedence for parsing the value of the waypoint is place ID, latitude/longitude coordinates, then address.

    • If you pass a place ID, you must prefix it with place_id:. You can retrieve place IDs from the Geocoding API and the Places API (including Place Autocomplete). For an example using place IDs from Place Autocomplete, see Place Autocomplete and Directions. For more about place IDs, see the Place ID overview.
      For efficiency and accuracy, use place ID's when possible. These ID's are uniquely explicit like a lat/lng value pair and provide geocoding benefits for routing such as access points and traffic variables. Unlike an address, ID's do not require the service to perform a search or an intermediate request for place details; therefore, performance is better.
    • If you pass latitude/longitude coordinates, the values go directly to the front-end server to calculate directions without geocoding. The points are snapped to roads and might not provide the accuracy your app needs. Use coordinates when you are confident the values truly specify the points your app needs for routing without regard to possible access points or additional geocoding details. Ensure that a comma (%2C) and not a space (%20) separates the latitude and longitude values.
    • If you pass an address, the Directions service will geocode the string and convert it into latitude/longitude coordinates to calculate directions. If the address value is ambiguous, the value might evoke a search to disambiguate from similar addresses. For example, "1st Street" could be a complete value or a partial value for "1st street NE" or "1st St SE". This result may be different from that returned by the Geocoding API. You can avoid possible misinterpretations using place IDs.
    • Alternatively, you can supply an encoded set of points using the Encoded Polyline Algorithm. You will find an encoded set is useful for a large number of waypoints, because the URL is significantly shorter. All web services have a URL limit of 8192 characters.
      • Encoded polylines must be prefixed with enc: and followed by a colon (:). For example: waypoints=enc:gfo}EtohhU:.
      • You can also include multiple encoded polylines, separated by the pipe character (|). For example, waypoints=via:enc:wc~oAwquwMdlTxiKtqLyiK:|enc:c~vnAamswMvlTor@tjGi}L:| via:enc:udymA{~bxM:
    Influence routes with stopover and pass through points

    For each waypoint in the request, the directions response appends an entry to the legs array to provide the details for stopovers on that leg of the journey.

    If you'd like to influence the route using waypoints without adding a stopover, add the prefix via: to the waypoint. Waypoints prefixed with via: will not add an entry to the legs array, but will route the journey through the waypoint.

    The following URL modifies the previous request such that the journey is routed through Lexington without stopping:

    https://maps.googleapis.com/maps/api/directions/json?
    origin=Boston,MA&destination=Concord,MA
    &waypoints=Charlestown,MA|via:Lexington,MA  
    

    The via: prefix is most effective when creating routes in response to the user dragging the waypoints on the map. Doing so allows the user to see how the final route may look in real-time and helps ensure that waypoints are placed in locations that are accessible to the Directions API.

    Caution: Using the `via:` prefix to avoid stopovers results in directions that are strict in their interpretation of the waypoint. This interpretation may result in severe detours on the route or `ZERO_RESULTS` in the response status code if the Directions API is unable to create directions through that point.
    Optimize your waypoints

    By default, the Directions service calculates a route through the provided waypoints in their given order. Optionally, you may pass optimize:true as the first argument within the waypoints parameter to allow the Directions service to optimize the provided route by rearranging the waypoints in a more efficient order. (This optimization is an application of the traveling salesperson problem.) Travel time is the primary factor which is optimized, but other factors such as distance, number of turns and many more may be taken into account when deciding which route is the most efficient. All waypoints must be stopovers for the Directions service to optimize their route.

    If you instruct the Directions service to optimize the order of its waypoints, their order will be returned in the waypoint_order field within the routes object. The waypoint_order field returns values which are zero-based.

    The following example calculates a road journey from Adelaide, South Australia to each of South Australia's main wine regions using route optimization.

    https://maps.googleapis.com/maps/api/directions/json?
    origin=Adelaide,SA&destination=Adelaide,SA
    &waypoints=optimize:true|Barossa+Valley,SA|Clare,SA|Connawarra,SA|McLaren+Vale,SA
    

    Inspection of the calculated route will indicate that calculation uses waypoints in the following waypoint order:

    "waypoint_order": [ 3, 2, 0, 1 ]
    
    Caution: Requests using waypoint optimization are billed at a higher rate. Learn more about how Google Maps Platform products are billed.

Generated from the OpenAPI specification. Edit Report bug

Directions examples

The following request returns driving directions from Toronto, Ontario to Montreal, Quebec.

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Montreal
  &origin=Toronto
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

By changing the mode and avoid parameters, the initial request can be modified to return directions for a scenic bicycle journey that avoids major highways.

URL

https://maps.googleapis.com/maps/api/directions/json
  ?avoid=highways
  &destination=Montreal
  &mode=bicycling
  &origin=Toronto
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&avoid=highways&mode=bicycling&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&avoid=highways&mode=bicycling&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&avoid=highways&mode=bicycling&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&avoid=highways&mode=bicycling&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&avoid=highways&mode=bicycling&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Toronto&destination=Montreal&avoid=highways&mode=bicycling&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

The following request searches for transit directions from Brooklyn, New York to Queens, New York. The request does not specify a departure_time, so the departure time defaults to the current time:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Queens
  &mode=transit
  &origin=Brooklyn
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

The following transit request includes a specific departure time.

Note: In this example the departure time is specified as July 30, 2012 at 09:45 am. To avoid an error, you must change the parameter to a time in the future before submitting the request.

URL

https://maps.googleapis.com/maps/api/directions/json
  ?departure_time=1343641500
  &destination=Queens
  &mode=transit
  &origin=Brooklyn
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&departure_time=1343641500&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&departure_time=1343641500&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&departure_time=1343641500&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&departure_time=1343641500&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&departure_time=1343641500&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Brooklyn&destination=Queens&mode=transit&departure_time=1343641500&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

The following request uses plus codes to return driving directions from H8MW+WP to GCG2+3M in Kolkata, India.

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=GCG2%2B3M%20Kolkata%20India
  &origin=H8MW%2BWP%20Kolkata%20India
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=H8MW%2BWP%20Kolkata%20India&destination=GCG2%2B3M%20Kolkata%20India&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=H8MW%2BWP%20Kolkata%20India&destination=GCG2%2B3M%20Kolkata%20India&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=H8MW%2BWP%20Kolkata%20India&destination=GCG2%2B3M%20Kolkata%20India&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=H8MW%2BWP%20Kolkata%20India&destination=GCG2%2B3M%20Kolkata%20India&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=H8MW%2BWP%20Kolkata%20India&destination=GCG2%2B3M%20Kolkata%20India&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=H8MW+WP%20Kolkata%20India&destination=GCG2+3M%20Kolkata%20India&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

The following request returns driving directions from Glasgow, UK to Perth, UK using place IDs.

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=place_id%3AChIJA01I-8YVhkgRGJb0fW4UX7Y
  &origin=place_id%3AChIJ685WIFYViEgRHlHvBbiD5nE
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=place_id%3AChIJ685WIFYViEgRHlHvBbiD5nE&destination=place_id%3AChIJA01I-8YVhkgRGJb0fW4UX7Y&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=place_id%3AChIJ685WIFYViEgRHlHvBbiD5nE&destination=place_id%3AChIJA01I-8YVhkgRGJb0fW4UX7Y&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=place_id%3AChIJ685WIFYViEgRHlHvBbiD5nE&destination=place_id%3AChIJA01I-8YVhkgRGJb0fW4UX7Y&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=place_id%3AChIJ685WIFYViEgRHlHvBbiD5nE&destination=place_id%3AChIJA01I-8YVhkgRGJb0fW4UX7Y&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=place_id%3AChIJ685WIFYViEgRHlHvBbiD5nE&destination=place_id%3AChIJA01I-8YVhkgRGJb0fW4UX7Y&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=place_id:ChIJ685WIFYViEgRHlHvBbiD5nE&destination=place_id:ChIJA01I-8YVhkgRGJb0fW4UX7Y&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

Travel modes

When you calculate directions, you may specify the transportation mode to use. By default, directions are calculated as driving directions. The following travel modes are supported:

  • driving (default) indicates standard driving directions using the road network.
  • walking requests walking directions via pedestrian paths & sidewalks (where available).
  • bicycling requests bicycling directions via bicycle paths & preferred streets (where available).
  • transit requests directions via public transit routes (where available). If you set the mode to transit, you can optionally specify either a departure_time or an arrival_time. If neither time is specified, the departure_time defaults to now (that is, the departure time defaults to the current time). You can also optionally include a transit_mode and/or a transit_routing_preference.

Note: Both walking and bicycling directions may sometimes not include clear pedestrian or bicycling paths, so these directions will return warnings in the returned result which you must display to the user.

Traffic information

Traffic information is used when all of the following apply (these are the conditions required to receive the duration_in_traffic field in the Directions response):

  • The travel mode parameter is driving, or is not specified (driving is the default travel mode).
  • The request includes a valid departure_time parameter. The departure_time can be set to the current time or some time in the future. It cannot be in the past.
  • The request does not include stopover waypoints. If the request includes waypoints, prefix each waypoint with via: to influence the route but avoid stopovers. For example,
    &waypoints=via:San Francisco|via:Mountain View|...

Optionally, you can include the traffic_model parameter in your request to specify the assumptions to use when calculating time in traffic.

The following URL initiates a Directions request for a journey from Boston, MA to Concord, MA, via Charlestown and Lexington. The request includes a departure time, meeting all the requirements to return the duration_in_traffic field in the Directions response.

URL

https://maps.googleapis.com/maps/api/directions/json
  ?departure_time=now
  &destination=Concord%2C%20MA
  &origin=Boston%2C%20MA
  &waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&departure_time=now&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&departure_time=now&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&departure_time=now&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&departure_time=now&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&departure_time=now&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Boston,%20MA&destination=Concord,%20MA&waypoints=via:Charlestown,MA%7Cvia:Lexington,MA&departure_time=now&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

Waypoints

When calculating routes using the Directions API, you may specify waypoints to return a route that includes pass throughs or stopovers at intermediate locations. You can add waypoints to driving, walking or bicycling directions but not transit directions.

Specify locations in the waypoints parameter.

You can supply one or more locations separated by the pipe character (| or %7C), in the form of a place ID, an address, or latitude/longitude coordinates. By default, the Directions service calculates a route using the waypoints in the order they are given. The precedence for parsing the value of the waypoint is place ID, latitude/longitude coordinates, then address.

  • If you pass a place ID, you must prefix it with place_id:. You can retrieve place IDs from the Geocoding API and the Places API (including Place Autocomplete). For an example using place IDs from Place Autocomplete, see Place Autocomplete and Directions. For more about place IDs, see the Place ID overview.

    For efficiency and accuracy, use place ID's when possible. These ID's are uniquely explicit like a lat/lng value pair and provide geocoding benefits for routing such as access points and traffic variables. Unlike an address, ID's do not require the service to perform a search or an intermediate request for place details; therefore, performance is better.

  • If you pass latitude/longitude coordinates, the values go directly to the front-end server to calculate directions without geocoding. The points are snapped to roads and might not provide the accuracy your app needs. Use coordinates when you are confident the values truly specify the points your app needs for routing without regard to possible access points or additional geocoding details. Ensure that a comma (%2C) and not a space (%20) separates the latitude and longitude values.
  • If you pass an address, the Directions service will geocode the string and convert it into latitude/longitude coordinates to calculate directions. If the address value is ambiguous, the value might evoke a search to disambiguate from similar addresses. For example, "1st Street" could be a complete value or a partial value for "1st street NE" or "1st St SE". This result may be different from that returned by the Geocoding API. You can avoid possible misinterpretations using place IDs. See troubleshooting the results of my route request.

Alternatively, you can supply an encoded set of points using the Encoded Polyline Algorithm. You will find an encoded set is useful for a large number of waypoints, because the URL is significantly shorter. All web services have a URL limit of 8192 characters.

  • Encoded polylines must be prefixed with enc: and followed by a colon (:). For example: waypoints=enc:gfo}EtohhU:.
  • You can also include multiple encoded polylines, separated by the pipe character (|). For example, waypoints=via:enc:wc~oAwquwMdlTxiKtqLyiK:|enc:c~vnAamswMvlTor@tjGi}L:| via:enc:udymA{~bxM:

The following URL initiates a Directions request for a journey between Boston, MA and Concord, MA with stopovers in Charlestown and Lexington, in that order. The example uses addresses:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Concord%2C%20MA
  &origin=Boston%2C%20MA
  &waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=via%3ACharlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Boston,%20MA&destination=Concord,%20MA&waypoints=via:Charlestown,MA%7Cvia:Lexington,MA&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

Influence routes with stopover and pass through points

For each waypoint in the request, the directions response appends an entry to the legs array to provide the details for stopovers on that leg of the journey.

If you'd like to influence the route using waypoints without adding a stopover, add the prefix via: to the waypoint. Waypoints prefixed with via: will not add an entry to the legs array, but will route the journey through the waypoint.

The following URL modifies the previous request such that the journey is routed through Lexington without stopping:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Concord%2C%20MA
  &origin=Boston%2C%20MA
  &waypoints=Charlestown%2CMA%7Cvia%3ALexington%2CMA
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=Charlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=Charlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=Charlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=Charlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Boston%2C%20MA&destination=Concord%2C%20MA&waypoints=Charlestown%2CMA%7Cvia%3ALexington%2CMA&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Boston,%20MA&destination=Concord,%20MA&waypoints=Charlestown,MA%7Cvia:Lexington,MA&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

The via: prefix is most effective when creating routes in response to the user dragging the waypoints on the map. Doing so allows the user to see how the final route may look in real-time and helps ensure that waypoints are placed in locations that are accessible to the Directions API.

The following URL requests waypoints using latitude/longitude coordinates:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Perth%2C%20AU
  &origin=Sydney%2C%20AU
  &waypoints=via%3A-37.81223%2C144.96254%7Cvia%3A-34.92788%2C138.60008
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3A-37.81223%2C144.96254%7Cvia%3A-34.92788%2C138.60008&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3A-37.81223%2C144.96254%7Cvia%3A-34.92788%2C138.60008&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3A-37.81223%2C144.96254%7Cvia%3A-34.92788%2C138.60008&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3A-37.81223%2C144.96254%7Cvia%3A-34.92788%2C138.60008&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3A-37.81223%2C144.96254%7Cvia%3A-34.92788%2C138.60008&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Sydney,%20AU&destination=Perth,%20AU&waypoints=via:-37.81223,144.96254%7Cvia:-34.92788,138.60008&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

Here is the same request, using an encoded polyline:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Perth%2C%20AU
  &origin=Sydney%2C%20AU
  &waypoints=via%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=via%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Sydney,%20AU&destination=Perth,%20AU&waypoints=via:enc:lexeF%7B~wsZejrPjtye@:&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

Note that you can freely intermix a via: specifier with location modifiers. For example:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Perth%2C%20AU
  &origin=Sydney%2C%20AU
  &waypoints=side_of_road%3Avia%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=side_of_road%3Avia%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=side_of_road%3Avia%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=side_of_road%3Avia%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=side_of_road%3Avia%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Sydney%2C%20AU&destination=Perth%2C%20AU&waypoints=side_of_road%3Avia%3Aenc%3AlexeF%7B~wsZejrPjtye%40%3A&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Sydney,%20AU&destination=Perth,%20AU&waypoints=side_of_road:via:enc:lexeF%7B~wsZejrPjtye@:&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

Optimize your waypoints

By default, the Directions service calculates a route through the provided waypoints in their given order. Optionally, you may pass optimize:true as the first argument within the waypoints parameter to allow the Directions service to optimize the provided route by rearranging the waypoints in a more efficient order. (This optimization is an application of the traveling salesperson problem.) Travel time is the primary factor which is optimized, but other factors such as distance, number of turns and many more may be taken into account when deciding which route is the most efficient. All waypoints must be stopovers for the Directions service to optimize their route.

If you instruct the Directions service to optimize the order of its waypoints, their order will be returned in the waypoint_order field within the routes object. The waypoint_order field returns values which are zero-based.

The following example calculates a road journey from Adelaide, South Australia to each of South Australia's main wine regions using route optimization.

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Adelaide%2C%20SA
  &origin=Adelaide%2C%20SA
  &waypoints=optimize%3Atrue%7CBarossa%20Valley%2C%20SA%7CClare%2C%20SA%7CConnawarra%2C%20SA%7CMcLaren%20Vale%2C%20SA
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Adelaide%2C%20SA&destination=Adelaide%2C%20SA&waypoints=optimize%3Atrue%7CBarossa%20Valley%2C%20SA%7CClare%2C%20SA%7CConnawarra%2C%20SA%7CMcLaren%20Vale%2C%20SA&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Adelaide%2C%20SA&destination=Adelaide%2C%20SA&waypoints=optimize%3Atrue%7CBarossa%20Valley%2C%20SA%7CClare%2C%20SA%7CConnawarra%2C%20SA%7CMcLaren%20Vale%2C%20SA&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Adelaide%2C%20SA&destination=Adelaide%2C%20SA&waypoints=optimize%3Atrue%7CBarossa%20Valley%2C%20SA%7CClare%2C%20SA%7CConnawarra%2C%20SA%7CMcLaren%20Vale%2C%20SA&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Adelaide%2C%20SA&destination=Adelaide%2C%20SA&waypoints=optimize%3Atrue%7CBarossa%20Valley%2C%20SA%7CClare%2C%20SA%7CConnawarra%2C%20SA%7CMcLaren%20Vale%2C%20SA&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Adelaide%2C%20SA&destination=Adelaide%2C%20SA&waypoints=optimize%3Atrue%7CBarossa%20Valley%2C%20SA%7CClare%2C%20SA%7CConnawarra%2C%20SA%7CMcLaren%20Vale%2C%20SA&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Adelaide,%20SA&destination=Adelaide,%20SA&waypoints=optimize:true%7CBarossa%20Valley,%20SA%7CClare,%20SA%7CConnawarra,%20SA%7CMcLaren%20Vale,%20SA&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

Inspection of the calculated route will indicate that calculation uses waypoints in the following waypoint order:

"waypoint_order": [ 3, 2, 0, 1 ]

Restrictions

Directions may be calculated that adhere to certain restrictions. Restrictions are indicated by use of the avoid parameter, and an argument to that parameter indicating the restriction to avoid. The following restrictions are supported:

  • avoid=tolls
  • avoid=highways
  • avoid=ferries

It's possible to request a route that avoids any combination of tolls, highways and ferries by passing both restrictions to the avoid parameter. For example: avoid=tolls|highways|ferries.

Note: the addition of restrictions does not preclude routes that include the restricted feature; it biases the result to more favorable routes.

Unit systems

Directions results contain text within distance fields that may be displayed to the user to indicate the distance of a particular "step" of the route. By default, this text uses the unit system of the origin's country or region.

For example, a route from "Chicago, IL" to "Toronto, ONT" will display results in miles, while the reverse route will display results in kilometers. You may override this unit system by setting one explicitly within the request's units parameter, passing one of the following values:

  • metric specifies usage of the metric system. Textual distances are returned using kilometers and meters.
  • imperial specifies usage of the Imperial (English) system. Textual distances are returned using miles and feet.

Note: this unit system setting only affects the text displayed within distance fields. The distance fields also contain values which are always expressed in meters.

Region biasing

You can set the Directions service to return results from a specific region by using the region parameter. This parameter takes a two-character ccTLD (country code top-level domain) argument specifying the region bias. Most ccTLD codes are identical to ISO 3166-1 alpha-2 codes, with some notable exceptions. For example, the United Kingdom's ccTLD is "uk" (.co.uk) while its ISO 3166-1 code is "gb" (technically for the entity of "The United Kingdom of Great Britain and Northern Ireland"). See Google Maps Platform Coverage Details for supported regions.

You may utilize any domain in which the main Google Maps application has launched driving directions.

For example, a directions request for "Toledo" to "Madrid" returns appropriate results when region is set to es and "Toledo" is then interpreted as the Spanish city:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Madrid
  &origin=Toledo
  &region=es
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&region=es&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&region=es&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&region=es&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&region=es&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&region=es&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&region=es&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

JSON

{
  "geocoded_waypoints":
    [
      {
        "geocoder_status": "OK",
        "place_id": "ChIJ8f21C60Lag0R_q11auhbf8Y",
        "types": ["locality", "political"],
      },
      {
        "geocoder_status": "OK",
        "place_id": "ChIJgTwKgJcpQg0RaSKMYcHeNsQ",
        "types": ["locality", "political"],
      },
    ],
  "routes":
    [
      {
        "bounds":
          {
            "northeast": { "lat": 40.4165207, "lng": -3.7026134 },
            "southwest": { "lat": 39.862808, "lng": -4.029406799999999 },
          },
        "copyrights": "Map data ©2022 Inst. Geogr. Nacional",
        "legs":
          [
            {
              "distance": { "text": "74.3 km", "value": 74327 },
              "duration": { "text": "57 mins", "value": 3446 },
              "end_address": "Madrid, Spain",
              "end_location": { "lat": 40.4165207, "lng": -3.705076 },
              "start_address": "Toledo, Spain",
              "start_location": { "lat": 39.862808, "lng": -4.0273727 },
              "steps":
                [
                  {
                    "distance": { "text": "0.6 km", "value": 615 },
                    "duration": { "text": "2 mins", "value": 106 },
                    "end_location":
                      { "lat": 39.8681019, "lng": -4.029378299999999 },
                    "html_instructions": "Head <b>northwest</b> on <b>Av. de la Reconquista</b> toward <b>C. de la Diputación</b>",
                    "polyline":
                      {
                        "points": "quhrF`rqWCBQJUJm@PQFg@Ni@JeBh@}@XaD|@{@Vk@Ns@RUFoA^u@R_AXwA`@WHMBG@C?E?GAC?IC",
                      },
                    "start_location": { "lat": 39.862808, "lng": -4.0273727 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.2 km", "value": 174 },
                    "duration": { "text": "1 min", "value": 24 },
                    "end_location": { "lat": 39.8675297, "lng": -4.0275807 },
                    "html_instructions": "At the roundabout, take the <b>1st</b> exit onto <b>C. Duque de Lerma</b>",
                    "maneuver": "roundabout-right",
                    "polyline":
                      {
                        "points": "svirFr~qW?AAEAEACACACCCACF_@H[FQNi@j@cB`@qAHW",
                      },
                    "start_location":
                      { "lat": 39.8681019, "lng": -4.029378299999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.6 km", "value": 594 },
                    "duration": { "text": "2 mins", "value": 91 },
                    "end_location": { "lat": 39.8688577, "lng": -4.021535 },
                    "html_instructions": 'At the roundabout, take the <b>3rd</b> exit onto <b>Av. Gral. Villalba</b><div style="font-size:0.9em">Go through 1 roundabout</div>',
                    "maneuver": "roundabout-right",
                    "polyline":
                      {
                        "points": "asirFjsqW@?@??A@?@A@A@?DI@C@C@A@C@C@CDS?A@O?G@G?GAKAA?AAAAA?CAAA?AAAAAAA?AAA?A?AAA?A?A?C@A?A?A@A@A??@A@CBQMIIEEACISCIIWEQEMI[Oi@?CYy@@E?K?A?A?AAA?A?AA??A?AAAAA?AA??AA??AA?A??AA?A?A?A?UcAOi@Mi@Mk@I]AMCOAQAQCWCeA?A?k@EuCCaCA{@?O",
                      },
                    "start_location": { "lat": 39.8675297, "lng": -4.0275807 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.2 km", "value": 198 },
                    "duration": { "text": "1 min", "value": 29 },
                    "end_location": { "lat": 39.8700417, "lng": -4.0208568 },
                    "html_instructions": "At the roundabout, take the <b>3rd</b> exit onto <b>Av. de Madrid</b>",
                    "maneuver": "roundabout-right",
                    "polyline":
                      {
                        "points": "k{irFrmpW@A@A@A@A@A?A@A@A?A@A?A@A?C?A@A?C?C?C?A?CAC?AAC?AAAACAAA??AAAAAC?AAA?A?A?A?AAA@A?A?A?]W_@U{@a@o@YGACAKBE@A@A@EDCFAH?F?H",
                      },
                    "start_location": { "lat": 39.8688577, "lng": -4.021535 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.4 km", "value": 415 },
                    "duration": { "text": "1 min", "value": 57 },
                    "end_location": { "lat": 39.8737356, "lng": -4.0207605 },
                    "html_instructions": "Turn <b>right</b> to stay on <b>Av. de Madrid</b>",
                    "maneuver": "turn-right",
                    "polyline":
                      {
                        "points": "wbjrFjipWEFCBABC@E@E@G?M?a@Aq@CsBCK?s@As@CcCE{@?{AEo@AGAOECAMA",
                      },
                    "start_location": { "lat": 39.8700417, "lng": -4.0208568 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.1 km", "value": 1065 },
                    "duration": { "text": "1 min", "value": 67 },
                    "end_location": { "lat": 39.8830007, "lng": -4.0190202 },
                    "html_instructions": "At the roundabout, take the <b>2nd</b> exit onto the <b>A-42</b> ramp to <b>Madrid</b>",
                    "maneuver": "roundabout-right",
                    "polyline":
                      {
                        "points": "{yjrFvhpW?C?CAC?AACAAACAAAACAAAAACAC?A?AAA@C?A?A?A@A?C@A?A@C@A@ABA@AB?@ABE?A?KDGDG@I@KBo@AWAoCEQEW?[A[AgAAu@CiBEi@EKCyAMiAM[G_@I[Mk@S_@Qa@QICWKQGKEICICYGIAIAKAQCUCO?Q?OAS?]?I?G?g@@EAG?GAG?IAIAGCKAYI[KCAo@WmAe@q@SMCiAS_@B",
                      },
                    "start_location": { "lat": 39.8737356, "lng": -4.0207605 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "19.2 km", "value": 19159 },
                    "duration": { "text": "11 mins", "value": 650 },
                    "end_location":
                      { "lat": 40.0333486, "lng": -3.925665899999999 },
                    "html_instructions": "Merge onto <b>A-42</b>",
                    "maneuver": "merge",
                    "polyline":
                      {
                        "points": "wslrFz}oWKA]C[CS?UA[@u@@kBFaBFsBBS@c@?A?iA?mCAG?Y?eACS?I?{@ESCK?QCKASAGAMAIC_@Ea@GUE_AQSEOC[GICSEOEMC[I]I]I[I_@KGACACAYGMCUG[I_@Ka@KuBg@]IC?i@Ok@Mu@OiAUKAMCA?C?eAQc@G]E{@MWCUEg@IAA[GSEOCwA[s@Qu@So@Oc@Ke@KKC_@Io@Qu@Q]ISGMC]I[GoBe@_Cm@kAYyA]i@QaBc@CA_A[gDuAGCy@]mAe@eCcAa@QQGw@]u@Y{Am@aAe@i@WKG_@S}@i@UOi@_@UOIEa@Ye@Ye@WOIu@]o@WSKMCSKEAsBu@YK[McC}@iE_BYMwDwAOGKESGsHsCgE}AWKg@QeC_AqIaDgC}@gC_AoBu@oAe@{Ak@qCeAeBq@cE{AmCcAkAc@QGQG[MmAe@qAg@MEqAg@_A]a@MeA]}@SICsAYw@M}B]cCa@UEKA}@OaGaAwASg@KOE[Ge@MICe@MGCs@UMEGA[M[KyAe@GCQEoAc@c@OwAc@_DeAYKUGeA]eAYICa@KA?s@Mg@Ia@Iq@ImBYaB_@UGEC}@Yg@QMGMEg@Uk@Wo@YECMIQIo@a@{@g@SOKGg@[mCmBaAs@SM{@o@]UmAu@q@[e@U{@e@SMKIQKGCGESKoDgCgGmEwCuBKI{AcAYQEA_@Sm@WgAc@IEEAw@W_Be@oBm@yAa@EAe@OaAYo@Su@Wc@Uq@_@EAe@Yg@[iDwBWQOKOK]UuBqA_@U}@m@gAs@[QaBiAq@e@WOECOIGGs@e@a@Yi@_@_@Y[WYUYWYWe@a@eB}Ae@_@c@[]WYQm@_@UOc@W_@SCA[QKGMGk@Y}@c@q@]yAs@UMIE_@UWO]S]WcAq@k@c@a@]QKc@][WUQ]Yo@g@}AkAiCgBcC_BgCcBa@WSKg@]g@[MKKE_Am@OKiAq@uBoAm@]qAy@w@g@y@i@gAu@w@i@iCkB}B}AYSCAEE_@U}AeA_@U}@m@eAq@w@i@IGIG_BcAwA}@yBwAuGiEmUgOaMeIq@c@e@[ECKG_C}AmCeBmCeBcC_BiBkAmAy@wBuAwGkEkBmAQK_BeASMgAs@yDgCy@i@s@c@ECIGs@e@iCaBoAw@i@_@OKIEYQqAw@kBcAOIm@YKG[OSKICoB}@y@[uAg@u@YyAe@y@U]KgAYs@SwAY{@QICc@GOCwAU{@MwAQ{@IwAOa@C_AG{@Ee@AYA]A]A]?_@A]?y@?M?c@?}@@G?s@@M?Q@Y@K?W@e@@}@DSBM?O@aCPcAHmAJQ@[BWBy@Fu@FC?[BC@]B[@a@BYB]@c@By@BW@u@BcA?]?]?_@A]A]Ca@A[C]E[C]E_@E]G]G[G_@I]I]I[K_@KYKYK_@M[OYK]Q[O[QYO[SYQYQ[SYSYUWS[WWUYWUUWYWWWYWYUYUYU]UYU]S[U]S]Q]S]S_@Q_@Q]Qa@Q_@O_@Oa@Q_@Wq@GQMa@Qe@]cAM_@K_@Qg@M_@K]?CQi@IY[iAK_@Og@W}@EKACIYEK?CSq@k@mBi@iBK_@Oe@Og@e@aBi@kB[eAi@iBeAqDi@eBMc@}@uCm@oBSq@Ww@Wu@Us@M]Wq@[}@a@iAa@_AeAcCSe@c@_Ac@aA_AoB}@kBg@}@c@}@c@w@Ua@S[S]S]e@y@U]e@u@W_@QWk@{@_AsAk@u@OUW[W]MOIKOS[_@_AkAGGEEa@e@UWY[UWCEQQWY_@a@e@e@WWA?ACSQYYq@o@USWWYYYUEEcB{Au@m@wBgBOMgA{@AAm@g@m@e@k@c@eAy@o@i@YU[UYU}@s@m@e@]W}BiBkByA",
                      },
                    "start_location": { "lat": 39.8830007, "lng": -4.0190202 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "47.1 km", "value": 47071 },
                    "duration": { "text": "30 mins", "value": 1825 },
                    "end_location": { "lat": 40.3957623, "lng": -3.7039499 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>A-42</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "m_jsFlv}ViEkDWQsEqDu@m@]Yk@c@oAaAa@]IGKIa@[}@s@IIUQQMi@e@{@q@]YwAiAa@[e@_@UQyBeBw@o@m@e@oAaAu@m@yAkA]W?A]Wo@g@aF}Dq@i@oAcAWSQMAAMKWUq@g@mJuHo@g@q@i@eG}Ea@[CC]YoAcA}@q@g@c@[UWSo@i@YSWUOMKIWSWUYSQMKKKGKKQOWSWQWUo@e@YWWSYUUSYSi@c@YUYU}@u@}@s@WSWS[WKKWSUQSQs@g@_@[q@i@m@g@u@k@m@g@w@m@o@i@g@a@OKMMw@m@cBsAoDqCk@e@m@g@c@a@MKm@k@y@u@KIgAiA{A{AeBkBwCyCoBqBkAoAWWkBmBcAeAWWgAiAmAoAeAgA{@}@s@w@USa@a@w@y@e@g@u@w@QQ_@]KMKKoAqAaBeB}A_BGIAA}@_A_BaByA}AgAiAeAeACCk@q@SUS[U[Ua@Wc@Q_@Ui@Se@Qg@Og@K_@Me@Ki@Ie@EWMw@Gk@UoBSeBYmCMiAMeA[qCYmCIu@YyBE[UmBc@_EIy@_AeIK}@c@cE]sCa@sDAK]wCK_AQqASuBGc@yAuMk@cFCSE]?A?AACASAG?GCMESW_CAISkBUwB?CIi@MgAGa@Kq@WqA_@gBOm@_@gA_@iAc@iAISAASe@CIg@aAi@aAw@sA_@k@i@u@W[EEY_@OOs@w@i@k@c@_@e@a@SOm@c@[Uq@c@a@S_@SUMuAo@uBcA_@Qq@[wMoGYMOIwAq@_LiFCCkEsBgD_BqBaAuFmC_CgAeFgCq@_@sAu@iBcAgC_B_@W}@k@uBuAgCaBc@YWQa@WCC]UgDuBcBiAq@a@cBiAGCOK_@UWQQKc@YwDeCuA}@u@e@]UCCaCiBu@k@[YQQw@s@kAmA[]SUw@_Aq@}@o@}@U[g@w@i@_Ae@y@o@iA]o@_CwE[m@i@_Ak@_A{A{Bi@s@UYCCu@{@GEe@g@EEk@k@w@s@YWu@q@iA_AmA{@iAw@sAy@iCsAu@[qAs@}CcAaCq@aCk@w@OkEiAcEeAUGSGcAUqA[_AUeDy@aDy@cLwCoBi@aG{A]IqA]sD{@EAu@Sg@Mi@O]KsCq@qA]e@MkBe@yEoAu@SgBi@_A[sAe@MEaBk@uAe@y@Y{@YGA{@[CAyBs@SGaBm@yDoAeBo@i@QyCaAUIcBq@yAm@uB{@wFeCqAi@aBq@w@Y[KqBs@[KuAc@sBm@gAWiCm@wAYs@M_AOWEa@GSCQCYCUGqAQk@G{@K_@GyAY}A[}A]a@K_Be@ECy@WaA_@c@OSI[K_A]mDsAcA_@cBo@A?_@OkEaBmAe@KCiAe@}As@iB}@y@e@WMOIg@WoCiAsBw@s@WQIm@UgBq@m@Sy@[yCiAkAc@aA_@q@WwAg@uBy@}@[oAc@mA_@EAu@SQEmAY{@Sk@Oq@Sa@Mi@SEAaC}@qAe@uAi@A?kBq@wAk@kAi@cCmAi@Ww@]wAo@cBs@aC}@aC_ASGsCeAsCeA]Ma@Oe@Q]KmAe@OGOGQGgC_AaBm@gDoASIa@OiG{BiAa@mCcAYK]M{EgB}B{@]MmFoBWKYK_FiBKECAOGkCaAqDsA}FwBGCWKSGKEUIgAc@]K_@OcBo@]MA?]Mi@SGCMEMEYMcE{AsAi@kAa@kAe@CAEAWKGEi@Sw@_@c@UOIGEQKKIOIc@[e@_@i@e@OOUUa@c@Y]i@q@U]e@w@IOGMKO[m@Yq@Se@ACUk@Qg@KWSm@a@kAMa@k@eBCKy@cCM_@Qi@gAeDwAiEmAuD_@gAqDcLKYIWSk@{@mCk@aBk@cBKUEIKUAEQ]CGGM_@o@U]Y_@[a@]a@e@e@YWWSWUSMA?QMIEKGk@Yk@Uc@QUEWGg@KEAk@Gq@IaAEI@u@?W@{@Di@Ds@JA?E@oAR_APc@Fu@N}@NyAX{AV{@N{AXyAV{AXyB^uCf@sDn@{AXq@Lu@N}B^YFoAPkANs@BC@u@?m@CWAMAM?_AIw@Mk@MEAw@Ua@OOGc@QKGg@Uo@a@SO}@q@CCq@i@a@[aHsFeEeDm@g@o@i@q@i@g@_@_@YSOCCOKIGEEWQGEUQIEWWq@i@iCoB_BcAaB{@aBq@_A]]MqA_@{@SQEOCA?}@Oc@IE?A?QCmAM{@Gy@GA?_@CeFWkCOkBIyBKgBKyOy@G?MAYAs@ESCUA}DScCOa@C{BS}BYuB[yAY_Ce@yBg@}D_A{Cs@m@Mo@OoEeA}@UuCo@wCs@EAICMCYGiBa@eLiC}HiBmBc@_Bc@cAYm@Uu@[CA{@a@c@Ua@U[UECYQIG_@[g@c@][c@c@WYSW_@c@S[W_@S[S[O[U_@O]Q[M]O[ACK[Sg@EKGSK_@M_@GS]sAMk@Mm@CMKg@SeAI_@O{@Kq@GYu@kEUoAMu@e@iCSiA]kBWkAMc@Mg@Om@Y{@?AQi@_@{@e@aAuAgC{@mAsA{Aw@y@uAgAm@a@w@a@KGeBs@AA[KsAe@{Bo@GCc@Ma@KYIOEYIuCaA[M_@Qi@Uk@Yi@Yi@[}A}@MI_@UoAu@e@YqC_BsBmAUMeDqB{@g@i@[uCeB_@UaDmBgEeC_@U_Ak@_@Ue@Yy@e@iGsDeBcAs@c@i@]e@Ue@[IEiF}C_DkBwA{@SKmBiAuCeBGEyA{@MIcDmBmBiAaBaA}FiDaBaAi@]u@c@_@UeAo@uEoCcBaAwA}@sAw@yA{@aBaAaCwAcEcCu@a@OKeAq@iC_ByCaB_CuA{Aw@gB_AaDcBy@e@cB_AmEiCmBiA[SWO{A}@{A}@qAw@sAw@CA]UA?_@UiC{AKGWOGCSMy@a@w@]]Og@Ma@Ig@K]EOAa@C_@Ak@?c@Bw@Fc@DW@aAPkB^gDf@kEp@oInAcBX{@JiBZ_@F_@Fm@JgANiBZiBXc@FKBy@LoDj@G?eG`Am@Je@Fa@Fk@Jm@FsAHk@Bq@Am@Ak@Cs@Ia@IYI]K[Mi@YYSWOa@Yq@k@m@g@}@u@g@a@eByA}BkB{@s@MKc@]_Aw@}OsMaBsAuBcB]Y{AoA_@Yy@s@KG?AWSsBeBeCsBwBeBwAmA}BmBuBiBsAiAgByAa@_@wBeBcBuAGGAA_Aw@g@_@e@_@{AqAk@g@g@_@mAcAk@c@g@[c@Uc@Sm@S[I]I[G_@Ec@CCA_@AGAuDEgEWaBKgCOe@EyAIgAIs@Go@CkCQq@E{BIgAEa@A[AMAM?oBIs@EOAu@EGAI?s@G{@EoAIgAIA?G?aBKm@Ee@Cy@IWAYCyCSC?WCcAEKAC?OAsBOYCWAuDWIAMAE?u@G{@GKAuCW}Gm@o@GkAKc@EKAE?y@Im@GiAOiAOu@IgBSo@G_AIwAKqAIq@Ei@EsAIcAImCO{CUmCQSAWAe@CwBOWCWAKAc@CeAI[CG?EA]CaAGSAiEYw@GMAYAcAIwIm@A?IAIAmDS?AsBMI?{@Gk@EcAGsAKWAgBMQAk@Eg@Eg@E_@A_@CGA[CG?QAKAoAGq@AYCY?oAGoCK]?q@EUAiBIWCkAG}BMmF[aAGm@EkBMMAK?}DWSAq@Ec@EKAC?a@CIAG?E?iAIaAGEA_CMs@EsAKWAkAIKAe@CcCOGA{BMgDSeBMe@E_@EI?QCYAa@AWAQ?M?MAK?KAOA[CYCy@KUEMAKAKC[EgAWWGoAWYG{Co@q@MMEA?s@QYIWIq@[m@]EAa@W]S]WWYMO[[a@c@e@e@o@q@SSUWEEUUUWa@c@UWQQcAeAg@k@mAoAIKGG_@c@SSw@}@QSa@k@e@w@e@y@q@cBm@mBs@eCe@_BWy@[eA_@qAg@cBM_@M[O_@O_@Sc@IOAAS_@QWGKOWMOMQW[SWSSKIIG{BqBQQMKCCAAA?SQSS_Ay@u@q@_@]CAAACCCCi@e@KKYWAAs@k@[Y][a@_@WUm@g@",
                      },
                    "start_location":
                      { "lat": 40.0333486, "lng": -3.925665899999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.7 km", "value": 1693 },
                    "duration": { "text": "1 min", "value": 88 },
                    "end_location": { "lat": 40.4001319, "lng": -3.7183967 },
                    "html_instructions": "Take exit <b>2A</b> to merge onto <b>M-30</b> toward <b>A-5</b>/<wbr/><b>Badajoz</b>/<wbr/><b>A-6</b>",
                    "maneuver": "ramp-right",
                    "polyline":
                      {
                        "points": "oxpuFtlrUIWEGGIEGAGEOAKAA?EAI?G@G?A?IBK@IBI?ADIDIDKJOHKLKHIJGDAFEDAFADADAP@H@BB@?HDDBFFBB@D@BBFBF@H?L?N@b@EHGFUd@Ud@CHg@tAQr@EPGTGRMj@?@Id@ABQ|@?l@?TETETEVCNADMl@q@rDKf@ENMj@ABCJ]tAENCJ?@Oh@ELIZMh@Oh@ENGXA@Of@Qj@Yx@Yr@Sf@_@`A]n@CFQ^CDCDEFEJEJ{BfD_AzAWb@MPINQXEHQ\\CFOd@A@Oh@AB[|BAHIl@EREVIl@Ij@SzAEPER?j@@\\?HDn@@`@Fz@@LB~@FlA",
                      },
                    "start_location": { "lat": 40.3957623, "lng": -3.7039499 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.5 km", "value": 473 },
                    "duration": { "text": "1 min", "value": 36 },
                    "end_location": { "lat": 40.4026657, "lng": -3.7219427 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>M-30</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "ysquF~fuU?\\@T?H@V?V?HAd@?@Cj@Gf@E\\GXADCHCJGNABCBMRGFGFKJODQBMBM@K?KAGAQG]BC@I@OBC@SHEBIBUJa@ZYZKLKPGHMZIPUx@EDMPY`@",
                      },
                    "start_location": { "lat": 40.4001319, "lng": -3.7183967 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.7 km", "value": 692 },
                    "duration": { "text": "1 min", "value": 35 },
                    "end_location":
                      { "lat": 40.40876859999999, "lng": -3.7214006 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>M-30</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "ucruFb}uUkA\\YDK?a@DYBc@BA?aAHi@FW@e@Du@BQ?c@?i@C]AC?KASCc@Gi@Kc@KYGECk@OoA_@q@UYKICy@UMEo@Iw@EyAA",
                      },
                    "start_location": { "lat": 40.4026657, "lng": -3.7219427 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.3 km", "value": 259 },
                    "duration": { "text": "1 min", "value": 28 },
                    "end_location": { "lat": 40.4110837, "lng": -3.721353 },
                    "html_instructions": "Slight <b>right</b> (signs for <b>Pᵒ V. del Puerto</b>/<wbr/><b>C/<wbr/> Segovia</b>)",
                    "maneuver": "turn-slight-right",
                    "polyline":
                      {
                        "points": "yisuFvyuUm@QMAk@BQ?Q@A?a@@A?S@M?A?Y?G@c@?U@G?i@@Q?A?O?E?G@S?A?K?UG",
                      },
                    "start_location":
                      { "lat": 40.40876859999999, "lng": -3.7214006 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.3 km", "value": 324 },
                    "duration": { "text": "1 min", "value": 55 },
                    "end_location": { "lat": 40.4139789, "lng": -3.7209563 },
                    "html_instructions": "Merge onto <b>P.º de la Virgen del Puerto</b>",
                    "maneuver": "merge",
                    "polyline":
                      { "points": "gxsuFlyuUkAAIAu@Co@Ew@GUCk@GGAmBSUAsAKm@G" },
                    "start_location": { "lat": 40.4110837, "lng": -3.721353 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.8 km", "value": 764 },
                    "duration": { "text": "2 mins", "value": 114 },
                    "end_location": { "lat": 40.413898, "lng": -3.7119377 },
                    "html_instructions": "Turn <b>right</b> onto <b>C. de Segovia</b>",
                    "maneuver": "turn-right",
                    "polyline":
                      {
                        "points": "kjtuF~vuUBu@?m@@_D?q@@kB@y@?e@?a@@{A@iC?C?e@?k@?mA?E?S@e@?}A?]?q@?u@?mC?i@?K?_@?M?O?C?G?]?I?W?_A?}A?M@c@?IAQ",
                      },
                    "start_location": { "lat": 40.4139789, "lng": -3.7209563 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.1 km", "value": 95 },
                    "duration": { "text": "1 min", "value": 26 },
                    "end_location":
                      { "lat": 40.4144408, "lng": -3.712543399999999 },
                    "html_instructions": "Turn <b>left</b> onto <b>C. de la Villa</b>",
                    "maneuver": "turn-left",
                    "polyline":
                      {
                        "points": "{ituFr~sUS?W?A?A?A@ERGZCHEREPELAD?@A@A@A?A@A?A?CAAAAA",
                      },
                    "start_location": { "lat": 40.413898, "lng": -3.7119377 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "84 m", "value": 84 },
                    "duration": { "text": "1 min", "value": 23 },
                    "end_location": { "lat": 40.414991, "lng": -3.7122205 },
                    "html_instructions": "<b>C. de la Villa</b> turns <b>right</b> and becomes <b>C. del Pretil de los Consejos</b>",
                    "polyline": { "points": "gmtuFjbtUEKCECCCCACEAC?iALEm@" },
                    "start_location":
                      { "lat": 40.4144408, "lng": -3.712543399999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "26 m", "value": 26 },
                    "duration": { "text": "1 min", "value": 8 },
                    "end_location":
                      { "lat": 40.4152243, "lng": -3.712259699999999 },
                    "html_instructions": "Turn <b>left</b> onto <b>C. del Sacramento</b>",
                    "maneuver": "turn-left",
                    "polyline": { "points": "uptuFj`tUm@F" },
                    "start_location": { "lat": 40.414991, "lng": -3.7122205 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.6 km", "value": 626 },
                    "duration": { "text": "3 mins", "value": 184 },
                    "end_location": { "lat": 40.4165207, "lng": -3.705076 },
                    "html_instructions": "Turn <b>right</b> onto <b>C. Mayor</b>",
                    "maneuver": "turn-right",
                    "polyline":
                      {
                        "points": "crtuFr`tUCMIaACYAOE]C[AAI{@?CSiBGk@ESE[UuAESAGCKIg@EWIm@Ge@?GIe@Ga@Ge@AC?IAG?CGo@Ek@Gq@Ek@?ICSEs@CYOiBCa@QkC",
                      },
                    "start_location":
                      { "lat": 40.4152243, "lng": -3.712259699999999 },
                    "travel_mode": "DRIVING",
                  },
                ],
              "traffic_speed_entry": [],
              "via_waypoint": [],
            },
          ],
        "overview_polyline":
          {
            "points": "quhrF`rqWcHzBaNzDeG~A][?k@lA{Dr@mBR]HmA[WQDWE[g@mAeE?]QOeAcE[_EEuKHMCo@_@IyBoAgAYUd@KXWDmMUqFWKWi@ASR]L}A@yM[yEe@cCs@uCiAcCUiCAmBa@sDsAcCUcKHgLB}EScJ_BwLwCsOkCaQaEgOsDmIwCuGkCuJeE}DcCeG{CkPiGgx@eZuUyIeNyEwNcCcOoC_V{HcHuAkFeAaCy@uGiDeKiH{GuDmV}PcIwCaM}DqY{QuE_D_IyGoOmIwGqEoO}KqZoRqX_RqpA_z@qe@{ZgIoEgNgF{IqBqN_BsGOeGD}SrAwDTkIJqFa@oFmA_FuBqEyCcEaEkDaFqC{FmCqH{DwMiPij@kEyLkJcSwE_IaGmIgIoJkP_Oau@kl@a_A}t@i[}VwQyNkN}KoLkLu_@o`@cXyXiB_CuAoCkBcHyIqv@yIiw@i@sEmB_OoBgHcAeCuFeJsGiGqJcFoa@uRge@iUwb@mXaMcIyEoDqDmDqHcKsFkKmEiHyEmFqE}DuJaGgCoA_HuBiQkEk^cJim@qOoc@aO}HoCyOyGgHkCmHuBuL{BaMoByKeD_T_IaGcCkE{BuPwG_T_IaL}CoLeEqToJue@iQwm@aUi]iMkMyE{FeCyDqCaBgBoBwCgC{FgEiMoTip@gDeFaDiCcBw@yBk@eDYsCHyG`AwRlD_XvEsEf@iCGqDe@oBo@gCqAgCoBaVkRoA_A{IsGaHyCoD}@gGs@{WuAgTiA_N{@mMuBu]eI}_@{I_IwByCuAmEeDcEmFsBoEoB{G_BqIwEaWw@sCmDoHoCiDmCaCwE_CuIkC{E_B_D{AqPwJem@g^q|Aa~@iNiI_LaG}UkNeIyEmCqAoCs@oBMkDPi`@bGob@xGoEd@wDCmCi@wBkAgO_Ma^wYqc@{^cKqIiEcDqCgAiDa@gRy@{Fa@}Nq@iGYmXeB{^uC}JeAsOqAc^}B{v@gFeZqAuYgBwm@}DkGmA}EcAwCaAsBkA_B}AsE{EuGcH}BiC_DaGqGiTsBiE_CwCaEoDyI{HeCyB]q@KeAHm@jAyAbAKb@^J\\CjA_CnG_@fBSdCcBbJoCrKkDbJgFnIyAfCeAdFiAtHVnHHjFc@hD[j@k@`@y@HcAG{Af@sAvAu@pBSVY`@kA\\e@D{@HqCTeCJsDSuHuBqA_@oFc@wCFqFFkIi@_Fc@m@GBu@@mEB}FBkG@{I?sQ?mAo@?g@tBKFY_@uAFEm@m@FMoAOcB_@kD_AaGs@eFqAsQ",
          },
        "summary": "A-42",
        "warnings": [],
        "waypoint_order": [],
      },
    ],
  "status": "OK",
}

XML

<DirectionsResponse>
 <status>OK</status>
 <route>
  <summary>A-42</summary>
  <leg>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>39.8628080</lat>
     <lng>-4.0273727</lng>
    </start_location>
    <end_location>
     <lat>39.8681019</lat>
     <lng>-4.0293783</lng>
    </end_location>
    <polyline>
     <points>quhrF`rqWCBQJUJm@PQFg@Ni@JeBh@}@XaD|@{@Vk@Ns@RUFoA^u@R_AXwA`@WHMBG@C?E?GAC?IC</points>
    </polyline>
    <duration>
     <value>106</value>
     <text>2 mins</text>
    </duration>
    <html_instructions>Head &lt;b&gt;northwest&lt;/b&gt; on &lt;b&gt;Av. de la Reconquista&lt;/b&gt; toward &lt;b&gt;C. de la Diputación&lt;/b&gt;</html_instructions>
    <distance>
     <value>615</value>
     <text>0.6 km</text>
    </distance>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>39.8681019</lat>
     <lng>-4.0293783</lng>
    </start_location>
    <end_location>
     <lat>39.8675297</lat>
     <lng>-4.0275807</lng>
    </end_location>
    <polyline>
     <points>svirFr~qW?AAEAEACACACCCACF_@H[FQNi@j@cB`@qAHW</points>
    </polyline>
    <duration>
     <value>24</value>
     <text>1 min</text>
    </duration>
    <html_instructions>At the roundabout, take the &lt;b&gt;1st&lt;/b&gt; exit onto &lt;b&gt;C. Duque de Lerma&lt;/b&gt;</html_instructions>
    <distance>
     <value>174</value>
     <text>0.2 km</text>
    </distance>
    <maneuver>roundabout-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>39.8675297</lat>
     <lng>-4.0275807</lng>
    </start_location>
    <end_location>
     <lat>39.8688577</lat>
     <lng>-4.0215350</lng>
    </end_location>
    <polyline>
     <points>asirFjsqW@?@??A@?@A@A@?DI@C@C@A@C@C@CDS?A@O?G@G?GAKAA?AAAAA?CAAA?AAAAAAA?AAA?A?AAA?A?A?C@A?A?A@A@A??@A@CBQMIIEEACISCIIWEQEMI[Oi@?CYy@@E?K?A?A?AAA?A?AA??A?AAAAA?AA??AA??AA?A??AA?A?A?A?UcAOi@Mi@Mk@I]AMCOAQAQCWCeA?A?k@EuCCaCA{@?O</points>
    </polyline>
    <duration>
     <value>91</value>
     <text>2 mins</text>
    </duration>
    <html_instructions>At the roundabout, take the &lt;b&gt;3rd&lt;/b&gt; exit onto &lt;b&gt;Av. Gral. Villalba&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Go through 1 roundabout&lt;/div&gt;</html_instructions>
    <distance>
     <value>594</value>
     <text>0.6 km</text>
    </distance>
    <maneuver>roundabout-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>39.8688577</lat>
     <lng>-4.0215350</lng>
    </start_location>
    <end_location>
     <lat>39.8700417</lat>
     <lng>-4.0208568</lng>
    </end_location>
    <polyline>
     <points>k{irFrmpW@A@A@A@A@A?A@A@A?A@A?A@A?C?A@A?C?C?C?A?CAC?AAC?AAAACAAA??AAAAAC?AAA?A?A?A?AAA@A?A?A?]W_@U{@a@o@YGACAKBE@A@A@EDCFAH?F?H</points>
    </polyline>
    <duration>
     <value>29</value>
     <text>1 min</text>
    </duration>
    <html_instructions>At the roundabout, take the &lt;b&gt;3rd&lt;/b&gt; exit onto &lt;b&gt;Av. de Madrid&lt;/b&gt;</html_instructions>
    <distance>
     <value>198</value>
     <text>0.2 km</text>
    </distance>
    <maneuver>roundabout-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>39.8700417</lat>
     <lng>-4.0208568</lng>
    </start_location>
    <end_location>
     <lat>39.8737356</lat>
     <lng>-4.0207605</lng>
    </end_location>
    <polyline>
     <points>wbjrFjipWEFCBABC@E@E@G?M?a@Aq@CsBCK?s@As@CcCE{@?{AEo@AGAOECAMA</points>
    </polyline>
    <duration>
     <value>57</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt; to stay on &lt;b&gt;Av. de Madrid&lt;/b&gt;</html_instructions>
    <distance>
     <value>415</value>
     <text>0.4 km</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>39.8737356</lat>
     <lng>-4.0207605</lng>
    </start_location>
    <end_location>
     <lat>39.8830007</lat>
     <lng>-4.0190202</lng>
    </end_location>
    <polyline>
     <points>{yjrFvhpW?C?CAC?AACAAACAAAACAAAAACAC?A?AAA@C?A?A?A@A?C@A?A@C@A@ABA@AB?@ABE?A?KDGDG@I@KBo@AWAoCEQEW?[A[AgAAu@CiBEi@EKCyAMiAM[G_@I[Mk@S_@Qa@QICWKQGKEICICYGIAIAKAQCUCO?Q?OAS?]?I?G?g@@EAG?GAG?IAIAGCKAYI[KCAo@WmAe@q@SMCiAS_@B</points>
    </polyline>
    <duration>
     <value>67</value>
     <text>1 min</text>
    </duration>
    <html_instructions>At the roundabout, take the &lt;b&gt;2nd&lt;/b&gt; exit onto the &lt;b&gt;A-42&lt;/b&gt; ramp to &lt;b&gt;Madrid&lt;/b&gt;</html_instructions>
    <distance>
     <value>1065</value>
     <text>1.1 km</text>
    </distance>
    <maneuver>roundabout-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>39.8830007</lat>
     <lng>-4.0190202</lng>
    </start_location>
    <end_location>
     <lat>40.0333486</lat>
     <lng>-3.9256659</lng>
    </end_location>
    <polyline>
     <points>wslrFz}oWKA]C[CS?UA[@u@@kBFaBFsBBS@c@?A?iA?mCAG?Y?eACS?I?{@ESCK?QCKASAGAMAIC_@Ea@GUE_AQSEOC[GICSEOEMC[I]I]I[I_@KGACACAYGMCUG[I_@Ka@KuBg@]IC?i@Ok@Mu@OiAUKAMCA?C?eAQc@G]E{@MWCUEg@IAA[GSEOCwA[s@Qu@So@Oc@Ke@KKC_@Io@Qu@Q]ISGMC]I[GoBe@_Cm@kAYyA]i@QaBc@CA_A[gDuAGCy@]mAe@eCcAa@QQGw@]u@Y{Am@aAe@i@WKG_@S}@i@UOi@_@UOIEa@Ye@Ye@WOIu@]o@WSKMCSKEAsBu@YK[McC}@iE_BYMwDwAOGKESGsHsCgE}AWKg@QeC_AqIaDgC}@gC_AoBu@oAe@{Ak@qCeAeBq@cE{AmCcAkAc@QGQG[MmAe@qAg@MEqAg@_A]a@MeA]}@SICsAYw@M}B]cCa@UEKA}@OaGaAwASg@KOE[Ge@MICe@MGCs@UMEGA[M[KyAe@GCQEoAc@c@OwAc@_DeAYKUGeA]eAYICa@KA?s@Mg@Ia@Iq@ImBYaB_@UGEC}@Yg@QMGMEg@Uk@Wo@YECMIQIo@a@{@g@SOKGg@[mCmBaAs@SM{@o@]UmAu@q@[e@U{@e@SMKIQKGCGESKoDgCgGmEwCuBKI{AcAYQEA_@Sm@WgAc@IEEAw@W_Be@oBm@yAa@EAe@OaAYo@Su@Wc@Uq@_@EAe@Yg@[iDwBWQOKOK]UuBqA_@U}@m@gAs@[QaBiAq@e@WOECOIGGs@e@a@Yi@_@_@Y[WYUYWYWe@a@eB}Ae@_@c@[]WYQm@_@UOc@W_@SCA[QKGMGk@Y}@c@q@]yAs@UMIE_@UWO]S]WcAq@k@c@a@]QKc@][WUQ]Yo@g@}AkAiCgBcC_BgCcBa@WSKg@]g@[MKKE_Am@OKiAq@uBoAm@]qAy@w@g@y@i@gAu@w@i@iCkB}B}AYSCAEE_@U}AeA_@U}@m@eAq@w@i@IGIG_BcAwA}@yBwAuGiEmUgOaMeIq@c@e@[ECKG_C}AmCeBmCeBcC_BiBkAmAy@wBuAwGkEkBmAQK_BeASMgAs@yDgCy@i@s@c@ECIGs@e@iCaBoAw@i@_@OKIEYQqAw@kBcAOIm@YKG[OSKICoB}@y@[uAg@u@YyAe@y@U]KgAYs@SwAY{@QICc@GOCwAU{@MwAQ{@IwAOa@C_AG{@Ee@AYA]A]A]?_@A]?y@?M?c@?}@@G?s@@M?Q@Y@K?W@e@@}@DSBM?O@aCPcAHmAJQ@[BWBy@Fu@FC?[BC@]B[@a@BYB]@c@By@BW@u@BcA?]?]?_@A]A]Ca@A[C]E[C]E_@E]G]G[G_@I]I]I[K_@KYKYK_@M[OYK]Q[O[QYO[SYQYQ[SYSYUWS[WWUYWUUWYWWWYWYUYUYU]UYU]S[U]S]Q]S]S_@Q_@Q]Qa@Q_@O_@Oa@Q_@Wq@GQMa@Qe@]cAM_@K_@Qg@M_@K]?CQi@IY[iAK_@Og@W}@EKACIYEK?CSq@k@mBi@iBK_@Oe@Og@e@aBi@kB[eAi@iBeAqDi@eBMc@}@uCm@oBSq@Ww@Wu@Us@M]Wq@[}@a@iAa@_AeAcCSe@c@_Ac@aA_AoB}@kBg@}@c@}@c@w@Ua@S[S]S]e@y@U]e@u@W_@QWk@{@_AsAk@u@OUW[W]MOIKOS[_@_AkAGGEEa@e@UWY[UWCEQQWY_@a@e@e@WWA?ACSQYYq@o@USWWYYYUEEcB{Au@m@wBgBOMgA{@AAm@g@m@e@k@c@eAy@o@i@YU[UYU}@s@m@e@]W}BiBkByA</points>
    </polyline>
    <duration>
     <value>650</value>
     <text>11 mins</text>
    </duration>
    <html_instructions>Merge onto &lt;b&gt;A-42&lt;/b&gt;</html_instructions>
    <distance>
     <value>19159</value>
     <text>19.2 km</text>
    </distance>
    <maneuver>merge</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.0333486</lat>
     <lng>-3.9256659</lng>
    </start_location>
    <end_location>
     <lat>40.3957623</lat>
     <lng>-3.7039499</lng>
    </end_location>
    <polyline>
     <points>m_jsFlv}ViEkDWQsEqDu@m@]Yk@c@oAaAa@]IGKIa@[}@s@IIUQQMi@e@{@q@]YwAiAa@[e@_@UQyBeBw@o@m@e@oAaAu@m@yAkA]W?A]Wo@g@aF}Dq@i@oAcAWSQMAAMKWUq@g@mJuHo@g@q@i@eG}Ea@[CC]YoAcA}@q@g@c@[UWSo@i@YSWUOMKIWSWUYSQMKKKGKKQOWSWQWUo@e@YWWSYUUSYSi@c@YUYU}@u@}@s@WSWS[WKKWSUQSQs@g@_@[q@i@m@g@u@k@m@g@w@m@o@i@g@a@OKMMw@m@cBsAoDqCk@e@m@g@c@a@MKm@k@y@u@KIgAiA{A{AeBkBwCyCoBqBkAoAWWkBmBcAeAWWgAiAmAoAeAgA{@}@s@w@USa@a@w@y@e@g@u@w@QQ_@]KMKKoAqAaBeB}A_BGIAA}@_A_BaByA}AgAiAeAeACCk@q@SUS[U[Ua@Wc@Q_@Ui@Se@Qg@Og@K_@Me@Ki@Ie@EWMw@Gk@UoBSeBYmCMiAMeA[qCYmCIu@YyBE[UmBc@_EIy@_AeIK}@c@cE]sCa@sDAK]wCK_AQqASuBGc@yAuMk@cFCSE]?A?AACASAG?GCMESW_CAISkBUwB?CIi@MgAGa@Kq@WqA_@gBOm@_@gA_@iAc@iAISAASe@CIg@aAi@aAw@sA_@k@i@u@W[EEY_@OOs@w@i@k@c@_@e@a@SOm@c@[Uq@c@a@S_@SUMuAo@uBcA_@Qq@[wMoGYMOIwAq@_LiFCCkEsBgD_BqBaAuFmC_CgAeFgCq@_@sAu@iBcAgC_B_@W}@k@uBuAgCaBc@YWQa@WCC]UgDuBcBiAq@a@cBiAGCOK_@UWQQKc@YwDeCuA}@u@e@]UCCaCiBu@k@[YQQw@s@kAmA[]SUw@_Aq@}@o@}@U[g@w@i@_Ae@y@o@iA]o@_CwE[m@i@_Ak@_A{A{Bi@s@UYCCu@{@GEe@g@EEk@k@w@s@YWu@q@iA_AmA{@iAw@sAy@iCsAu@[qAs@}CcAaCq@aCk@w@OkEiAcEeAUGSGcAUqA[_AUeDy@aDy@cLwCoBi@aG{A]IqA]sD{@EAu@Sg@Mi@O]KsCq@qA]e@MkBe@yEoAu@SgBi@_A[sAe@MEaBk@uAe@y@Y{@YGA{@[CAyBs@SGaBm@yDoAeBo@i@QyCaAUIcBq@yAm@uB{@wFeCqAi@aBq@w@Y[KqBs@[KuAc@sBm@gAWiCm@wAYs@M_AOWEa@GSCQCYCUGqAQk@G{@K_@GyAY}A[}A]a@K_Be@ECy@WaA_@c@OSI[K_A]mDsAcA_@cBo@A?_@OkEaBmAe@KCiAe@}As@iB}@y@e@WMOIg@WoCiAsBw@s@WQIm@UgBq@m@Sy@[yCiAkAc@aA_@q@WwAg@uBy@}@[oAc@mA_@EAu@SQEmAY{@Sk@Oq@Sa@Mi@SEAaC}@qAe@uAi@A?kBq@wAk@kAi@cCmAi@Ww@]wAo@cBs@aC}@aC_ASGsCeAsCeA]Ma@Oe@Q]KmAe@OGOGQGgC_AaBm@gDoASIa@OiG{BiAa@mCcAYK]M{EgB}B{@]MmFoBWKYK_FiBKECAOGkCaAqDsA}FwBGCWKSGKEUIgAc@]K_@OcBo@]MA?]Mi@SGCMEMEYMcE{AsAi@kAa@kAe@CAEAWKGEi@Sw@_@c@UOIGEQKKIOIc@[e@_@i@e@OOUUa@c@Y]i@q@U]e@w@IOGMKO[m@Yq@Se@ACUk@Qg@KWSm@a@kAMa@k@eBCKy@cCM_@Qi@gAeDwAiEmAuD_@gAqDcLKYIWSk@{@mCk@aBk@cBKUEIKUAEQ]CGGM_@o@U]Y_@[a@]a@e@e@YWWSWUSMA?QMIEKGk@Yk@Uc@QUEWGg@KEAk@Gq@IaAEI@u@?W@{@Di@Ds@JA?E@oAR_APc@Fu@N}@NyAX{AV{@N{AXyAV{AXyB^uCf@sDn@{AXq@Lu@N}B^YFoAPkANs@BC@u@?m@CWAMAM?_AIw@Mk@MEAw@Ua@OOGc@QKGg@Uo@a@SO}@q@CCq@i@a@[aHsFeEeDm@g@o@i@q@i@g@_@_@YSOCCOKIGEEWQGEUQIEWWq@i@iCoB_BcAaB{@aBq@_A]]MqA_@{@SQEOCA?}@Oc@IE?A?QCmAM{@Gy@GA?_@CeFWkCOkBIyBKgBKyOy@G?MAYAs@ESCUA}DScCOa@C{BS}BYuB[yAY_Ce@yBg@}D_A{Cs@m@Mo@OoEeA}@UuCo@wCs@EAICMCYGiBa@eLiC}HiBmBc@_Bc@cAYm@Uu@[CA{@a@c@Ua@U[UECYQIG_@[g@c@][c@c@WYSW_@c@S[W_@S[S[O[U_@O]Q[M]O[ACK[Sg@EKGSK_@M_@GS]sAMk@Mm@CMKg@SeAI_@O{@Kq@GYu@kEUoAMu@e@iCSiA]kBWkAMc@Mg@Om@Y{@?AQi@_@{@e@aAuAgC{@mAsA{Aw@y@uAgAm@a@w@a@KGeBs@AA[KsAe@{Bo@GCc@Ma@KYIOEYIuCaA[M_@Qi@Uk@Yi@Yi@[}A}@MI_@UoAu@e@YqC_BsBmAUMeDqB{@g@i@[uCeB_@UaDmBgEeC_@U_Ak@_@Ue@Yy@e@iGsDeBcAs@c@i@]e@Ue@[IEiF}C_DkBwA{@SKmBiAuCeBGEyA{@MIcDmBmBiAaBaA}FiDaBaAi@]u@c@_@UeAo@uEoCcBaAwA}@sAw@yA{@aBaAaCwAcEcCu@a@OKeAq@iC_ByCaB_CuA{Aw@gB_AaDcBy@e@cB_AmEiCmBiA[SWO{A}@{A}@qAw@sAw@CA]UA?_@UiC{AKGWOGCSMy@a@w@]]Og@Ma@Ig@K]EOAa@C_@Ak@?c@Bw@Fc@DW@aAPkB^gDf@kEp@oInAcBX{@JiBZ_@F_@Fm@JgANiBZiBXc@FKBy@LoDj@G?eG`Am@Je@Fa@Fk@Jm@FsAHk@Bq@Am@Ak@Cs@Ia@IYI]K[Mi@YYSWOa@Yq@k@m@g@}@u@g@a@eByA}BkB{@s@MKc@]_Aw@}OsMaBsAuBcB]Y{AoA_@Yy@s@KG?AWSsBeBeCsBwBeBwAmA}BmBuBiBsAiAgByAa@_@wBeBcBuAGGAA_Aw@g@_@e@_@{AqAk@g@g@_@mAcAk@c@g@[c@Uc@Sm@S[I]I[G_@Ec@CCA_@AGAuDEgEWaBKgCOe@EyAIgAIs@Go@CkCQq@E{BIgAEa@A[AMAM?oBIs@EOAu@EGAI?s@G{@EoAIgAIA?G?aBKm@Ee@Cy@IWAYCyCSC?WCcAEKAC?OAsBOYCWAuDWIAMAE?u@G{@GKAuCW}Gm@o@GkAKc@EKAE?y@Im@GiAOiAOu@IgBSo@G_AIwAKqAIq@Ei@EsAIcAImCO{CUmCQSAWAe@CwBOWCWAKAc@CeAI[CG?EA]CaAGSAiEYw@GMAYAcAIwIm@A?IAIAmDS?AsBMI?{@Gk@EcAGsAKWAgBMQAk@Eg@Eg@E_@A_@CGA[CG?QAKAoAGq@AYCY?oAGoCK]?q@EUAiBIWCkAG}BMmF[aAGm@EkBMMAK?}DWSAq@Ec@EKAC?a@CIAG?E?iAIaAGEA_CMs@EsAKWAkAIKAe@CcCOGA{BMgDSeBMe@E_@EI?QCYAa@AWAQ?M?MAK?KAOA[CYCy@KUEMAKAKC[EgAWWGoAWYG{Co@q@MMEA?s@QYIWIq@[m@]EAa@W]S]WWYMO[[a@c@e@e@o@q@SSUWEEUUUWa@c@UWQQcAeAg@k@mAoAIKGG_@c@SSw@}@QSa@k@e@w@e@y@q@cBm@mBs@eCe@_BWy@[eA_@qAg@cBM_@M[O_@O_@Sc@IOAAS_@QWGKOWMOMQW[SWSSKIIG{BqBQQMKCCAAA?SQSS_Ay@u@q@_@]CAAACCCCi@e@KKYWAAs@k@[Y][a@_@WUm@g@</points>
    </polyline>
    <duration>
     <value>1825</value>
     <text>30 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;A-42&lt;/b&gt;</html_instructions>
    <distance>
     <value>47071</value>
     <text>47.1 km</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.3957623</lat>
     <lng>-3.7039499</lng>
    </start_location>
    <end_location>
     <lat>40.4001319</lat>
     <lng>-3.7183967</lng>
    </end_location>
    <polyline>
     <points>oxpuFtlrUIWEGGIEGAGEOAKAA?EAI?G@G?A?IBK@IBI?ADIDIDKJOHKLKHIJGDAFEDAFADADAP@H@BB@?HDDBFFBB@D@BBFBF@H?L?N@b@EHGFUd@Ud@CHg@tAQr@EPGTGRMj@?@Id@ABQ|@?l@?TETETEVCNADMl@q@rDKf@ENMj@ABCJ]tAENCJ?@Oh@ELIZMh@Oh@ENGXA@Of@Qj@Yx@Yr@Sf@_@`A]n@CFQ^CDCDEFEJEJ{BfD_AzAWb@MPINQXEHQ\CFOd@A@Oh@AB[|BAHIl@EREVIl@Ij@SzAEPER?j@@\?HDn@@`@Fz@@LB~@FlA</points>
    </polyline>
    <duration>
     <value>88</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Take exit &lt;b&gt;2A&lt;/b&gt; to merge onto &lt;b&gt;M-30&lt;/b&gt; toward &lt;b&gt;A-5&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Badajoz&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;A-6&lt;/b&gt;</html_instructions>
    <distance>
     <value>1693</value>
     <text>1.7 km</text>
    </distance>
    <maneuver>ramp-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4001319</lat>
     <lng>-3.7183967</lng>
    </start_location>
    <end_location>
     <lat>40.4026657</lat>
     <lng>-3.7219427</lng>
    </end_location>
    <polyline>
     <points>ysquF~fuU?\@T?H@V?V?HAd@?@Cj@Gf@E\GXADCHCJGNABCBMRGFGFKJODQBMBM@K?KAGAQG]BC@I@OBC@SHEBIBUJa@ZYZKLKPGHMZIPUx@EDMPY`@</points>
    </polyline>
    <duration>
     <value>36</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;M-30&lt;/b&gt;</html_instructions>
    <distance>
     <value>473</value>
     <text>0.5 km</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4026657</lat>
     <lng>-3.7219427</lng>
    </start_location>
    <end_location>
     <lat>40.4087686</lat>
     <lng>-3.7214006</lng>
    </end_location>
    <polyline>
     <points>ucruFb}uUkA\YDK?a@DYBc@BA?aAHi@FW@e@Du@BQ?c@?i@C]AC?KASCc@Gi@Kc@KYGECk@OoA_@q@UYKICy@UMEo@Iw@EyAA</points>
    </polyline>
    <duration>
     <value>35</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;M-30&lt;/b&gt;</html_instructions>
    <distance>
     <value>692</value>
     <text>0.7 km</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4087686</lat>
     <lng>-3.7214006</lng>
    </start_location>
    <end_location>
     <lat>40.4110837</lat>
     <lng>-3.7213530</lng>
    </end_location>
    <polyline>
     <points>yisuFvyuUm@QMAk@BQ?Q@A?a@@A?S@M?A?Y?G@c@?U@G?i@@Q?A?O?E?G@S?A?K?UG</points>
    </polyline>
    <duration>
     <value>28</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Slight &lt;b&gt;right&lt;/b&gt; (signs for &lt;b&gt;Pᵒ V. del Puerto&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;C/&lt;wbr/&gt; Segovia&lt;/b&gt;)</html_instructions>
    <distance>
     <value>259</value>
     <text>0.3 km</text>
    </distance>
    <maneuver>turn-slight-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4110837</lat>
     <lng>-3.7213530</lng>
    </start_location>
    <end_location>
     <lat>40.4139789</lat>
     <lng>-3.7209563</lng>
    </end_location>
    <polyline>
     <points>gxsuFlyuUkAAIAu@Co@Ew@GUCk@GGAmBSUAsAKm@G</points>
    </polyline>
    <duration>
     <value>55</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Merge onto &lt;b&gt;P.º de la Virgen del Puerto&lt;/b&gt;</html_instructions>
    <distance>
     <value>324</value>
     <text>0.3 km</text>
    </distance>
    <maneuver>merge</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4139789</lat>
     <lng>-3.7209563</lng>
    </start_location>
    <end_location>
     <lat>40.4138980</lat>
     <lng>-3.7119377</lng>
    </end_location>
    <polyline>
     <points>kjtuF~vuUBu@?m@@_D?q@@kB@y@?e@?a@@{A@iC?C?e@?k@?mA?E?S@e@?}A?]?q@?u@?mC?i@?K?_@?M?O?C?G?]?I?W?_A?}A?M@c@?IAQ</points>
    </polyline>
    <duration>
     <value>114</value>
     <text>2 mins</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt; onto &lt;b&gt;C. de Segovia&lt;/b&gt;</html_instructions>
    <distance>
     <value>764</value>
     <text>0.8 km</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4138980</lat>
     <lng>-3.7119377</lng>
    </start_location>
    <end_location>
     <lat>40.4144408</lat>
     <lng>-3.7125434</lng>
    </end_location>
    <polyline>
     <points>{ituFr~sUS?W?A?A?A@ERGZCHEREPELAD?@A@A@A?A@A?A?CAAAAA</points>
    </polyline>
    <duration>
     <value>26</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;left&lt;/b&gt; onto &lt;b&gt;C. de la Villa&lt;/b&gt;</html_instructions>
    <distance>
     <value>95</value>
     <text>0.1 km</text>
    </distance>
    <maneuver>turn-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4144408</lat>
     <lng>-3.7125434</lng>
    </start_location>
    <end_location>
     <lat>40.4149910</lat>
     <lng>-3.7122205</lng>
    </end_location>
    <polyline>
     <points>gmtuFjbtUEKCECCCCACEAC?iALEm@</points>
    </polyline>
    <duration>
     <value>23</value>
     <text>1 min</text>
    </duration>
    <html_instructions>&lt;b&gt;C. de la Villa&lt;/b&gt; turns &lt;b&gt;right&lt;/b&gt; and becomes &lt;b&gt;C. del Pretil de los Consejos&lt;/b&gt;</html_instructions>
    <distance>
     <value>84</value>
     <text>84 m</text>
    </distance>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4149910</lat>
     <lng>-3.7122205</lng>
    </start_location>
    <end_location>
     <lat>40.4152243</lat>
     <lng>-3.7122597</lng>
    </end_location>
    <polyline>
     <points>uptuFj`tUm@F</points>
    </polyline>
    <duration>
     <value>8</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;left&lt;/b&gt; onto &lt;b&gt;C. del Sacramento&lt;/b&gt;</html_instructions>
    <distance>
     <value>26</value>
     <text>26 m</text>
    </distance>
    <maneuver>turn-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4152243</lat>
     <lng>-3.7122597</lng>
    </start_location>
    <end_location>
     <lat>40.4165207</lat>
     <lng>-3.7050760</lng>
    </end_location>
    <polyline>
     <points>crtuFr`tUCMIaACYAOE]C[AAI{@?CSiBGk@ESE[UuAESAGCKIg@EWIm@Ge@?GIe@Ga@Ge@AC?IAG?CGo@Ek@Gq@Ek@?ICSEs@CYOiBCa@QkC</points>
    </polyline>
    <duration>
     <value>184</value>
     <text>3 mins</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt; onto &lt;b&gt;C. Mayor&lt;/b&gt;</html_instructions>
    <distance>
     <value>626</value>
     <text>0.6 km</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <duration>
    <value>3446</value>
    <text>57 mins</text>
   </duration>
   <distance>
    <value>74327</value>
    <text>74.3 km</text>
   </distance>
   <start_location>
    <lat>39.8628080</lat>
    <lng>-4.0273727</lng>
   </start_location>
   <end_location>
    <lat>40.4165207</lat>
    <lng>-3.7050760</lng>
   </end_location>
   <start_address>Toledo, Spain</start_address>
   <end_address>Madrid, Spain</end_address>
  </leg>
  <copyrights>Map data ©2022 Inst. Geogr. Nacional</copyrights>
  <overview_polyline>
   <points>quhrF`rqWcHzBaNzDeG~A][?k@lA{Dr@mBR]HmA[WQDWE[g@mAeE?]QOeAcE[_EEuKHMCo@_@IyBoAgAYUd@KXWDmMUqFWKWi@ASR]L}A@yM[yEe@cCs@uCiAcCUiCAmBa@sDsAcCUcKHgLB}EScJ_BwLwCsOkCaQaEgOsDmIwCuGkCuJeE}DcCeG{CkPiGgx@eZuUyIeNyEwNcCcOoC_V{HcHuAkFeAaCy@uGiDeKiH{GuDmV}PcIwCaM}DqY{QuE_D_IyGoOmIwGqEoO}KqZoRqX_RqpA_z@qe@{ZgIoEgNgF{IqBqN_BsGOeGD}SrAwDTkIJqFa@oFmA_FuBqEyCcEaEkDaFqC{FmCqH{DwMiPij@kEyLkJcSwE_IaGmIgIoJkP_Oau@kl@a_A}t@i[}VwQyNkN}KoLkLu_@o`@cXyXiB_CuAoCkBcHyIqv@yIiw@i@sEmB_OoBgHcAeCuFeJsGiGqJcFoa@uRge@iUwb@mXaMcIyEoDqDmDqHcKsFkKmEiHyEmFqE}DuJaGgCoA_HuBiQkEk^cJim@qOoc@aO}HoCyOyGgHkCmHuBuL{BaMoByKeD_T_IaGcCkE{BuPwG_T_IaL}CoLeEqToJue@iQwm@aUi]iMkMyE{FeCyDqCaBgBoBwCgC{FgEiMoTip@gDeFaDiCcBw@yBk@eDYsCHyG`AwRlD_XvEsEf@iCGqDe@oBo@gCqAgCoBaVkRoA_A{IsGaHyCoD}@gGs@{WuAgTiA_N{@mMuBu]eI}_@{I_IwByCuAmEeDcEmFsBoEoB{G_BqIwEaWw@sCmDoHoCiDmCaCwE_CuIkC{E_B_D{AqPwJem@g^q|Aa~@iNiI_LaG}UkNeIyEmCqAoCs@oBMkDPi`@bGob@xGoEd@wDCmCi@wBkAgO_Ma^wYqc@{^cKqIiEcDqCgAiDa@gRy@{Fa@}Nq@iGYmXeB{^uC}JeAsOqAc^}B{v@gFeZqAuYgBwm@}DkGmA}EcAwCaAsBkA_B}AsE{EuGcH}BiC_DaGqGiTsBiE_CwCaEoDyI{HeCyB]q@KeAHm@jAyAbAKb@^J\CjA_CnG_@fBSdCcBbJoCrKkDbJgFnIyAfCeAdFiAtHVnHHjFc@hD[j@k@`@y@HcAG{Af@sAvAu@pBSVY`@kA\e@D{@HqCTeCJsDSuHuBqA_@oFc@wCFqFFkIi@_Fc@m@GBu@@mEB}FBkG@{I?sQ?mAo@?g@tBKFY_@uAFEm@m@FMoAOcB_@kD_AaGs@eFqAsQ</points>
  </overview_polyline>
  <bounds>
   <southwest>
    <lat>39.8628080</lat>
    <lng>-4.0294068</lng>
   </southwest>
   <northeast>
    <lat>40.4165207</lat>
    <lng>-3.7026134</lng>
   </northeast>
  </bounds>
 </route>
 <geocoded_waypoint>
  <geocoder_status>OK</geocoder_status>
  <type>locality</type>
  <type>political</type>
  <place_id>ChIJ8f21C60Lag0R_q11auhbf8Y</place_id>
 </geocoded_waypoint>
 <geocoded_waypoint>
  <geocoder_status>OK</geocoder_status>
  <type>locality</type>
  <type>political</type>
  <place_id>ChIJgTwKgJcpQg0RaSKMYcHeNsQ</place_id>
 </geocoded_waypoint>
</DirectionsResponse>

A directions request for "Toledo" to "Madrid" sent without a region parameter does not return results, because "Toledo" is interpreted as the city in Ohio and not Spain:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Madrid
  &origin=Toledo
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Toledo&destination=Madrid&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

JSON

{
  "geocoded_waypoints":
    [
      {
        "geocoder_status": "OK",
        "place_id": "ChIJeU4e_C2HO4gRRcM6RZ_IPHw",
        "types": ["locality", "political"],
      },
      {
        "geocoder_status": "OK",
        "place_id": "ChIJgTwKgJcpQg0RaSKMYcHeNsQ",
        "types": ["locality", "political"],
      },
    ],
  "routes": [],
  "status": "ZERO_RESULTS",
}

XML

<DirectionsResponse>
 <status>ZERO_RESULTS</status>
 <geocoded_waypoint>
  <geocoder_status>OK</geocoder_status>
  <type>locality</type>
  <type>political</type>
  <place_id>ChIJeU4e_C2HO4gRRcM6RZ_IPHw</place_id>
 </geocoded_waypoint>
 <geocoded_waypoint>
  <geocoder_status>OK</geocoder_status>
  <type>locality</type>
  <type>political</type>
  <place_id>ChIJgTwKgJcpQg0RaSKMYcHeNsQ</place_id>
 </geocoded_waypoint>
</DirectionsResponse>

Location Modifiers

You can use location modifiers to indicate how drivers should approach a particular location, by using the side_of_road parameter to specify which side of the road to use, or by specifying a heading to indicate the correct direction of travel. These modifiers may be freely mixed with the via: modifier for intermediate waypoints.

Specify that routes must pass through a particular side of the road

When specifying a waypoint, you can request that the route go through whichever side of the road the waypoint is biased towards by using the side_of_road: prefix. For example, this directions request will return a long route so that the vehicle ends on the side of the road to which the waypoint was biased:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=side_of_road%3A37.7663444%2C-122.4412006
  &origin=37.7680296%2C-122.4375126
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=37.7680296%2C-122.4375126&destination=side_of_road%3A37.7663444%2C-122.4412006&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=37.7680296%2C-122.4375126&destination=side_of_road%3A37.7663444%2C-122.4412006&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=37.7680296%2C-122.4375126&destination=side_of_road%3A37.7663444%2C-122.4412006&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=37.7680296%2C-122.4375126&destination=side_of_road%3A37.7663444%2C-122.4412006&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=37.7680296%2C-122.4375126&destination=side_of_road%3A37.7663444%2C-122.4412006&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=37.7680296,-122.4375126&destination=side_of_road:37.7663444,-122.4412006&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

When using side_of_road: with encoded polylines, the parameter is applied to every location along the polyline.

The side_of_road: modifier may only be used with the following restrictions:

  • The travel mode parameter is driving, or is not specified (driving is the default travel mode).

Specify that routes should have a particular heading

When specifying a waypoint, you can request that the route go through the waypoint in a particular heading. This heading is specified with the prefix heading=X:, where X is an integer degree value between 0 (inclusive) and 360 (exclusive). A heading of 0 indicates North, 90 indicates East, and so on, continuing clockwise. For example, in this directions request the route goes east from the origin, then takes a U-turn:

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=37.773245%2C-122.469502
  &origin=heading%3D90%3A37.773279%2C-122.468780
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=heading%3D90%3A37.773279%2C-122.468780&destination=37.773245%2C-122.469502&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=heading%3D90%3A37.773279%2C-122.468780&destination=37.773245%2C-122.469502&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=heading%3D90%3A37.773279%2C-122.468780&destination=37.773245%2C-122.469502&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=heading%3D90%3A37.773279%2C-122.468780&destination=37.773245%2C-122.469502&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=heading%3D90%3A37.773279%2C-122.468780&destination=37.773245%2C-122.469502&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=heading=90:37.773279,-122.468780&destination=37.773245,-122.469502&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

The heading=X: modifier may only be used with the following restrictions:

  • The travel mode parameter is driving, bicycling, or is not specified (driving is the default travel mode).
  • The side_of_road modifier is not specified for the same location.
  • The location is specified with a latitude/longitude value. You may not use heading with addresses, Place IDs, or encoded polylines.

Directions responses

Directions responses are returned in the format indicated by the output flag within the URL request's path.

A sample HTTP request is shown below, calculating the route from Chicago, IL to Los Angeles, CA via two waypoints in Joplin, MO and Oklahoma City, OK.

URL

https://maps.googleapis.com/maps/api/directions/json
  ?destination=Los%20Angeles%2C%20CA
  &origin=Chicago%2C%20IL
  &waypoints=Joplin%2C%20MO%7COklahoma%20City%2C%20OK
  &key=YOUR_API_KEY

cURL

curl -L -X GET 'https://maps.googleapis.com/maps/api/directions/json?origin=Chicago%2C%20IL&destination=Los%20Angeles%2C%20CA&waypoints=Joplin%2C%20MO%7COklahoma%20City%2C%20OK&key=YOUR_API_KEY'

JavaScript

var axios = require('axios');

var config = {
  method: 'get',
  url: 'https://maps.googleapis.com/maps/api/directions/json?origin=Chicago%2C%20IL&destination=Los%20Angeles%2C%20CA&waypoints=Joplin%2C%20MO%7COklahoma%20City%2C%20OK&key=YOUR_API_KEY',
  headers: { }
};

axios(config)
.then(function (response) {
  console.log(JSON.stringify(response.data));
})
.catch(function (error) {
  console.log(error);
});

Python

import requests

url = "https://maps.googleapis.com/maps/api/directions/json?origin=Chicago%2C%20IL&destination=Los%20Angeles%2C%20CA&waypoints=Joplin%2C%20MO%7COklahoma%20City%2C%20OK&key=YOUR_API_KEY"

payload={}
headers = {}

response = requests.request("GET", url, headers=headers, data=payload)

print(response.text)

Java

OkHttpClient client = new OkHttpClient().newBuilder()
  .build();
MediaType mediaType = MediaType.parse("text/plain");
RequestBody body = RequestBody.create(mediaType, "");
Request request = new Request.Builder()
  .url("https://maps.googleapis.com/maps/api/directions/json?origin=Chicago%2C%20IL&destination=Los%20Angeles%2C%20CA&waypoints=Joplin%2C%20MO%7COklahoma%20City%2C%20OK&key=YOUR_API_KEY")
  .method("GET", body)
  .build();
Response response = client.newCall(request).execute();

Ruby

require "uri"
require "net/http"

url = URI("https://maps.googleapis.com/maps/api/directions/json?origin=Chicago%2C%20IL&destination=Los%20Angeles%2C%20CA&waypoints=Joplin%2C%20MO%7COklahoma%20City%2C%20OK&key=YOUR_API_KEY")

https = Net::HTTP.new(url.host, url.port)
https.use_ssl = true

request = Net::HTTP::Get.new(url)

response = https.request(request)
puts response.read_body

Go

package main

import (
  "fmt"
  "net/http"
  "io/ioutil"
)

func main() {

  url := "https://maps.googleapis.com/maps/api/directions/json?origin=Chicago,%20IL&destination=Los%20Angeles,%20CA&waypoints=Joplin,%20MO%7COklahoma%20City,%20OK&key=YOUR_API_KEY"
  method := "GET"

  client := &http.Client {
  }
  req, err := http.NewRequest(method, url, nil)

  if err != nil {
    fmt.Println(err)
    return
  }
  res, err := client.Do(req)
  if err != nil {
    fmt.Println(err)
    return
  }
  defer res.Body.Close()

  body, err := ioutil.ReadAll(res.Body)
  if err != nil {
    fmt.Println(err)
    return
  }
  fmt.Println(string(body))
}

Postman

The OpenAPI specification is also available as a Postman collection.

Run in Postman

The above example requests JSON output. It's also possible to request XML output. Select the tabs below to see the sample JSON and XML responses.

JSON

{
  "geocoded_waypoints":
    [
      {
        "geocoder_status": "OK",
        "place_id": "ChIJ7cv00DwsDogRAMDACa2m4K8",
        "types": ["locality", "political"],
      },
      {
        "geocoder_status": "OK",
        "place_id": "ChIJ69Pk6jdlyIcRDqM1KDY3Fpg",
        "types": ["locality", "political"],
      },
      {
        "geocoder_status": "OK",
        "place_id": "ChIJgdL4flSKrYcRnTpP0XQSojM",
        "types": ["locality", "political"],
      },
      {
        "geocoder_status": "OK",
        "place_id": "ChIJE9on3F3HwoAR9AhGJW_fL-I",
        "types": ["locality", "political"],
      },
    ],
  "routes":
    [
      {
        "bounds":
          {
            "northeast": { "lat": 41.8781139, "lng": -87.6297872 },
            "southwest": { "lat": 34.0523525, "lng": -118.2435717 },
          },
        "copyrights": "Map data ©2022 Google, INEGI",
        "legs":
          [
            {
              "distance": { "text": "579 mi", "value": 932311 },
              "duration": { "text": "8 hours 48 mins", "value": 31653 },
              "end_address": "Joplin, MO, USA",
              "end_location": { "lat": 37.0842449, "lng": -94.513284 },
              "start_address": "Chicago, IL, USA",
              "start_location": { "lat": 41.8781139, "lng": -87.6297872 },
              "steps":
                [
                  {
                    "distance": { "text": "443 ft", "value": 135 },
                    "duration": { "text": "1 min", "value": 24 },
                    "end_location": { "lat": 41.8769003, "lng": -87.6297353 },
                    "html_instructions": "Head <b>south</b> on <b>S Federal St</b> toward <b>W Van Buren St</b>",
                    "polyline": { "points": "eir~FdezuOdCEjBC" },
                    "start_location": { "lat": 41.8781139, "lng": -87.6297872 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "269 ft", "value": 82 },
                    "duration": { "text": "1 min", "value": 20 },
                    "end_location": { "lat": 41.8768866, "lng": -87.63073 },
                    "html_instructions": "Turn <b>right</b> at the 1st cross street onto <b>W Van Buren St</b>",
                    "maneuver": "turn-right",
                    "polyline": { "points": "sar~FzdzuO@fC?|@" },
                    "start_location": { "lat": 41.8769003, "lng": -87.6297353 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.6 mi", "value": 887 },
                    "duration": { "text": "3 mins", "value": 182 },
                    "end_location": { "lat": 41.8689131, "lng": -87.630596 },
                    "html_instructions": "Turn <b>left</b> at the 1st cross street onto <b>S Clark St</b>",
                    "maneuver": "turn-left",
                    "polyline":
                      {
                        "points": "qar~F`kzuOlBAb@?zA?\\CnBAZAt@?P?xAAl@C~EGxA?pAAJ?bAAL?NDr@?d@@J?f@?XAf@?rBAH?T?\\?B?v@AZ?",
                      },
                    "start_location": { "lat": 41.8768866, "lng": -87.63073 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.1 mi", "value": 1777 },
                    "duration": { "text": "3 mins", "value": 196 },
                    "end_location": { "lat": 41.852949, "lng": -87.6300619 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>S Clark St</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "uop~FfjzuOJEBAB?d@Az@ArACXAl@?V?V?VAb@?jBA~AAJCpAKb@AJ?dACd@@TA\\CR?x@Ef@AzA?h@?lAC|BAt@C^?ZA|ABn@@j@?b@Af@?`@?b@Ax@AnC?rDCx@A`AA~@AhBAnBChBAL?v@A|FGP?bACTAZ?^CN?",
                      },
                    "start_location": { "lat": 41.8689131, "lng": -87.630596 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "269 ft", "value": 82 },
                    "duration": { "text": "1 min", "value": 20 },
                    "end_location": { "lat": 41.85294, "lng": -87.6310536 },
                    "html_instructions": "Turn <b>right</b> onto <b>W Cermak Rd</b>",
                    "maneuver": "turn-right",
                    "polyline": { "points": "}km~FzfzuO?~A?j@@n@?H" },
                    "start_location": { "lat": 41.852949, "lng": -87.6300619 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.2 mi", "value": 336 },
                    "duration": { "text": "1 min", "value": 36 },
                    "end_location": { "lat": 41.8500987, "lng": -87.6310927 },
                    "html_instructions": "Turn <b>left</b> onto the <b>I-55 S</b>/<wbr/><b>I-90 E</b>/<wbr/><b>I-94 E</b> ramp",
                    "maneuver": "ramp-left",
                    "polyline":
                      { "points": "{km~F`mzuO?n@\\?hACfACjBClCED?fCU" },
                    "start_location": { "lat": 41.85294, "lng": -87.6310536 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "136 mi", "value": 218546 },
                    "duration": { "text": "2 hours 4 mins", "value": 7436 },
                    "end_location":
                      { "lat": 40.4505676, "lng": -89.02339479999999 },
                    "html_instructions": 'Keep <b>right</b> at the fork, follow signs for <b>I-55 S</b>/<wbr/><b>St Louis</b>/<wbr/><b>Stevenson Expy</b> and merge onto <b>I-55 S</b>/<wbr/><b>Stevenson Expy</b><div style="font-size:0.9em">Continue to follow I-55 S</div>',
                    "maneuver": "fork-right",
                    "polyline":
                      {
                        "points": "czl~FhmzuOXPF?r@@n@BV@T?n@B^@@?B?N@LBD@D@NDNFHFJHDDLPJNFLFNFPDR@?BND\\@L@L?V?f@?L@F?f@?X@f@?X@BDj@?B@DLv@Lt@Fd@BVL~@BVLlBHzADjA?BFVB|D@lC@xDBhG?j@?fA@X?L?P?P?\\@^?H@T@\\?P@FB`@Dl@Dj@Hj@?@Ff@Jj@@FHb@DVH\\HXHZNh@Jb@h@hB\\tANj@H\\DRLh@Lz@Hn@JbADd@HhBFpBNzEBrA@RBXFt@Fv@BLD`@Fd@Hh@Nx@BP\\|AFR@DNj@^lAL\\BJr@|BBFHXn@nBJZfApDpAxDfBlF@BPd@Zx@Vt@DHf@pAPd@Rh@Rd@dBfEbAfCr@zAt@|Ar@bBJPh@lAxCjGp@tAhBtDRb@N^P^Rl@J\\FRHXLf@HXH\\BFDTFXDVPlABLD\\@FBXB`@FjAJnCB~A@|@?n@@~A?V@X?z@@`@?bAB|B?h@@hA?Z?p@@P@bB?X?PBlD@R?n@@rA@h@@rB@rB@lCB\\@\\DfABd@B`@Fz@Hv@Hr@BNF\\X`BVfADPVlA^bBPz@hAnFh@~Bl@bD@?@LBH?@T`A@F^bBvBxJJj@FXLj@Jd@Rz@Ld@Np@TdA~@dEDNTfAj@nCNt@`AnEdA~EdA`FDRDLBLF\\Rx@BNFXH^l@tChHr\\dBdIFXBLNp@@B?@~@bE`@lBFVzF~Wf@|BDVJf@P~@dArE^bBdAdF`BtHLj@x@tDhAlFDP@BVjAZnALj@ZtA`@rBv@nDFXdA|Ep@`Dd@tBPz@J`@H^DP?@@BfA`Fx@|D~@fEjB`JR`AlAxFH^p@~C\\xATlAfBlIhBpId@vBf@vBPv@^fBd@xB~@dE^`Bl@tD@JPbA`@`DJl@T~AF\\BRLh@@JDN@D?@@B?BVfAZlAv@lC`@lA?BPh@DJVz@vEnRp@bDXnAl@nCn@xCTbAp@xCxBhKjAjFNp@VlA`@lBvAnGVlAh@bC|BnKh@dCHZBNJb@x@xDb@rBDPrAjGLj@jAnFFXlAtFvAxGR|@fA~ERdArBpJ|DlQdCvLjBxI|AhH|BnKJd@@FnCdMdCdLBJZxAf@~BdCdLf@|BLl@^dB~BpMHd@r@xELdA?BxAdNVdBRtAHf@Jj@Jp@^hBHb@BFf@dC^vANl@|@~CBJNd@BD^lAbApCNZrAlDtAlDHXLb@@?Jd@J^H`@Hf@F`@D`@Hr@Dn@HrA@\\?R@t@?FAjAAt@EbCGbCE~A?D?J?^A|AAp@DhFBX@^Bf@N|AP~APhAP~@BJTdA^tAd@tAh@rA@D\\v@Xl@\\l@\\f@Zh@`@j@n@v@f@l@bA~@^ZFH\\\\@@d@d@hCdCJJh@f@NN`A~@lDhD\\Z`EzDfC`CvBtBdMtLdC~BRPTXf@h@`@b@`@b@vA`BVXh@n@dArAnAfBvBdDdDxF@BjCzEp@fAnBtCrBjC|@dANP~BfCVXZ\\ZZ|FhG\\^Z\\DBzEhFhBnBb@d@NPJJd@f@tBzB~BbCf@f@v@p@nAfA@@`At@tAbAhBrA`Ap@hAv@DB\\VXRn@b@z@n@t@f@|@n@dBjAv@h@LHNLp@d@zDnCxBzAvAjArArA`AjA\\f@V`@T`@b@z@h@hAXz@Pl@Rt@Pr@RfAF^BPHp@JnAH~@|BpZF|@RnCRlC`@pFHlAJnAVzDDn@d@zGx@vKX~D?BBZ@JDl@`@lFb@hGX|Df@~HHlBBn@@b@LbIHtJBxC?FJfQ@xBHtI?vD?LC~CAfBE`DAd@An@EnC?HExD?~C?xD@tF@lB?X?^@|A?t@?D@pDJ`L@dC@bCFpHH|HFpH?P?HBjD@XDrDBx@NnCHrAXdDb@~C?DDXXbBTdAHd@R~@Rv@Rt@DRVz@FPzCrJHP`AxC~@tCj@fB?@r@bCx@bCp@tB?@HVBDHVPf@?@ZbAd@xABDb@vANd@b@rA\\bAh@bBz@~C~BbH|AtEh@`BPf@Z~@t@|B`@pARn@x@fCNb@d@vAfAfDl@jBXz@FTv@zB@Bj@`Br@nBN^HPRf@|CjHh@fA`@v@x@bBtBzDDHPZvBrDr@fABBv@lApBvCrAfBp@|@~ChEX`@bCnD`@h@f@r@b@v@b@r@^p@@Dj@bAf@bAJVR`@Zr@Xn@j@tA\\z@^dAh@|A\\fAd@rALf@Nd@HVBFRp@t@hCL^BJPl@^lAL^BJL\\v@jCNf@~AnFHVp@zBrAlFt@xCf@rB|@jD`@hBDTDNb@fBDTx@hDNj@z@lDhBpHJb@z@hDH`@VbAp@vCnAjFT~@Ld@dApE\\pALj@jDpNf@pBTbANh@Lh@Rx@dAjEH\\Lf@l@hCPp@Pr@vAzFNp@Np@dCbKb@~A|BlJH\\`AhEjDnNb@dB@BJ`@n@hCJf@Lh@Lf@@Bf@tBBLl@dCRx@\\tAp@pCf@tBd@hBd@pBZpAd@hBj@pB~@dDNj@JXdAhDj@~APh@|@dCz@|Bt@nBBDr@fBr@dBhApCr@fBvBnFTj@l@vAnBxEZp@bC`GzCfHPb@`A|Bb@bAj@vAtAdDzAnD^z@\\x@h@rAd@fA`AzB`BzDDLb@`Af@lATf@h@rAxBhF|@vBlArCJVr@`Bj@nArBpFx@nBJVrAfDpArClCrGrBvEd@dAnBvEt@fBbB~DnBtEN^FJdBfEjBlEBFJRh@rAHPN\\dBbER`@bA`CLZdA`C`@|@jApCzCjHlAvCh@nAVl@n@vAd@hAtCzGDJN\\Vp@Vh@fChGVl@h@pArB~EzApD\\|@jClGt@fBt@fBL\\Rf@BBh@nAdBfEzEfLt@fBFP@B@@HTzAnDP`@l@xADJtAbDTj@\\x@pB|E^|@`CvFBHTf@Rf@x@rBfBhEh@nARf@rFtMJTFNJTFPLXFLDNFLFLJXtSbg@Xn@x@lBjArCDJN`@Vj@j@rAv@lBRb@Pb@FN`AzB^|@@@Tn@@@b@hAx@jBPb@hCfGDHVn@h@hARf@JR~ArD~BbFhBzD\\t@`@x@rA~CxA`DzAjDXp@z@jBl@|Av@hBnA~CxD`Jh@pA@@jBlEj@rAt@fBt@dBVl@v@nBxBjFdD|HxBjFN\\BHLV@Dp@|Ab@dArB~EP`@d@fAnBvE\\x@DJt@fB\\x@lBrEZt@t@dB`@v@fF~LL\\zAlDn@bBp@bBpAzCh@pAx@nBP`@jDfId@fAFLvAhD@BJVZr@dDzHJVxCbH|ArDh@nAnBvEz@tBp@~ABHLXBF@@HRVl@P^DNd@lAdC|F@DP`@@B`DvHtExKxDhJN\\N`@Th@HTDHVp@h@vAj@|A@Dl@bB`@rAh@xA|@pCh@~ARp@Ph@?@vAnE`AzCTr@b@rAb@nAhArDfAlD|@pC~@tCpA`EdAtCp@jBt@jBt@hBn@zAp@zADLlCxFz@hBVh@Xn@fA`Cp@vAr@zA`@|@l@nA~@rB|CvGx@dBbBnD|CrGpC`GlAjCTd@DHhBzDP^h@lAj@jABHpApC`D~GnC~FbCfFLXjAjCtBpEhClFfCdElArBtCzDTZlCtC~BbCfAb@^XDDt@d@h@XlAr@lAl@tAl@x@Xx@Xp@RNFPD@?h@Nn@NzAZ^HVDj@HP@d@HTBJ@f@Dj@D|@Fl@@h@BR?X?h@?b@?fA?jJEzFC`AAb@?b@?rDCdEApHEb@?rDApAA|@Ab@?zBAfECb@?rDCb@?J?fDAzECbIEvBAbEAlDCtCAlCApAAfA?rGCnAAbCAb@?fAA~QIlBAb@?vJGnDAfDArCC~JEfJOjA@l@@jCJhBHN@XB^D^DLBVBTFRBZFb@Ht@Pj@Rl@Rl@Px@ZXLnB~@jAr@r@d@v@l@ZPj@d@d@`@b@^z@~@xA~Az@hAr@~@b@f@bDlEv@`A?@Z^X^PVrAdBX^RV@@pAdB`C|CV\\d@l@nA`BbArAdLdODFDFHJrBlCX^p@z@\\d@rA`BHHn@x@vAxAZVp@l@x@p@h@b@@?\\V\\V^Tj@^rBlA`@RhAf@z@\\x@\\h@Ph@Pp@Tl@NHBz@PdATj@H|@Nt@H`@Ff@F~@D|AH~ABrBAB?lCEd@AlAA`@A|CEr@Ab@Ab@Ab@AlACxACvBE|GKvIKhDIzBCbKQb@AfAAl@C~JOpGKvBE`@AfJM~EI|FKdGKv@AzKS`CGzFI`BCxCGz@AdCET?ZAV?PAxACvAAz@A\\?H?t@?jABx@Bt@DN@lAFr@FvAPv@JhARfARjAVt@RtA^fBj@pAf@~@^hAf@BBj@VpAr@n@\\^TfJvFxK|Gz@h@t@d@hC|A|AdARLlIdFrBlAHDfAp@lBlAlDtBnAx@nFbDhDvBhF`DjEjCrAx@^VDB@@XNXPtAx@l@`@jC`BhAp@^T^TtFhD@@dAp@t@b@jBhAlAr@p@^jB~@v@\\VL^Np@VdBj@r@TLD`@LD@ZHVFn@NVFd@HdAT|@LF@B@dAN~@Hj@FfAH~@DtAFrABzA@pDENAb@?D?\\AhDEtBCxDGp@AN?lEGlEEvDGb@AfAC~CE|EGrDElFIvBEnBEjEGdCEtCEhDGlFGnHIfBA`@AzBCpAAT?bEChB?nA@vD?h@?j@?j@?`BAlAAnA?B?F?~@?@?^Ad@?tACX?D?|@A\\?zCEZ?B?@?ZAzDEjAAhAAl@A~@Ab@AbBCF?b@AlBCh@AzAArBAhAAjACb@ApDKjBI`@C`@AlBIlAE@?ZA@?h@CVALAR?^CbCIZC`@Cd@Ah@CVAbAE^A`@A`AEjAEh@AtBKnAEn@ChAExAGJ?|DO@?`@AJ?xKOL?dBEN?p@Ap@A|AED?ZA^?D?fAAB?X?DAjBEJ?P?DArDG`BEfCKxACtAGfBEtCKd@ApDMF?v@CbBEr@Cb@AJ?VAVAZAt@Cn@A^Ah@A@?zBERAN?D?~@Al@A`BCb@Ax@AL?T?L?RAdEElCETAp@Ab@?fAAx@CL?fAAb@AT?LAnCCjACT?hAC|AChAAX?b@AH?zBA`@AN?TAl@AlAAj@A~@CJ?F?r@AR?N?jBCPAd@?l@AD?J?p@Al@AT?L?VAV?hAC`AA~@AbAAj@AZ?nHMl@AJ?vBCd@?VAV?d@AF?N?F?F?PAjA?@?dAAl@CF?V?xCE|@AlAAnBEhAAhCEnCGfAAXAH?nCGtDI^?B?b@?lC?\\?tBE`BGH?rBIz@I\\Az@GnBObCSdBQzAM~BQbAEdAGtAI|BIFAvBEZ?VAH?XAF?bAAZAdCCL?V?rACP?`@AT?l@AbAA^?^AV?JAz@AV?TAbAAn@AtAAh@Ah@?f@AtCClHIzBCRA@?fEEpAC`GIhDCzCElDGjDCbKMdKMlAAB?|OQtKMDA`AA`DEN?|@A|EGjBAP?t@AN?v@?fA?X?l@?J?`C?dJ@H?X?\\?rG@N?b@?D?v@?V@N?T?P?B?RAJ?jA?dB?B?^?nA?dAAfCA^ARARAj@ETA@?P?T?V?R?P?h@AD?j@ATAT?R?T@D?N?f@AX?T@f@Bb@Ab@?b@Ab@AfAAb@Ab@?PAvCEpACb@AL?zAE@?LAR?@?tAEj@AJ?vBEvAElBEbCGlBEj@ApBEPAj@Aj@A`AAb@A\\?vAClBCnAA\\?jBCfBAtAAvBCB?Z?fDCjDCrCCzAC|@?~BCj@?J?fDCbDEr@Ad@Ah@?j@?TAT?j@AT?T?l@AhA?|BCzBAzBCvCCvCEnC@zEIvJGF?vLK~HE`GGtDCxCCxCEL?jBC\\?DAhDEdFKh@AdCEjAAnFIxCGh@Af@C\\?TAtAAfZi@l@AfT_@j@?h@AV?R?T?R?T?T@T?d@@p@BV@T@TBT@P@n@FT@RBVBRBRBXDRBNBXDh@HTDTDTDd@Jj@Ll@Nh@Lf@Nj@Nf@Ph@Ph@R|@\\f@Th@Tf@VRJd@TPJVLFD\\Rz@f@PJPLPLRLPLHDHFRNPLPNRLPNPNRNPNPNPNPPPLPRPNPPPNPPNPPPPPRVRPX\\?@`@b@b@j@^d@NR\\b@LRPTj@z@l@`A\\h@j@bAh@`APZFLNXJTLTJVLTJVJVLTJXLXJTJVLXHVJTJXJXJXHVHRFRBH^jARp@JXf@jBdApDz@xCDNn@lBh@|AvDvKZ|@d@jAdCtG`B|D~@~B@BdDrHvA~CfA~B`DvGfBnDx@zAn@lA\\p@hBbDvBzDjAnBrAzBv@pAnApBfAdBtAvBx@jA~@tA@Bp@bAv@dA@B~@rAt@bAtAhBn@z@V\\dAtArAhBzAlBt@|@bApAh@l@PTv@t@t@z@d@f@PPPRPPj@l@`CfCb@b@vAtArApAVT|@|@ZV@?XX@@NN`@^d@`@b@`@t@n@r@l@`@^B@`@\\d@`@JH@@PLHH@?DDtAhArCzBhA|@f@\\t@l@f@\\b@Zd@\\x@j@x@f@VRTP^VLHDDJFPJ`@XZTB@HFD@LJRLNJ^TDD\\R@@RJBBVNp@`@^T\\RDBb@XVNb@V`@TTL@@x@d@x@d@v@b@x@b@lAn@lAn@x@`@f@Vd@VlAj@nAl@b@Rf@T@@JD\\Nx@^h@T`@PB@h@Tf@Rx@\\pAf@jAd@dBp@f@Pr@T`@Pf@Pz@Z|Bt@h@Pb@NdA\\|@VpA^hD`AhDz@~Ab@pBf@jBb@|HzA`C`@pATvB^H@LBlANtARf@DxARhFn@dD\\\\DvBXbALb@FrANzAT|@LrAT~B`@H@z@P`AR`@JNBd@L|@T`Dx@z@X|@Xl@T`A\\z@Zl@Tp@TnCbA`E`B\\Nz@`@v@`@DB`Af@nAp@tAv@zChBjAt@r@b@nAz@v@j@pCtBd@^rC`Cp@j@nBhBn@h@~B|BtAvA`AdARTl@r@vA`B`BpB~ArBjBhCfAzAnA`BdAvAz@lAlAbBn@z@t@bAb@l@\\f@d@l@^h@n@|@z@hAz@lA~@nAdAvAzArBvAlBzAtBz@lA`@h@`@j@|@jAbAvAt@dADFj@t@b@l@`BzBLRJJtC|D`CfDrAfBh@t@@B^d@PVzArBpK~N|GhJ|GjJlBhCj@x@l@v@lAbBlA`BZb@V\\nEfG@BV\\fBbCX^BBhSvXV\\dJbMV\\T^b@h@X`@Zb@PVbCbDX`@d@l@dDnEx@hAv@bA|DpFnEbGn@|@|EtGbAtALNp@~@h@r@p@`AlA`BdCjDn@x@^f@r@`AxDhFvDdFbArAb@l@DDRXz@jAnAbBdCfD`BvBrAjBhE~FjA~A`DhExArB~ExG|GfJp@|@rBpCt@bAb@h@f@n@NP\\b@^b@Z\\VXXXn@n@t@r@ZZXVPNRP\\Z~@r@hAz@pBrAz@f@nAr@DBzBbAj@Tz@^t@Vd@Nv@V~@VtAZ|Bd@`APbAPb@FxAThAPJB`C^tGdAvBZnFx@dG`A~AZ|@TbAXz@Vp@RXJp@Tf@PbCdA|At@fB`AVNPJRLRLFDHDRNRLPLPLRLPNRLPNRNNLRNPNPNPNPNPPPNPNPPPNPPNPr@t@`@b@PPNP`@d@^d@^d@bArAPTzCdEZ`@|CfEnGrIvC~Db@l@`_@hg@Zb@pBjCNTX^jGrInDzEdAxAz@fALPtIjLb@l@jKnNZb@RXJLNPLPPTRXV\\\\h@rAfBlFlH~ShYbAtAfB`CzGbJrBpCjFfHtBrCp@|@h@r@bAtAtJtMzKdOtS~XtMlQ|CdEDFX^nBlCfAvAdLpO|B|C`@h@lEbG`ApA|@lAl@x@p@|@|@nA\\b@RVlA`BLP^f@RVJPn@z@n@z@l@x@p@z@~@nAl@z@n@x@l@z@p@|@^h@\\d@\\f@^j@Zh@V^FLNTLRLVZh@LVZj@Zl@Xl@Vl@Xn@Xp@Zp@Vp@Rl@Xr@`@hARp@Vx@J\\`@tATz@Lj@HXFRDVHXPt@Ln@Pv@Nz@Nz@RhAJt@Hl@Jv@RzAHn@JfALjAb@tE~@pJ|@hJ`@bE^rDT~BFr@XrCXxCHr@tAnN\\vDFl@Fl@NrAD`@B\\Hv@RtBvBvTt@|HNvALhAJnAd@~E^lDvBbUJdAx@fIJ`At@bIv@bILnAXlCPdBN|ALpArA`NLrANnAN`ALt@Jv@Nt@Nv@Nt@Pt@Pr@@DNn@Pp@Tr@Rr@BHTr@L\\d@pARf@p@`BrAtC`@t@f@z@f@t@f@v@Zd@HJXb@NPX^BB`@f@RTb@d@NPDDd@d@VV^Z\\Zb@^l@f@b@\\DBp@d@t@d@r@^HDhAn@|@d@^N^P`@Nb@R`@N`@Lb@PF@h@PjAZv@Rr@NtCb@TB`@DdAHhAHb@Dd@BrCTvAJpAJxCVvBPfCRRBT@jBN`@D|ALP@N@`@DvAJhKz@vALN@l@FlBLnCTfAJ\\BD@ZBb@DF?`DXf@Dn@D~DZVB~Gj@t@DJ@fBNv@Dd@DdAHpDZB?`@DRB`DXl@DtE^dAHXBbAH~MdAjDXd@DlAJr@Hf@Fj@Ht@J~AZlATjAZn@PZHn@R\\JTHXJXJr@ZrAj@z@`@^Pb@Tx@d@d@Xd@Xf@Z`@Vz@n@l@b@jA~@h@f@b@^nAjA|AbBh@l@DDv@~@NPb@j@fBbC@@jSpXtAjB\\d@`BxBvG|I|@lAzFzHjFdHpAfBn@z@nEdGp@|@jKlNpAdBlCpD|BzC`ApAX^r@`A|@jAjCtDdAvA|@nAtCxDpAbB`@f@jAtA`AhAx@z@|@|@j@h@h@f@fB`BpG~FzAtAnF`FpBhBjC`Cn@l@rAlAt@r@lBbBxAvAh@b@|AvAn@l@nF|ElBhBpG|FzElErChCt@p@t@r@xClC~DrD~EpEn@l@jHtGfAbAvBnBvDlD|@z@f@h@^`@X^\\`@~@hAr@|@d@n@~@vAr@fAt@nAb@z@bAnBh@dAp@|Ah@nA\\~@Xt@b@lAVt@Rr@Ph@Vz@r@fCTbARz@Pz@XvATrATpAX~ANdA\\tB\\jBb@rCl@tDZhBnA|HdBrKxDxURpAp@`Ev@tE^vB\\vA\\vARr@ZfA^fAZ~@Rd@Rf@Tl@P`@Vh@Zn@Zl@\\l@Zj@\\j@^j@^h@^h@Z`@BDb@f@^b@`@d@b@d@b@b@d@`@b@`@d@^d@\\f@^f@\\d@Zf@Xf@Xh@V@@f@Tz@`@j@Rh@RTHj@PTFh@Nj@L`AThI`BbDp@tE~@zBb@bATbARZFxE`A`@HbB\\`ARnAVxBb@bB^nFfAH@`Ez@pAVrAVzBd@x@P@?tB`@|Bd@HBjCh@bGjAbB^xAXjAVpDt@jB^xAXx@PxE`A|Bd@fCf@v@PfARv@P~AZtBb@TD|AZtAZ\\JjAZfBj@tAf@f@Rr@ZlAj@h@VtAt@fAp@l@^hBnAr@h@t@j@dA~@xBrBrDdDz@x@|@v@rBjBh@f@hD|ClAfAfC~BbCxBvArA^Z`A|@dC|BnAhAnAhApAlAhB`BjC`CfD|Cj@d@fC~BzAtAhD|CJJlLpKtBjBd@b@hAbApBjB|BrBxBpBbB|AxCnC~BvB`BvA~AvAvArAnBhB|BrBpBhB`DvClC~BfD~CtDhDfC|B`CvBjD`DnE~DtApAlBhBpAtAxAbBz@bAdAvAh@p@bAvAbBdCJR^j@h@~@Xf@l@dAj@hAr@vAd@`AJRLXVh@`@bA\\r@HVN^Th@@DFPJVJVJXh@xA~CxIf@vAvCbIzAdEf@rAPf@|AhE`AlCHTZ|@dDbJtAvDf@tAh@zAx@|BnBnFL\\t@rBBDv@xB|@bCpCxHPf@bCzGrC|HjCjHdAxCRf@tCbI`@hArC|Hl@`Bh@zABD|@fC`AlCFPnAhDvB`GjAdD\\|@x@|Bt@rBb@jABJ^~@Xv@FRzDpKxAdEv@xBBFdCvGd@nAhAdDbCzGbApCbAnC`@fAJ\\pBrFx@zB`@fAz@`Cj@zAJZDJd@nAPh@HPtAxDj@~Ah@vAt@tBv@vBTn@N\\j@zATn@bApCDLnF`O\\~@rBxFjEvL~CtItAzDJVFPlA`DjCvHh@tA\\`An@bBhBbFt@lBvA~DRf@b@pAd@pAlBnF@BpCzHBFrAvD`AjCf@tAzAbEHXzAbEl@dBz@|Bd@rAdCvGlDtJv@tBTn@Vr@Tn@b@hATn@f@fAVl@DJTb@?@Xj@Xj@\\l@T`@Zh@b@r@RXV`@X`@FJ^f@nA~Ax@`AnAnAb@b@p@n@d@^HF\\XLJz@n@hAv@rBlAh@Z|@`@b@R|@^f@Rh@Rj@Pf@P|@TtA\\JB^Fh@Jj@J^Db@Fz@JbAHVBt@Dr@Dl@@f@@^@h@Ad@?h@?^AnACz@?H?z@BV?j@?tA?dAAfECp@?lBAjB?pDCb@?jC?lBAj@?`A?vAAtAAvA?dCA`CA`C?bAAtA?tA?bAA~@?hAAnC?@?nBAlB?tAAl@?B?d@?j@Aj@?`A?|AAvEArBArA?lAAvEApA?l@?j@?h@A`A?F?v@?bAA~@?hCArAAX?H?vC?nCAzOEb@?b@?pCAfB?`DAxCApDA~B?`KC~UG~B?j@AbA?~@A|@?n@?j@@h@?^@`@@^@`@Bl@Df@Bl@Fh@Dh@Fl@Hh@HZDd@Hr@Lt@N`AT~@Vf@Nf@NTFTHh@Px@Zj@RZNXLZLNHLFNFZNVN|@d@`@TVNFDxD~B|FnDjAt@rBpAlAt@`BbAVNhAp@n@`@FDlAt@d@Xd@Xz@h@d@Xx@f@lAt@x@f@f@Z`BbAd@Zl@^bAl@`EfCr@b@XNf@Zz@f@b@VTJPJB@d@Tf@VRHRJTHh@T^PXJVHf@Ph@PrA`@hBj@pA`@pMzDdDbAd@Nx@Tn@T|@Z`A\\TJVJ\\P\\N`@R`Aj@^Vh@Z|@n@`An@ZTZRtOjKhErCv@h@x@j@jAx@lAv@rBtAdCbBp@d@h@\\~AdArA|@tA`Ax@h@dC`B|AdAvBvAjAp@h@Xn@X|@b@p@XXJv@Xx@Xt@R^JZHz@RlBb@zCt@~Ct@z@R|A^tCp@d@Jp@PpCn@pGzApP|DZHbE`ARDjCn@vTfFzD~@l@NfDx@\\Ft@RB@pDx@nFnAbIlBVFlAX|HjBx@RnAX|A^~Bj@lDx@|@R|Ct@jFjA`@Jh@Lf@Lh@LZFvBh@r@RlA\\bA\\bA\\DDlAf@jBz@dCpAnVvM`IhEpLnG~JnF~MlH`Bz@jE~BpDnB\\PFDdFnC^R|@f@dB~@lFrCfCrA?@hAp@x@f@h@\\v@j@VP`@Zr@j@l@h@~AvAx@z@v@x@x@`APRf@l@p@z@TZRVf@t@PTFJrDpFf@v@Zd@nC`EHLpAlBxCpEh@z@`B`CxAzBv@jAlAhBdBfC`@n@NRp@bAh@v@d@r@X`@n@bAx@jAPXtApBLTbBfCh@x@bAxANTT\\n@~@bAtA`@f@d@h@d@f@b@d@b@^t@p@p@f@\\V`@XNHTNd@XFB^R^RRHLFb@RXJ@@l@ThA\\x@TXDb@JB@\\Fr@L`AJ\\D^Bf@Bh@B~CBj@@p@?n@?HAbBCv@A\\AjAA|@Ax@?^?j@AnA@d@A@?d@Ab@AR?N?RAL?`AAL?dDCV?nBCj@?|BC\\Az@?~DE`@?R?JAlBAlAAh@AzBAf@AD?b@?|GGlDC|DC|HGfAA~HGdBCl@?dAApCC|@Ab@?H?zAAfDCz@@rABb@@h@BvAHx@HF?b@DJ@z@JfAP^FH@XDXFfATdAT~Ab@jBl@zAh@~@`@fBx@xAt@xAv@r@^fAj@`B|@x@b@nE~B`Bz@`Af@^R~BnA@?fCrAdExBXNpAp@n@\\~@f@b@TlAp@PHrAr@jB`ADB^RRJ|DtBz@d@h@Xv@`@nAp@h@V\\P\\Rf@Vp@^n@\\\\P\\Pl@ZHDx@d@h@Vx@d@f@V|@d@`Bz@`Bz@d@VDBlAp@ZNn@Zz@d@pAp@z@b@d@VlAn@nAn@lAp@z@b@`Bz@~HdE^R~@f@dB|@v@b@|@d@fAl@l@Zf@Vf@Vh@XNHpAp@nDlBd@Vf@VRJRLh@V|@f@t@^pAp@FBRJVPXLXPJD^RNHrAr@VL`Af@p@^xBjAj@XvBhAbB|@jAn@fB|@LHpAp@bAh@dAj@dB~@jAl@RJnAp@LHd@T`Af@p@\\bAj@pAp@r@^v@`@NHPJPHn@\\f@XTLXNdB|@hCtAlAn@nAp@z@d@x@`@z@d@lAn@nAn@nAp@lAn@`Bz@~@f@`Bz@nAn@b@V|@d@z@b@d@VlAn@nAp@pAp@TJNHx@b@TLh@X~Az@j@ZVL\\P^Rp@\\VNPHXNr@^x@b@~Az@t@^n@\\z@d@b@T`@Rp@^rBfAVLnAp@h@X\\PD@z@d@\\RFD@?BBXNNJ\\TRL`@ZPNNJRPXVBBFFJHFHLJXZFFb@d@?@NPJLBD^f@Zb@\\f@\\l@FJDF`@t@?@Xj@FNXn@JVLZHRJXFRDJ@DNb@JZFVHV?BPl@Pr@Pv@Lp@@FBJFd@@BBLHh@D^BNFd@@ND^PrBPhBd@bFVpCJlAT~BFl@b@vEJrAFl@Fn@Fj@Fl@N|ADl@PhBPlBBNLzA@BVpCTjCNtANfBVpCBTLtA@FFl@?FLrAFp@J|@Fx@BNBZ@PD^@LBVJhAd@`FJ`ALxAPjBH|@Ht@LrAFt@Hp@Hj@Fh@Nx@Hj@Ll@Jh@Nt@H^Pn@Pr@Tv@Rl@Lb@@?Pf@Pf@@Bb@dA@DHRN\\`@x@LTNZLRBD@BLR\\j@Vb@NRPXJLX`@PRV\\PR^b@\\\\PPTV^\\B@FF@BPNB@DB@BJH`@\\RLTP`@V\\T\\RTLf@Vd@Tx@^FDLFrAh@lAd@`A`@bA`@hBt@dAb@b@Pj@Vd@RXJJD|@^D@dDrAxAl@`@Pl@VZLrCjAz@^`A^nAf@VJlBv@~@^LF~B`A`A^pDzALDNHf@RnBv@~@`@dBr@~@^@@b@PbBp@~Ap@JDtChA~Ap@TH|@\\JBj@VXJh@RJDb@NdA^`Bh@hA^r@Rz@Vl@PpA\\dBb@`Cj@fAT~A^NDpAXzA\\rCp@n@N|A^F@`Dr@RDTDJBrE~@vBd@~@Rh@LxBb@lGpATFn@LdATnDt@h@LZHr@Pb@Lb@Ln@T^NHBhAf@v@^h@Vf@ZfAp@bAr@p@h@d@`@VTl@j@f@f@^b@XZl@r@Z`@^d@\\f@l@~@xAbC`IlMXb@BFrRb[~AjCrF|IdNzTjMvSfCbElAnB\\h@n@bAn@dAVb@p@dAn@dAn@dAhAfBT^p@fAV`@?@V`@\\h@zAbCVb@p@dAt@nAh@z@V`@FJxA~B|CdFJNfBtCvA|B~@|ArD~Fp@fAn@dApCnEn@dA`BjCj@~@tAxB`@n@fAfBhEbHhBxCFJx@|At@vAj@nA^x@Pb@Vj@^bAXr@Zz@`@pAVv@`@vAd@dBT|@T`AZrABHd@tBDRbBpHLj@TbAtAhG`@bB|BfKx@lD`J`a@jGxXBNHZhBdIp@xCPt@lAnFBJf@|BfAzELj@p@vCx@tDJ`@Lb@Rv@FPVx@L`@L`@JXTl@Tl@Vl@Th@BDRf@Xh@\\p@`@t@Xh@^l@FJh@x@Z`@Zb@HJX^b@h@hApADF~CrDX\\|BlC~AhBt@z@xDrEdInJpAxAb@h@zClDjAtAx@bA~@dAh@n@DDtA`Bf@j@|@dA|DvE^b@n@t@fAnABBLNXZt@r@PPb@^h@`@RPHDNJPLB@`@VLHDBTL^R^P`@PNF`@NPHPFVHRFh@NRFb@JXDB@RDXDd@FnBXRB~@JbANhBTbCZd@FZDf@FTDTBVFRDd@HVHn@PLDTFj@Rf@RTJf@T^R`@T|@j@LH^VXTHHLHRPf@d@b@b@\\\\VZVXRXNRHHRZNRLRT^T`@\\l@JPv@rA~BbEdB~CNV\\l@d@z@@@LTNV`AdBR\\HNNVLTNXLTj@bAb@t@zAlCNVz@|AHPt@pAv@tALR^n@Vf@f@|@jArBd@z@DFbAfBLT\\n@\\j@~ArCn@jAb@t@n@hAb@v@HNRZ|ApCbAdBDJd@x@|@~A~@`BVb@T`@j@bAp@lANTFLhBbD~@bBr@pAJPBDnAzBlAnBzCpFp@lAh@`Af@`AVf@P^P\\Tf@Rf@@@Pb@LZNZL\\Pd@N`@L^f@xAXv@Ld@JZRn@FV`@zA`@`BdAhEt@`Dt@xC?@|AnGVfAFVHd@H`@BHJr@Jt@Hh@BRH~@HbAHjABl@Dh@@^@b@?j@@r@?V?N?TAh@?\\A??^Cj@Ch@?DEf@I|AKpAOhAyCnTIh@It@Ip@I|@Ej@E`@Cl@ALC`@Ex@?\\?NCr@AbBAV?\\BpD@l@?p@@Z?d@@bB?TDrI?~@@|A@~A@bB@vA?n@@v@?nA?DB`E@j@?@DjI?\\@zCHvM?`BHdO@n@FvM?n@@n@?n@BzD?n@DjFA`ABzCBjC@lE?n@?l@?n@?|AAzC?fAAdA@^A~@EpCCrEEhF?h@AxCAf@Av@AbB?p@Ad@GlKAjACjCCfFCvDAdC?ZAf@?j@?DA|@AX?d@?p@AlBApBA`AAbBCbBAdCCrCCbCA`BAt@CbFA~CIzI?fAAl@?d@C`C?dA?zACzC?xAAvBClEC`DCjDCjCGdME~E?d@@d@@f@@|@R~DBb@Fv@Jx@Jx@L~@Lx@F\\FVLp@Lf@Pt@Nj@Rp@Vx@Rj@Xv@@@Rd@FPTf@Zp@^n@NXNVNVXb@LRNPV\\PVBDPRBBZ^Z\\RRb@b@r@n@t@j@f@^l@^ZRZP^Pb@Tb@Rd@PXJTHRF`@L^JVFTDVFTDRBRD^D`@Fh@Db@Bf@Bl@BlCJV@lCJxJ^|BH`Pl@pBFxHXtNf@vEPfGTbENrJ\\l@B|ADbCFfCBbBBpA?jB@z@?tBA~DAN?^?p@?bBAtLCrDAtC?|@ApA?Z?lBAtFA~KCpDAnOCvEAp^IlA?XAzEChB?D?|HAbDApGCX?lIC`A?n@?tGNrBPnALzCd@dDf@~AXpIjAlHbAhAPl@Hh@J^DXFb@FnC`@PDhBXp@JdG~@t@Jd@Fv@F^BXBx@DF?R?r@BN?T?d@@V?RANAn@Cb@A`@Cj@Ch@Ed@EZEVCZGh@IlAO\\GhAW~@WPEb@Of@Qv@Yp@W|BcAh@U@?dCgAbAe@\\QbBu@bBs@?AhAe@jAi@vEuBZMjAi@ZOjIsD`@QbCgApD_BpCmAt@]^QHCr@[PIhBs@ZMbA_@fAa@XGLEXIx@WzAa@rA[",
                      },
                    "start_location": { "lat": 41.8500987, "lng": -87.6310927 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "60.6 mi", "value": 97481 },
                    "duration": { "text": "53 mins", "value": 3167 },
                    "end_location":
                      { "lat": 39.7905528, "lng": -89.59839989999999 },
                    "html_instructions": "Keep <b>right</b> at the fork to stay on <b>I-55 S</b>",
                    "maneuver": "fork-right",
                    "polyline":
                      {
                        "points": "ao{uFdkj~O~@S|A]REf@MbB[n@Mx@O`C_@p@Gp@I~@Gx@C`ACl@?h@?T?F@J?T@@?N?Z@j@D\\B^B~@Jb@F`@FTDPBVDRDNDVFZHj@NRDt@VVHNFVHXL\\Ll@Xb@RXNB@FDLHNHJFRLRJb@XVPVNJHLJDBPNXRFFDBPPDBn@h@PP@Bb@`@fEfEdFdFpHpHlBlB^^bJ`J|BvBhCfClBhBzIxIVTd@b@~BzBbAbAf@d@bAbAv@x@^^RT\\\\PPlApAj@n@b@d@v@z@lAtAbBlBp@x@`AhAZ`@FH|AlBb@h@p@v@l@v@p@v@`@h@\\b@d@h@nA|AFHHJlAxArA`B^d@^b@pA~ARTd@l@x@bAbAlA|@fA^d@TVLNd@h@RTPRl@l@RR^^JHJL\\Z^ZVT\\Xl@d@ZVZT\\Vd@\\XPNJPLNHPJTNJFVNXN`@TLFhDfBdB|@tCvA`ClAzAt@v@b@lAl@HBPHzAx@PHdKhFbAf@vCzA|EbC|C~Aj@X~Ax@z@`@d@VlAn@h@VhIdEvAr@XNTLb@TTL^TBBVNBBNH`@XRNb@\\PNp@h@HHNLNNXVXX`@d@`@b@`@d@^f@^d@NRNRNT^j@Xd@\\j@Zj@Td@R^BFh@hA^|@Tj@FRLZHVJV^jAJXHZHXJ\\FVFTPt@R|@Lj@TlALv@D\\F\\DXJv@Fp@D^Ht@Ft@Fv@Dv@LpBJvADz@BTDz@BXBZBZBZBZB\\D\\BXDZJz@Jr@Lr@DXF^FXFZDTFXHZH^Nl@H\\JZNl@JXHXHVJXHVXr@HRVp@JTLXJTLXLVVf@LTNVJRPXJPLTNT^h@NTLPNPNTNPNP^d@`AlA`@d@rA`B^d@bAlAlAzA^d@dCxC\\b@RVpBbCrBfCpBbC\\b@rA`Bl@t@v@~@p@z@zFdH|BpCxDxEJJh@n@zE~F`BrBnAzAz@bAbBnBJLzBbC`BbBt@r@z@v@v@r@|@v@dA~@RNj@f@pAdAbAv@TNd@\\tAbAr@d@d@ZdAp@vA~@dAp@z@j@lAv@z@l@lAv@`An@p@b@~@n@dC~AlAx@rAz@z@j@dAp@d@\\|AbAdBhArA|@bAr@fAp@fAt@lBnAbBfAlCfBr@b@|@l@hAt@jAv@r@d@dAp@hAt@z@h@XP|@l@|@n@dAr@\\T`@Xl@`@hAr@d@ZxA~@x@h@`@Xr@d@r@d@`ElChAt@jAt@f@\\\\VFDv@n@ZV\\Z^\\b@`@\\Zf@f@^b@FFZ\\^f@p@z@l@v@HLT\\LR\\h@\\h@LT\\j@Xj@\\j@Xl@Xl@\\t@Th@Vn@b@jA`@jAl@bBnEdMbB|EzAfEx@zBlAlDl@bBt@tBl@bBbAtCl@bB\\bABDlAjDv@zB|@fCt@rBh@|Ab@jAN`@N`@Tn@Rd@h@tAd@hA\\z@\\t@Xl@LZJR\\v@p@tAf@dAf@`Ab@z@Zn@t@rAz@xA`@p@Zj@V`@R\\j@|@h@z@fA~An@`At@`AnAdBh@r@h@p@h@n@d@l@p@z@xAfBh@n@TXd@j@t@~@lAxAdBvBx@dAv@|@hAxAv@~@d@j@|@fAxAhBpA|Av@bAh@n@`AlAv@~@t@|@bAnAx@bAl@t@p@z@r@z@~@hAv@`A~@hAp@x@|@fAdArAdAlAj@t@\\`@hBzBhAvAxAdBHLNP`@d@bAjA`@`@Z\\^`@`@`@ZZVTZZZXXVTR`@\\^Z`@\\^Zb@\\VRZTb@Xf@^b@Zf@Zd@Zp@b@ZPp@^^RhAp@VJ^Rv@^r@ZpAj@fAd@xAl@fBr@pAj@~@^|@^XJLFPHVJj@TxAl@j@VDB|@\\bBr@b@Pd@Rd@Rv@Z^NXL\\N`@Nj@VtClA~EpBB@p@Xd@Rj@Vt@^VLZPdAn@l@`@\\TPLDBXTBB\\XRPf@b@\\ZZZTVd@f@Z\\DDr@~@Z`@`@l@@@NRDFLRJNTb@PZDDLRFNVb@Zn@NXBHNZLVVn@LZPd@Zz@BDL^Nb@Lb@J`@Nb@@DDL@DTx@DJ@FNd@d@xAl@pBHXFRJ\\JXb@xAd@zAd@|ABHBJdAhDVx@BHt@fCh@fB^jA`@rAf@`B@BX|@l@rBl@lB@BNd@h@fBz@tCt@|Bp@rBZz@n@~AVn@`@bA|@pB\\t@r@zAh@bAv@vAv@tAr@lADHn@dALPFJh@v@LRX^DHLNx@hA`AnAbBrBpErFfC|C`BrBzAhBvAfBdDbErDpEpBbCd@j@Zb@`@f@TV`AjAPTr@z@fArApDnEnBbCdCzCzAjB|@fA|AjBnA|AhAtAbAnAv@`At@|@lAzAlB|BvAhB`AjA@?LPrBfCbAlAn@v@zBpCf@l@|@fAb@j@tAdBPPDDRX^d@^`@`AjAp@z@`AjAZ`@tAdB`BnBp@x@HJDDPTRV`@d@NRb@h@j@p@`@b@`@d@^^h@h@d@^\\Xr@l@b@ZZR`@VTNd@XTL`@Td@TVLv@ZVJRHNFRHB@JDj@Pn@RvA^\\Fd@JJ@j@JPBXDh@Fn@F`@Dt@DP@Z@J?l@BxBBP?t@?j@@h@@tA@|A@n@@|@@~@@X?h@BT@z@DZB\\Df@DVD^F\\F^Fz@P\\HPD\\JPBTLh@Td@RHBPHd@RZPn@Zr@`@d@@~@j@bBjA|ClCx@v@\\`@j@n@XZ\\\\Z^TTf@h@b@d@TVj@l@FHbAfAv@z@LL@@JJ@@pAvAr@t@`BhBTVFHjAlAb@f@JHBDLJt@x@b@d@^b@|@~@r@v@bAfA@@Z\\ZZv@z@z@~@VXjF~FPT^d@\\h@NT|@rArAdCZn@p@xAJXn@`BJXTn@^nAvAxFP`APbAPdAFj@F^R`BNhA@P@?V|B@HRxAF`@Hx@`@|Cl@dFTdBZbCPtAL~@X`Cb@jD^xCJt@Hd@?@BNNz@RfALp@Pr@Pt@Jb@Pr@Nj@Nh@X`AL^Rp@HPBJJXVn@DJXt@p@~A^z@n@nAn@lAFJLRLT`@p@T\\NRBDHLLPDFLRh@r@PVX\\TXr@z@d@j@tBhCx@bAbAlABDjBzBtj@zq@vExFlCdDvExF~GlI~CzDdFhGrAbBlDjEdGnH\\`@zFdHdEdF`DzDPT`AjAb@h@NPLPNP`@d@p@x@LP`@f@PRRVl@t@`AjAp@x@tBhC^`@^d@PRNRHJl@t@h@p@`@d@HHHLJL`@d@RX`@d@^d@JLTV|@fAn@x@PRJLRTNRHHFHJLn@v@TXJJTXp@x@^d@NRxAfBLP\\^RVp@z@`DzDrBdCr@|@LNhdApoAJLJLJLl@r@Z`@j@r@h@l@TXb@h@n@v@`@f@n@v@`@f@`AhAn@v@PTNPNPt@z@\\^p@t@^^TT`@b@j@h@l@h@\\Z^Zl@h@p@h@n@f@r@h@n@b@HFf@\\t@f@v@f@x@f@l@\\v@`@d@Vf@Vh@Vf@TXLNHf@T\\L\\Nx@ZvAh@z@\\THzBz@b@NVLjAf@rAh@bBr@d@Rt@Zd@RbAb@l@TjAf@~@^b@RTJJFVLNHn@\\h@ZFFd@Xd@\\FDNLPRPPRTVVJLlAzAhAdBp@pAFJ`@x@HRP^JVJXTj@Nf@N`@HTH\\Nf@BHFXFP@FFVLn@Px@Lt@BRHh@Hr@Fh@@@Dj@Fr@Ft@@\\B`@@N@NBv@@n@@zA@vG@dG@bG?|@@dD?J?l@?Z?H?jA@vA@j@@b@BjA?PBz@BhA?BFvADv@@VDdADv@Dl@LpBBNDl@Fv@BRPjBD^@LFl@Fl@D`@ZpCD`@ZxCv@pHXjCh@|Et@`HPbBbB|OFh@`@bERfB@DPlBDXRpBH`AF~@Fr@Fv@Bj@Fx@Dv@D|@Bp@@^@NBn@@l@B\\@x@@r@@`@@f@@p@@jA?hB@nC?d@?l@@hL@jF?TBlQBrP?bD?V@`D@`L@l@?rA?x@@zD?dD@bDBbR?pA@tB?n@?lA@xF@lC?jC?n@@l@?lF@xD?n@@l@@hI?~@@`A?dG@xG@~G@xG@zDBvI@zKBrP@hL@J@|H@xG@zL@dB@vI@dE?j@?j@@fE?rB?tA@fA?zB?F?bD@nA?`@?r@?rA@lA?`@@v@?\\@x@@z@Bx@Dt@BVBl@Ft@Fh@J~@PnAPhA@DJj@@JNt@Nh@T|@ZhATr@Tp@Vn@Tj@Zp@Vj@LVZj@Zh@NVj@x@n@|@^d@LLRVh@h@b@b@l@h@r@j@x@l@`@Vv@b@PHLHb@Rb@Rb@P^L|@XpAZn@Lz@Lj@H~@FZBl@BX@^@l@Af@?`AA~@AV?x@?xDE\\@PBTA`AA|HGvBClA?fBAzACF?F?B?dBAdDCrAAdAA|@AR?`@?fAAB?J?zACl@?F?PAB?D?|@?JAjEC`DCV?jAAh@?h@A`CAjCCZ?B?f@AnAAn@?j@AtEEnJIfCA`DCPArEClDEdCAzAAb@AV?n@ApAA|@?zAAzBC~SO|DEjBAjBAb@Ab@?|^WbDElg@]j\\WnCCnCAbCC^AN?`@?fJItDCjAAlCARAjBApBAjBAnCAdHC~AAJ?H?vDErBCZ?j@AN?dAATAlAAt@ApEEbHEhFCrCC`ECzBE@?Z?L?n@?B?TBj@@T@l@BlAHPBn@DlAPPDhAPjATVHt@Ph@NtA`@z@Zt@ZpAh@\\Pv@b@JFnBjAJF^TfAx@p@h@RPf@`@d@^lDpCTPFFTPFD|@t@zAlA`BpAvAhArAdA`Ax@NLjA~@lDrChBvAHHpDtCvBdB^ZlA~@xBdBHF\\X\\V\\Vz@r@PNfAz@j@d@n@f@nAbAHFtBbB^ZdBrAtFpEjA~@z@p@@B`DfCfBvAXTvBdBfCpBn@h@p@n@RRn@n@NRz@~@d@n@V\\`@h@PXl@`Af@x@R^dAhBrAbClBfDBDNVvBrDpDlGfCnEl@dAn@dAXf@HJZ`@VZ~ApBn@r@l@l@XVb@^r@j@FFr@j@lBlADDz@b@x@`@vEpBb@PTHPHRHdBp@lAf@TH\\NfAb@lAd@jBt@xAl@l[dMlCfAd@P~@`@h@V`@Rl@Z`@VXNf@\\^Vj@b@zAlAj@b@~@t@lCvBfAz@z@r@p@h@xD|Cx@l@x@r@fAz@tAfAhA~@bAv@xAjApB~AjBzApB~A`BpA|@r@bBtA`BrA|@r@tAfApAbAnAdArAdAnA`AxBfB|CdC~@t@b@\\NLdCnB`BpAjA~@z@r@dBvAdBrAjA`AbAx@`At@hA|@h@b@x@n@lCxBh@b@x@n@nAbArAdAdBtA|@r@dAz@fAz@dAz@|@t@~@r@t@n@z@p@fAz@x@n@r@j@bBxA~@v@dBxA|AtAFFz@t@zAvAfAbAbA|@r@p@v@v@t@x@l@p@v@~@t@`Ar@~@p@`Av@jAt@lAn@hA`AlBj@jAh@fA`@`Ar@dBh@xA^fAd@tAZdA^pAV`ADRd@nBz@rDz@tDx@lDZvAj@`CZpAPv@x@pDj@hCFRrAzFPr@BLHZJ^Rr@DNTr@Rn@BHZz@Xp@Xp@N^P^f@bAHJ`@r@Zj@j@x@`@l@h@p@\\b@RRRT`@b@h@h@n@l@DBPL\\XB@`@X`@Zj@\\x@f@ZP^Pf@T^PZLNFXJTHd@NHBb@LRDb@LF@~@Ph@JdANd@H|@NbANj@H^DpB\\rARpBZnEr@z@Lb@Hz@Lt@LH@bC`@b@Ff@Hd@Hh@FjCb@pCb@~@LrB\\\\F\\FlARl@Jh@Jb@Jp@NvA^@?ZJF@|@Xb@Nf@Pb@Pf@RXJpAj@b@Rd@Vj@XzAz@PLd@X|@l@n@d@`@Xn@f@\\XDBj@h@f@d@b@`@jAhA|@z@nApAxAxAbC`CPPHHf@d@`D`D|BzBlBlB@@RTZZh@f@rApAh@h@tBrBv@v@bA`A|AzAdAfATRr@r@nFlFnBlBtBrBxEvEdFbFrApArBrB`G|FlNfNnAnAl@j@|B|BbAbAr@p@pCpChAfA|@|@JHdBfBtCrC`B~A~A~Ab@`@h@h@f@f@f@d@RR\\ZrArAJJDD|GxGjBjBb@b@HFr@r@LLd@d@t@r@fDfDh@h@d@f@NPLLfAnAx@dAV\\\\d@f@p@h@x@T\\R\\\\j@l@bAf@|@^t@Zl@b@~@\\v@NZPb@Pb@v@jBj@pAh@rAJVdCdGn@zA`@bAVl@Xn@Xr@x@pBr@`BlCrG|BtFp@`Bf@lAn@zAv@lB`B|D~AzD`@~@FNhApC|@zBJTZt@Rb@^~@N^P`@FNN\\^|@`@`AJVVj@Zt@Td@Td@T`@V`@V`@Xb@nAbBV\\RVZXh@j@`@\\\\Xf@b@n@b@VPXP`@VVN^PXLTLDBb@P`@PVHd@P`@J`@JZH|@Pf@J`@D^Dd@D`@Dh@@b@@Z@b@@B?^?\\Af@CjAEr@CzAEbAEp@CnEQz@EbFSX?j@Aj@?`@At@@r@Bf@BdAFF?@?^Dn@Hx@L`@Fp@Ll@L~@Vh@NjA^dAb@n@XbAf@j@Zr@`@JFb@X\\Tb@Z\\ZZVb@\\ZX\\V\\X`@^`@\\TRrHnG~CjCz@t@\\XBBnB`BlDxClRhPvAlAh@d@PNlA`AtCbCnD|CdCtB~FbFrBdBvOxMXVv@r@fGfFzDfDbCrB@@tLbKhJ~HzBlBfA`Ab@`@d@`@t@r@VTZZ\\\\d@j@PRNRf@p@\\h@NTPVXj@NTLVZl@Xn@JVFNDJRf@Rj@BFL^Pj@Rr@Np@Nh@Np@l@lDD\\VtAPjATjANv@Pv@J`@HZVz@N`@@FDLXv@h@vALVRd@LVN\\r@lAr@hAn@~@\\b@Z`@BB`B~Aj@h@t@l@x@n@p@`@^R`Aj@HB|An@pA^PJlAVt@Lb@H~@J@@z@Fj@BD?`ABL?f@?PA`@Ax@CLAb@EF?^EXCnASb@K\\ILCdD{@l@OvCw@VIjAYnA]lAYp@Kz@Kj@EPCdAEbAAt@@rADp@Fv@H|@Lx@Nz@RhAZVH|A`@HB^Jj@Nt@RH@ZH`@Hd@Jf@H\\Db@Hp@Hj@F`AH~@FnADjADtAF|K`@R@VBrDLtADdBFF@lBFlBHlBFB?fBHfENl@B|@DrBHt@BlK`@r@DD?J@F?J@H?R@rAFfADx@Dl@Br@BpBFF@R@d@@h@@p@@d@?L@`@?\\?v@?vAAb@?dAAj@A`AC|DOdBG\\AtAGn@Cl@CnCIvHY`DKnAE~AGv@CTATAL?z@E`@An@CPAlAEJ?`AEnBIp@AdGUL?dBGD?|AGJAnCITAr@C`@CrDMTAn@Cd@AjFSdMc@~@C|AGhBGtAGdEOjAEbIY`FQbDK~@EdCI`CIpDMjCKvFQrBIvAGb@AvAElBInCKrEOjCKbDKjCKjCIfDMtAE|AGTAJA~@CTAN?`GSn@EbCIB?T?PA~CMhACp@E~BIL?LAJ?hEOjAEbACXAj@CJAd@ChAEnAExBIjCK|BIb@ARAb@CfAEZAjACtHWV?D?VA^A\\?DAB?P?j@AjBAbDBvBBdHH^@`EFzBB\\@LApAB`EHfGHlB@P@tCFpBBxBDhB@~BDjCD`A@r@@lABzBJt@F|Eb@lDb@dEv@lARXDf@Jj@JF@LDZDdARB?d@JhCb@\\F|AXr@L^FTDfCb@bCb@dAPtB`@F?B?`ANPDbAPlARJB|@NhCd@`C`@`APjBZbEr@VFnEt@~AX`AP^FxAVxNfCtCf@",
                      },
                    "start_location":
                      { "lat": 40.4505676, "lng": -89.02339479999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "4.2 mi", "value": 6768 },
                    "duration": { "text": "4 mins", "value": 233 },
                    "end_location":
                      { "lat": 39.74389, "lng": -89.63554889999999 },
                    "html_instructions": "Keep <b>left</b> to continue on <b>I-55 S</b>/<wbr/><b>I-72 W</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "}qzqF~tzaPzAV|@PXDbAPf@Hr@N`Dp@zAVr@LD@^HTDp@LNBb@FNBLBB@tAVJ@TF`@Fv@N~@LlARD@v@J^FJ@fAPJ@b@Hf@HH@bBZj@Hj@Jh@JbCb@b@HvCj@j@Hd@HVD|B`@B?LB\\F`APTDpB\\ZFVDn@Lp@Jr@LfARd@HbAPvAV~AXhAR~@NZDfARb@Fp@J`@DPBd@Hj@FTDRBl@Hv@JdAJXDpANjANb@D`BRjDb@zBVXBh@FtC\\\\D|ARj@Fl@Fx@Jn@Hn@H~@Jt@JbAL~APr@JdALb@Db@FrC\\`BRz@HjALn@H|@L^DB?b@FJ@|@JfALbALB?VDpBTvARt@Lz@PXFh@NLBd@Ld@LDBvB`Ab@Rp@^r@b@v@l@jAbAdAbAhApA\\b@d@l@BB|@zAb@v@^t@~@vBvAdDjAnCz@nBn@vAvAfDbBxDxApD~@xB|@lBp@hBfAdCfC|FLVrA`D`AzB~@vBn@~Ab@fA^hA^jAXjAPt@Hd@DNLt@RnAPlAD^LhATpBLfAb@pDPzA^~CDZTjB@L^tCFf@Hl@NxAHh@PtAP~AHp@NzANlANpAXlCHl@NvANtA",
                      },
                    "start_location":
                      { "lat": 39.7905528, "lng": -89.59839989999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "81.5 mi", "value": 131189 },
                    "duration": { "text": "1 hour 10 mins", "value": 4186 },
                    "end_location": { "lat": 38.6805444, "lng": -90.0121054 },
                    "html_instructions": "Keep <b>left</b> at the fork to continue on <b>I-55 S</b>, follow signs for <b>St Louis</b>",
                    "maneuver": "fork-left",
                    "polyline":
                      {
                        "points": "inqqFd}abPP|@PtA@@Fl@f@fE`@`DNjADXF^?@DXFTDV@@FZFXFVFRHXHRLb@JTJXHTJV@?Vh@LXPXJPVb@PVNRNR`@f@RT^^b@`@`@\\f@`@b@Zd@Zh@\\b@Tz@b@RJVJf@Rz@Zv@VZHbAT\\Fp@JVD^DZBH@L@RBV@R@T@R@T?Z@`@?T?T?T?V?@?B?@@VFtBAnDCbA?D?jDCdCAb@?|BA`A?n@?tBCnACt@AzACpDEvKIbKEnHGxHEnMGh@?`BAVAhFC|BCnGCxECpGElHEh@?zAAt@AN?rLEnCEtBAhKGhBA`A?dAAt@AT?l@C~@Ej@CfAId@EVCn@IbD]vFm@lCYxEg@zEg@`I{@f@E`AEr@A^?L?X?X?\\@\\BP@N@PBB?VBdANf@Hh@JlAZhAZxBl@bDz@jDf@R@`@BP@f@BV@r@?h@?l@Aj@Cd@EVC\\C`@GXEdAOdBYdAQdBWBA~@KlAG^APAd@Ar@@l@@`AB\\Bb@D^Dr@Jl@Ht@P`@J`@Lr@V|@`@t@ZbAf@PL^Th@\\d@^`@Zd@`@b@`@d@`@d@`@jAdAp@l@\\ZFD\\XZT\\VPLPJb@X`@TXNf@Tb@RPFZLZLZJXH\\HRFf@Jl@JTDl@Hx@H`@B^Bb@@h@@|@@H?hGCfHCnGA|NEnSE`JCtNEfSEbTGzFAbFAvBA`CAlB?lBAl@?dDAtBA^?@?lC?pHC~CA\\?xDAzJCdEA|DA@?p@AnDEbCGfAC@?z@EhBGlBIpDOrACbAC|@CtACb@?ZArBAzB?zB?f@?f@@rBBtA@dAB@@N?xADT?^Bd@@jADzAB\\@nA@bB@`BBjAAfB?tA?hAAnAAvCAhEAlDAzAA|BAxICrFCh@?D?lMGbA?hCAnA?xDCb@?X?dOGxTIf@?jc@QnJChCAdBCrAA`@?r@AbEA^@tLGlDAJ@J?jBCB?`A?z@AD?tAA\\?B?P?d@A@?\\?\\?zGCf@?b@AxBA|BA|EGN?rDCvD?z@?h@?nE@`FA@?`KEF?\\?~DCd@?`KEd@?`DA`@?n@A`AAn@@bDCxB?`KG`HCl@?bKEpEAvECzDAzVKr\\KnSIzNGxA?|TIb`@OR?N?RA`[KnLErDAzBAvIEbICjBAxSIlIAxAAlBAjBAX?rNGpKE|NG~NE|NGpBAhDAlWOpDAbTKzQKtUOhBAbAAdECzEE|UObTMlUMzOKb@?lQK`CC`@?vNKnLGrDCtQMrOI|QKfKGfXQzAAp@A|CAnKGtEExCAhAAlKGH?J?XAjJGjHEdA?|AAJAvDAfEEhFC~CC`DAx@Af@?tCC|DCL?dDCb@?|DE~DC~IExIGz@?jAA~CChMIf@Cn@AzGChBC~CAjFEn@?pHGpBAX?dB?nDCnGAv@?j@?tJEdEAj@?`DArGAlDCxIChB?`BArFApDA~PEt@AbNCb@AnEApFAtCA`YG|EClB?\\Al`@Kp@?v@?|@?rYKzLC`HApFCtNEvJC|C?l@At@?lA?zBAhA?lE?rB?rA?b@?H?lB?xA?pAApB?b@?b@?z@?lB?l@?vE?xA?xFCxB?zC?rC?lM?V?`BAb@?v@@bA?jA?tIAX?l@?tBAfC?j@?nC?b@?z@?`B?n@?b@AxA@xAAp@?~F?xSAtF?xF?bEA|C?dE?nD?`G?l@?`C@X?`A?R?hD?|A?Z?`B?hA?rA?vA?lA?F?xAAvAAxA?@?pAAV?b@Al@?hGGvAAzHEzAAlCAlLKnFCnBC~@?hGGnYQnKIxTMT?dEEj@A`CAxAAtACx@Ab@?dBAnFEdCCf@?xAAlA?b@Ad@?lBAxECp@?p@ArDA|AAxBAvIEN?fBAhA?hJEb@AjBAxBAT?|CArAArA?`A?hBApBA@?`A?pAAp@?~@?`A?tFA`AAd@?T?T@L?JAR?R?TAH?zFCzEClBAZ?bB?|CCV?dFEtBAz@?nAA~JEnGCH?xCC~TId]QvEAtGEpA?vECfSGrDAb@?rDC~GClLC@?lUInCAjBAT?hICdEA@?jBAxA?T?tA?j@@x@Bz@Bt@DpAJdAJ`AJ|@Lt@NTBbARl@LlBd@pA^pAb@fBn@hC~@xAh@|HtCrI~C`A\\|Al@`DhAz@\\z@X|ChAjC`AfA`@jAd@jBx@LFx@`@zAt@@@HD`@TbAj@bAl@dBhAl@`@nAz@jAv@p@d@pCjBv@f@z@h@dAr@dAr@\\VpBrAhAv@nChBHFRNvI|FfBlARLhBlAp@d@fDzBfFjDfAr@zF`EbGhEfWtQxCvBpCnB`EtC\\VbH`FjAx@jAx@~CzB^VzB~AJHPLnClBh@`@xEdD\\VzAfA^VpKvHxIhGvCrBVRDBbDzBvCnBzDbCf@ZdE`CzKrGdJlFhC|Ab@TdDlBFB~BtAx@f@fAl@vHpEJFvCbBnDtBb@TbBbAvDxBpDtBtIdFjHfE~FfDdBbATNpF~CvCbBfBbApKjGrBlAzAz@bFvChAp@jAr@tBpAhBjAz@j@nGfEhG|DhDzBdBlAbAn@vBvAd@ZbQbLdDvB`GzDl@^zDfC~@l@vJpG~@l@lEtC`BdAf@\\hAr@|AbAzBxA`DvBjJfGjAt@lDzBvFrDzDhCfDvBpAz@|BzAdBhAnD|BfEpCtNlJzFrDpQnLxOdKr@d@NHvClB`RxLbDvBjFhDBBxH`FhOzJlD|BzA`A`FbDfFfDp@b@|BzANJjDzBxFrDlAv@`C|AlAv@lAx@|BxALJhEpCjAt@jAv@f@Z|AdAx@j@b@Zv@j@hAx@d@^zAjAv@l@dAz@f@b@r@l@fA`AvArAdAbAb@`@p@p@j@l@j@j@bAdA`AfAr@v@\\`@PRlAvAt@~@^d@n@x@n@x@b@h@h@t@l@x@|@pAl@x@PXX`@@@\\h@x@nANTNVJPj@|@n@dAf@x@h@|@p@jA@@`@p@f@x@Zj@Zh@v@rA@@Xf@j@~@Tb@Xb@t@nAh@|@h@~@Xd@BDr@jA|@zALR^j@l@x@TZX\\l@t@VXZ\\`@`@b@d@PNPNPNPN`@\\d@\\b@Zd@ZRNRLNJ@?`@Tf@Xj@Xh@Vh@VVJz@ZVH`@L^Lr@Ph@N^H^Fh@J`ALjAN`@Dn@Bz@DR@l@Bh@?jA@f@?~CDjAC|BB|B@vEB`B@xC@fA?P@N?F?J?B?L?tC@d@?`B@F?Z?F@fA?J?N?R?nC@V@FAp@@lA@fA@J?jB?dA?l@@|@?R?F@~@?|@?nFA^AB?|@?z@?`AAx@?hNEl@Af@?P?P?n@Ar@?j@AbCArAA`A?R?rAAnEAnA?lCArEAhD?tAAD?fA?lJAz@?xD?pEAR?tDAL?dA?`FAhG?zDAnB?lB?xEAjAAzB@bDAd@?x@AfACT?TAh@Cn@Ej@C\\EPAb@ETCXCd@EVCTCf@IRCPC^G@A@?`@IFAPCj@Mh@MvA_@j@ONEHEFATIBAbA[rAe@~DcBBAlCgA@?nB{@zAo@vB_AjL}E|@_@~@_@b@Qj@UpAc@`@MZI~@WDAt@SVGfCi@tASj@Ij@GFAd@EbAIb@EF?ZCr@Ef@Cn@AbBCp@A`@?lA@pFEhAAzKEbGCdAAlGCd@?l@?p@?lD@n@?`HBB?pGBtLDvEBfA@`@?~GDpB@hB@nDBb@?rB@fC@jDBrB?hD@l@@T?L?fAAxCAdCArWMdIClLGl@?|GCxA?n@?H?XAj@?h@AbAAlBEf@AdAC`AEjBEvAEl@AP?l@AvAAZAx@?T?bAAbA?H?rDCpEAb@Aj@?P?V?B?fAA^?b@?ZAj@?f@?B?^AJ?j@?r@AfA?D?h@AbA@p@Af@ApA?V?n@BR?P@^@b@BTB^D`@D\\Df@H`@FXF\\HJ@\\JTFtC~@NF^PTHb@TJDXPh@Xd@Zf@\\v@h@b@\\d@`@\\\\NLVV^`@\\^^b@`@h@\\b@DFl@z@dCnDnBpCdAvAPVPRT\\l@x@DFj@z@X`@fCrDrGdJpBrCt@fAn@|@FJLNl@z@@Bj@v@LRZb@tApBhAbB|AzBHNX^j@z@p@`AxAxB`AtA\\h@x@jAhCrDr@bAn@~@bBdCp@~@p@bA?@|AxBpAjBV`@d@p@d@p@V^Zd@PV`@j@RZX^bBfC^f@jBnC`@l@jAbBv@hAn@~@PV@DX^bBbCr@dAzB`DV`@vEzGzAvB\\f@d@r@xAvBHJh@t@V^DFfBhCb@n@^h@fDzEv@jAX^FJzAxBdDzEpAhBlAfBbCnDb@p@~BnDdA`Bz@tAZf@RX`BrC^j@d@x@\\j@v@pAtAxBT\\x@rAZf@`@l@nAlBV\\j@z@^h@Zb@`B`CtCdEJNhBjC`@j@r@bAzAvBd@p@V`@PTV^h@t@`@j@HJ~@nA`C|CdD~D~CtD~AhBt@x@NPrAvAd@d@zDzD`A~@vFlFtKdKl@j@vDlDrBnBjG`GlAhAfOnNrM~LZZ\\ZhE~DpBnBvApA~GrGjDbDzAvAhJzIzAtAzNdNvFjFhCfCv@r@t@r@pAjAHH~@z@TPn@h@XTb@Z\\XRLt@h@x@j@d@ZRL^Rb@XtAx@jAp@dCxAlAr@h@ZrElCd@XnEjCtDvBfAp@jC|A|A|@bB`Af@XdBdAZPnAt@f@X~@h@zA|@VNt@`@DDvAx@ZP^Td@Xh@Zr@`@nAr@rAt@b@VRLjAp@|A`Ap@^^T@@^RnAt@VNf@XFDr@`@ZP\\Rf@XdAp@zHpE~A~@fAn@rAv@TLb@VTNv@d@|A|@lAv@LFh@\\VNNJDBd@XdC|AtBrAvA|@|FpDpAx@rAz@ZPf@\\rBrAD@LH^T~A`Ap@b@fBhAlDzBpDzB^TnDzBxDbCzH|ElKxGpG~DxLtHb@VZRVPdAp@hIfFzCjBtBrAlAt@fBhAbI`FpEtCXPxBrA~CpBxChBzBxAzExCx@f@v@f@~AbArBpAjGzDjG|DpFhDzBtApDzBjAt@vBrAdC|AzA~@lG|D\\Tl@^lAv@v@f@z@h@|@j@zDbCRLx@f@RNdF~Cv@f@\\Tn@`@RJ@@d@Xp@b@XPn@`@TNl@^\\Tn@^jAt@f@Zn@`@FD`Aj@fGzDhElCHDTN@?^VfAp@tBrAnAv@`@VnAv@r@d@`@VZP|AbAb@VB@t@f@d@Xx@f@j@^dAp@lAr@@@TNr@b@r@b@~@j@VNFDRLb@X|@j@~@j@JFp@b@^T\\R`@Vh@\\r@b@h@\\r@d@TNh@Z^T|@l@t@d@`Al@`CzARLb@Xt@b@z@j@hDvB^T^Tj@^xBrAjAr@x@d@z@b@rAp@t@\\|@^n@ThA`@nA^VHh@Nf@Nh@L`ATpAVvAX|@NbBXdARtEx@`ARxB^~Bb@fBZnB\\`AP`APf@JxCf@|AXlB^fEt@zEz@~HtAnB^dGfAH@nB\\z@N`@HnAVj@J`@HhHpA`BVpAVD?~A\\nAThBZrAV@?dARD@XDdCb@l@J`@Hp@LhB\\`APbCb@nATvCh@dARpB\\r@Lt@NvAVPB\\Fz@NRDvAXl@J`APf@H~@P^FtB`@h@Hr@Lx@N~Bb@f@Hb@HLBz@Nj@JtAVtAV|Ch@b@Hf@J~@P`@H^FD@b@HtATr@NlARj@JvAX@?b@Hb@HfBXtB^f@JTFlAR`AR\\FxAV`BZbBXvB`@XD`@Hb@Hr@LzB`@jB\\dARj@Jz@Nr@LpB\\hARp@Lr@LHBb@H`@FhB\\r@LrAVlB\\b@Fp@LRDb@HLBv@Np@LxAVlF`ApB^F@tAVh@HvAVRDh@JjB\\\\FVDNBpATtDp@bBZZFxB`@jARD@F@@?`APnATbCd@hF|@lDn@xB`@D@PBVFtAV@?B@fCb@bEr@bHpA^F`TvDdM|BpIzApAVlARx@NdCb@lF`AdCd@~B`@fARrB^nHpAxJfBF@dARb@HB@D@NBLB@?F@|NhCpDp@rATrAXdDh@zCh@@?fCd@b@HPBxJhBbC`@~Bf@d@JdF~A~Ar@p@`@r@`@v@j@l@f@hAbAp@v@LLn@t@p@~@BB\\f@PXNVDHPXJRXf@Xl@d@jAVr@L\\^hAX`Ab@|APr@r@vCDNH`@FXBD@B@FDLXnALd@@HH^Pv@XlArCpLBJPp@BLNn@v@hD`@dBt@xCXlAPt@Pt@Lf@x@jDZrAJf@j@dCh@fC\\bB^dBJj@VnAVnABLJh@Lv@PhAPdANfAPnAVrBFn@Hr@LnAPnBFh@Dh@BXTnCRdCR~BFt@jArNZpDHfAPjBFv@h@zGh@hGh@tGXdDVbDHbAL~APnBPtB\\fENfBTjCPvBL`BDj@\\~DFx@PfB@Pt@jJHbAJfAXlDh@rFl@vEXvBFb@Lv@L~@bAxG~AzKHd@DZd@~CLt@l@|DHj@RnA@HXjB\\~B@DPnAl@zDPjA@Dp@pEXjB\\`CjA|HXjBRpADV^bC^fCBP`@jCTzA^bC@F@HBLN|@BNDVJf@@HLn@Lj@ZrA@FFVDLFVRv@BH`@vAXbAJXFRTp@Pj@N^JV^dAJVVn@Xn@Xn@Xl@HPXl@Xj@v@vAZl@Zf@\\l@v@lA^j@n@z@PV~@lANPNP\\`@TVZ^dAfAb@d@`AbA`@b@`@b@RRNP`AbAr@v@d@d@Z\\b@b@b@f@b@b@\\^`@`@p@t@b@b@l@n@VX^`@PPPP^`@`@b@`@`@jAnAZZ^^h@j@\\^\\\\x@z@x@x@f@j@t@t@\\^rAvAn@n@r@t@TVPRb@d@z@z@t@z@h@h@h@j@v@x@z@|@lBrBZZPPz@|@j@l@JLTTb@b@pAvAn@p@~@`AHJd@f@^`@@@Z\\RT\\^n@r@f@h@PRl@p@d@h@`@d@b@f@f@j@Z\\X\\t@z@?@^`@Z\\JN^d@h@n@hDvD",
                      },
                    "start_location":
                      { "lat": 39.74389, "lng": -89.63554889999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "7.8 mi", "value": 12590 },
                    "duration": { "text": "7 mins", "value": 419 },
                    "end_location": { "lat": 38.6358417, "lng": -90.1380288 },
                    "html_instructions": "Keep <b>left</b> to continue on <b>I-55 S</b>/<wbr/><b>I-70 W</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "kxakFtnkdPf@j@X\\NPXZ@@VZ^b@PRbAlA`@f@BDf@p@\\d@RXJNFLRXZd@\\j@T`@`@r@HLXh@Vh@Pb@BJtAtCN\\Rf@`@`A`@fA\\bAZ|@ZfADNv@xCp@hCn@|CXzA`@zBLr@^nBJh@?@TnAbAlF^tBHf@f@jCVxA^pBJl@f@jCf@rCNz@dBfJNx@BNP~@FZ^pBNx@@@BN`@zB?@Nt@Nz@pBzKhAtGDRTjAx@rEn@fDHb@VtAdBlJdA~FhAhGRbATjAHVx@tE@@bAtF`@vB\\nBLn@X~ARfAJj@FXF\\Z~AHh@H^X`B~@dFFXNx@b@~BLn@H`@r@~DRdAJl@DRH\\|@bF`@xBTnAZ`B`@|B`@zB\\hBFXXxAjApGBJF`@Lz@Jn@N`AHn@VnBRnBL|AF`AHjAJnBF`BBt@BnA@v@@x@@t@?fC?dAApA?~A?dA?l@AhC?|DAbD?B?d@?ZAtC?J?nFAtBAjE?|@AjB?xEA|B?R?vB?~@?dAApJ?dBCnI?hB?bG?JArA?R?F?jAA|@?hA?bB?xE?F?~A?h@AzAA~A?B?zAAV?zB?B?d@?~FA`C?fA?b@@tA?l@@h@BfADtB@^Bl@JvAFdAH~@JbAJbAVlBJx@TtAJn@Nt@`@jBZrA`@zAb@tAPl@Vp@Rl@Zx@Vn@\\x@j@lAd@`AVf@^p@j@`AXd@hBtCJPnD|Ft@lA^l@tA|BhAhBvBhDT`@^l@n@dAjDvFhAjBzC|EtAzBzAdCT^z@tAjAlBv@pAb@p@dE~GbC~DJNh@|@nApBbAbBx@pAT^Xd@JPpAxBrApBzIxNdAdBt@fAjArBn@`ANVR^z@pAj@|@x@fA^d@X^x@bAX\\FFFFLJd@f@~@bAXX~@x@ZZvBfB|@t@d@^TRRNHHFDZXd@b@fA|@LJlA`AZTXVLHJJPLtC~Bv@p@z@r@XTzAnA~AtAf@b@p@j@",
                      },
                    "start_location": { "lat": 38.6805444, "lng": -90.0121054 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.0 mi", "value": 1575 },
                    "duration": { "text": "1 min", "value": 67 },
                    "end_location":
                      { "lat": 38.63079380000001, "lng": -90.1541232 },
                    "html_instructions": "Keep <b>left</b> at the fork to continue on <b>I-55 S</b>",
                    "maneuver": "fork-left",
                    "polyline":
                      {
                        "points": "_ayjFtadePp@t@n@r@Zd@@BXf@P\\LTL\\`@`Af@pA@DRr@Rx@RhAJj@PxAFv@Fx@@v@?t@?j@Et@CLO~AGh@M|@QvACZCZAFAZAX?R?B?Z?ZB^@XBXDVFb@BTBHH`@?@J`@Nj@L\\J^Tn@\\`A@DHTBJPd@FPHPXx@^fARf@^h@Rr@n@dBTr@vC|HbAnCtA`E",
                      },
                    "start_location": { "lat": 38.6358417, "lng": -90.1380288 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.7 mi", "value": 1193 },
                    "duration": { "text": "1 min", "value": 48 },
                    "end_location":
                      { "lat": 38.6250805, "lng": -90.16470679999999 },
                    "html_instructions": "Keep <b>right</b> to continue on <b>I-55 S</b>/<wbr/><b>I-64 W</b>",
                    "maneuver": "keep-right",
                    "polyline":
                      {
                        "points": "maxjFffgePdAbDVr@Lf@J\\Nl@@DJ`@@BF^Jh@BT@BDb@D`@D\\NxAZhCHd@LzAFv@j@`EDTDPTbA?D\\lAFP@D?@DH@B?@Nb@@@?@Nb@@@Nb@@@Pd@R`@DJFL^p@?@j@|@@@@BJNd@n@DDd@h@\\^HFh@b@BBf@^\\PVNRJVJDB`A^v@PnB\\",
                      },
                    "start_location":
                      { "lat": 38.63079380000001, "lng": -90.1541232 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.7 mi", "value": 2672 },
                    "duration": { "text": "2 mins", "value": 106 },
                    "end_location":
                      { "lat": 38.6190308, "lng": -90.18641819999999 },
                    "html_instructions": 'Keep <b>left</b> to stay on <b>I-55 S</b>/<wbr/><b>I-64 W</b><div style="font-size:0.9em">Entering Missouri</div>',
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "w}vjFlhiePtBVH@l@Jv@L~Cd@pARf@HL@H?j@H`BXhBXdHfAdAPv@TNDJB\\Lb@Tp@\\^Rd@ZNLj@`@j@j@FFLJ?@l@r@RTBFXb@f@v@@D@BTb@N\\Vh@ZbATp@Tz@VnALx@Jv@JhABb@@T?B@P?D?FDlA@z@Ar@Ad@Cl@?@Cl@KrAIr@CP[pBWtAIj@I^W`BGVCRKj@eBpKGZADEZ[bBeAdGEREVeA`G_@`CKj@Kj@Ij@Kj@a@`Ck@lDIj@Kj@k@lDCRCP",
                      },
                    "start_location":
                      { "lat": 38.6250805, "lng": -90.16470679999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.4 mi", "value": 603 },
                    "duration": { "text": "1 min", "value": 38 },
                    "end_location": { "lat": 38.6184369, "lng": -90.1908455 },
                    "html_instructions": "Take exit <b>40B W</b> for <b>I-44 W</b>",
                    "maneuver": "ramp-right",
                    "polyline":
                      {
                        "points": "}wujFbpmePKLGNELIXUr@ELCDIRQb@Wf@Yh@u@vAk@fAMTMVCJEJG\\CNAh@?RB`@BVFXHTHPBFBFHFPPRLPFx@TZD@?P@f@D\\@ZFHBLDJD^L^B",
                      },
                    "start_location":
                      { "lat": 38.6190308, "lng": -90.18641819999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.9 mi", "value": 1458 },
                    "duration": { "text": "1 min", "value": 60 },
                    "end_location": { "lat": 38.6112263, "lng": -90.2042965 },
                    "html_instructions": "Merge onto <b>I-44</b>/<wbr/><b>I-55 S</b>",
                    "maneuver": "merge",
                    "polyline":
                      {
                        "points": "gtujFxknePh@^z@j@JFp@d@TPfAt@b@Zb@XNJNJ|@p@n@l@XZVX\\f@Zf@PZXf@N\\P^Vn@`@xA~@vDZpA^`BZvADP@@TbAv@jDDPb@bB`@bBv@xCh@dBxH|U",
                      },
                    "start_location": { "lat": 38.6184369, "lng": -90.1908455 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "28.5 mi", "value": 45888 },
                    "duration": { "text": "27 mins", "value": 1606 },
                    "end_location":
                      { "lat": 38.5056275, "lng": -90.67413669999999 },
                    "html_instructions": "Keep <b>right</b> at the fork to continue on <b>I-44</b>",
                    "maneuver": "fork-right",
                    "polyline":
                      {
                        "points": "egtjFz_qePJp@Rl@V|@Lf@H`@Hd@F^DVD`@BZB\\BX@Z@Z?`@?Z?`@?VAXAVCf@Cf@CRIh@UnAAHAHIV?@Mb@M`@Wr@[v@A@Uj@IPCFM`@Sf@ELQh@GXEJI^[bBE`@Ix@Ef@IdBKdCKhBADAXCX?BAPCPANEZKl@Qt@e@bCQ`AWvACLW~Aa@~BSlAM|@Gn@I|@EXItAO~CK~B?HKrBO~D?DKbCSbECZSnFE~@A`@KvCC|@GlAAh@C^GbBMpCIjBMtASxASxAMr@Mt@K\\g@nBg@nBc@zAa@|Ai@pBAFWlACPSdACNEZUlBCVGj@ALEn@InAUxFQnD?FALI~BOfDKhCGz@I|Bi@fM?BAXAHEdAQtDOvDCl@GxAQvDQ|Dc@nKEx@SvEO`D_@|IM`DGrAk@~NE|A?FEnAAvD?jC@lC@nALxIBjCFnD?^@bDCvD?\\C|@GpCGlBc@~IOhCEt@MhCQjDKpCGvAInCEtAAr@ANEhC?\\AZ?v@Ar@ApB?nA?lA@bC?f@?P?@@fA@X?R@l@Bp@@x@@n@@VBx@Z`O@h@F|A@VNhCJzAPlBFj@D\\@HFn@JbAF`@Lz@F^Jt@RlAX~AHd@ZrABNH`@Rr@r@tCb@zAPh@XbAn@tBPh@JZPj@Nf@Rl@`@tAdDvKZdAx@jC^hA`@`AVp@Xn@\\p@`@t@HLt@jAd@p@JN\\b@JLPR~AbBPNd@^d@^TPz@l@pBjAj@VjAb@`AZxAb@lD`Ar@\\v@^@@h@Z`@XRNb@^l@j@XZtAjBbC|D\\h@j@x@`A`BjApBp@fAbCxDt@`A~@bAtAtAtBhB\\X~ArAzAvAJJl@p@d@l@f@x@HLHNHPJRBFDFN\\Pd@\\z@L^f@bBf@hB@H@BHVVbA`@xA`@xAh@dBHPPf@@DP^JVFLh@lAT`@Zj@RZR\\BBLTLPh@v@Z`@@@PRFHRR@@\\\\p@t@@@DDJJPRl@r@PTZ`@PXHLT\\JTNX^z@N^HPJXJZRn@HZLb@Jd@H^H`@Jr@DZD`@Fh@Dl@HnB@xA?v@?d@ApBDrD@p@Br@?JDj@Bb@D\\D^BTBJ@ND\\@HDTFf@Hf@Lv@Hf@Lj@Lh@ZlADNFXV|@?DX`ALb@BH@DBHDLBF?@Nf@Rh@JXJVPd@Tf@Td@R^R^RZ\\h@\\h@VZRZvAjBRTNLHL^d@FHn@n@jCnC@@j@l@lBtB|DdEp@r@HJx@z@h@p@l@x@d@t@T^T^DJLTTd@R`@FPBDN^Pb@Rh@Pd@^lAPl@@@Rx@T`AJf@@Hv@pD@DXtA`@rB^`BfG`Zd@xB`B~HzBvKn@vCPr@ZjAFRJ^JZRn@^bAZx@@@Rd@N\\Zp@Vl@p@~ANZPh@Pf@V~@Rt@Hb@FVBRJn@PlAPzA@FRjBDb@`@zCrAxIJh@Lt@Hf@Lx@`AbGb@rCFXF`@@HPfADRJv@Nz@p@bEBPHd@Hn@`@fC|@vF`B`Kp@fEBLdBxKN~@N`AhBfLp@bE~@|FrAlIXfBHj@h@bD@Jb@lCd@tCDX\\hBRrAJn@Ln@Nr@Nh@J`@Ph@Tj@Nb@P^Rb@NZPZT`@\\h@TZ^f@VZNNNN^\\ZVTTRNTP`B`ApDrBr@\\XRHDtAx@vAz@~CfBXPZNp@`@TL@??@\\P@@FDh@Xb@VFD`@TXPp@^bH~Dx@d@bE`Cv@d@`@Zd@\\d@b@\\ZTX\\b@\\b@RXPVNXTb@PZj@pAd@tAPl@Rv@Lh@H`@L~Ad@dG\\bEBd@Dr@HvADf@J~ADp@JfAL`AFd@Jt@Jj@Hh@Hh@d@pCP~@@DBL^dBH`@FTDRd@hBLf@@B@DTt@Vz@Z`Aj@bBVp@\\~@BFXr@pErKrDvI\\z@FNh@nA`@v@Zv@JRZt@LXDLHNVn@P^DLXn@Vn@d@dAd@hA?@HNRb@\\z@LVx@nBHRHR\\v@f@lAb@bAN\\x@hBb@`ADFXn@j@dALPHPn@bAj@z@l@|@fF|FfAtATX`@`@\\\\VVh@l@^`@?@LLDFDBDFFF?@FFVXTX^`@r@x@\\`@^\\LL|@|@h@l@LJlAvAdDlEp@hAdAtBh@pAj@xAdA`Ep@pC\\vADTl@pDRdBPxC@dC?nC?D?vMCvEAvDA|C?zACzREnP@nAA|LAbHAfH?\\AtEAv@A~LAp@?D?T?T?B?j@AlEAlHAvA@bECnE?BHzLBz@DhBLlBRnDd@lFj@|EJl@TpARlAPdAN~@TzALx@\\nBD\\Jj@^~Bh@jDHh@RrAJj@PdAN~@Fb@TrA?@Hh@PfA`@jCDRDXVbB@FTrABLLv@Hf@DVFl@P`BLbB?HDt@?@HtA@lDAh@Ad@CfAElBElAQnHAVIlC?LC`ACz@?VAd@AV?Z?b@?L@d@@z@?X@R@T@V@R@TBd@Bj@RvBVtCFx@PjB\\rDB`@@@@LDh@?@D`@`@zE?DHt@b@vEJrAJpAHx@@HD`@@HTdC|@zJtB~UX~CJlARtBdA~LjAjMFp@L~AN|AVtC@ND\\J|@Fh@DVLx@FXJl@Hb@J^H\\HZZlARl@`@pANf@j@fBXx@^nAPh@|D|LtAhEPl@n@nBfBtFbA`DPf@ZbAb@tAdAdDf@zAVz@DLHT@BDLX~@f@zAVx@Tt@Xz@^hA`@pA`AzCPl@b@pAT|@VbANt@Nv@?@Lt@Ff@D`@H|@HlAHrAFdAHxABl@FdAHjBPxCFrALhCBTBj@Dj@JlAFp@F`@DXF\\Hb@Nv@Ld@DPJ\\Rr@Tp@j@xAHP`@x@`@p@NVZd@l@v@X\\n@p@VVJJNLXTp@d@TNj@Zb@TPHVLb@PXJf@Nn@Nh@JnCf@fARnCd@n@JRD|@Nl@JnATdATj@NZJRHXJ~@b@f@Xr@b@NJHFbA|@|@|@TTFFZVZZjAjAx@x@n@l@LL`CzBp@n@PLJJb@^^ZTNZX\\Z\\Vz@r@b@b@TPZXx@v@FFTPZZ\\\\FDRR?@t@p@LLbAbAjIdI@@JLPNXXNPh@f@d@d@r@p@n@l@FFb@b@X\\b@h@JNPTPVHNPX@DJPVd@Xl@Tf@?@HRFPHRFNZhAFRFZLj@Hb@Jh@Jp@Hh@Db@Db@B^B^Dh@@^@d@?B@V?T@`@An@?^EpBCl@?BAh@KhCAT?VG|AKpCG|BIxBALAl@Cl@ATGrBKfCAl@A?Cx@C|@GfB?TAjA?b@@v@?L@z@Bp@Dv@Dz@D^?@Dh@?@Fv@Hr@Lv@Lx@BTPbAPfAPhADVZhBLx@TrAJl@D\\Lr@RjAXhBN`AV`BLn@Fb@PfAHf@Hd@Hf@N|@PdAJn@PvAVtBZbER~ECjF?LIdBCdAEhA?HAF?DAl@Cv@A\\?LAP?R?X?\\@`ABt@Bd@l@pF|Ipf@Lt@BPPjANpAJ`A@NHz@JpBDrAB~@?`@@xA?X?t@CzACz@EdAKxAKnAQpBI|@Gn@Q|AKbAm@|Gc@bFO~AQlB?@Gl@?@E`@?DGj@OjBWlCQvBQtBM`BABEh@C\\IbAABC`@AJUnCIv@?HGl@Gl@El@UdCAFEd@Gr@MpAUfCi@bGGr@Ir@AVCPAP_AdKi@fGKnAOvBWvDGbA?@AJAZ?@A@IpAKjBC`@?@Ej@Cn@APC\\?NCr@C`@Aj@Cl@?ZAXApAAZ?PAl@A`@?d@?|@?f@?NArCAT?d@BdAB`AB|@Bt@Dv@BR@XFj@?@@H?@BZ@DFp@BP@HF\\Hf@DXDXb@dCFb@RhAf@tC\\jB^zBBNBL^`Cb@nCBL^`Cx@lFBHV`B^bCP`AFb@PnAFj@Hr@Fp@@NB`@HxA@n@Bl@?l@@H?@?j@?@AtAAnA?|@AdBC`D?LAhBA~ACjD?d@EbFA`DAfAAl@?l@Ap@AtBAhB?H?b@?@CxB?|@AhAApAAbBAfCCjCAlCAz@AnAAfCAbCA`ACdDAjCCtDAzCAl@CdF?P?PGrGIvEI~BKxBi@vGe@|DCVa@~Cm@xEy@`K",
                      },
                    "start_location": { "lat": 38.6112263, "lng": -90.2042965 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "97.7 mi", "value": 157216 },
                    "duration": { "text": "1 hour 26 mins", "value": 5176 },
                    "end_location":
                      { "lat": 37.8367953, "lng": -92.09681309999999 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-44</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "es_jFjxlhPQtEA`@EhB?l@APA`A?xA@t@?@@j@@r@@vA?@FzBFfB@Z@JBf@Bd@?@f@vGbAdMj@lHvCt^?@Fj@LzAFj@Dl@Fj@?F`@xE\\xEX|DXfDVvCRzBJvAD`@Fv@?@Dj@JrA@DDl@NlBPrBDj@Hz@HjA@?@XH~@Dl@BXXbDHhAPxBJlAL`BNhBLtAFj@PtANnAN`A?@PjAHb@BNHb@Lr@Jh@DP?@H\\BHRbARz@?@R|@b@rB`@hBJj@tAlG^bB^jB@BXnAZ|ALf@H`@TfARz@b@rBDNJd@?B@?XtA?@VdA@JLj@XrADRFVLh@XtABJH\\f@~BJb@^dBh@hCnB~IZvAZ~AJh@Px@n@vCr@`Dv@vDbArE^hBZxApA`Gd@vBz@`ERx@\\|AXjAHb@h@dCZvAr@fDXvAZrAnBlJdAtEb@tBj@fCd@xBn@rCHZXtALh@?BLf@Jh@Lh@Lh@Jj@BJVfAJh@H^Pt@TfAPx@VdA?@TbAJ`@f@fB?@\\jAd@tADNf@vAFNj@xA\\x@BDh@lA^v@HNTb@Tb@NZz@bB`@t@Tb@d@|@h@bAVf@Zn@Xn@LZRf@Pf@BFL^BHJ\\L`@XjARx@XtAHn@F^BTHj@Fj@DXDd@D^JlADlA?J@`@BxA@X?nAAbAChACx@GfAMdBEz@MbBABIvAg@zHMbBEl@IlAGlAKxA[`FEb@[lEi@rIEj@k@zIEh@C^MhBEj@En@KxAInA[|ESxC]fFGnAMbCKbCSdHa@`M[xJUdHMxEItBCn@?D?BA^G|ACt@?@Ab@IfC?@?D?BA`@A??F?BMbEQrFO|EQrFG~AG`CErBAf@?Z?LCrBCpE?X?@?dC@dBDdD?f@@j@DnBLpEBr@?BBh@@VFfABv@NfCJ~A\\`FHv@\\xDVbCBVX|Bz@tG@BHj@Jt@RlATvAn@lDn@jDHf@Hf@j@hDXxAF^F^DVj@bDfA~FLt@DVJ`@DXVzAv@xEdBrKp@fG@NHhA@JHdABp@Bd@LxCBzABtA?@@j@?@D`CB|@Bl@?bABrAT~N@h@BbB@^D`CFpC?\\FjCBdBBhA?^@ZD`DP`LDjBJpGD`BFxD@l@@X?RB|@@z@BtAHzANdBTjBPpAVzAXzAZfAj@`Br@pBh@lAr@zAn@jAjAdBz@jA~@hAh@f@|ApAtAx@t@d@~ErBl@XNFf@Tf@V`@P`Ad@JDvDhBLFRH`Bv@`Ab@`@R^P`Ad@^P`@PvB`A~Ar@NF|@`@lAl@tFhCNFh@TJDLFPHLFRHLFz@^XLHD^P`@RLFPH^PD@j@VPH`@Pn@VZNB@|@`@^PD@^Rr@Zn@Z\\T`@Th@^b@ZdA|@XVHHPR^^p@t@n@z@BDBBTZLRJPPVXh@LTLTLTBDRd@@@Vl@Vl@\\|@Nd@Tp@Pl@v@tClAxEr@hC`@vArBxHZjA`@zAFRr@hCzDxNb@bBv@rC?BLd@l@zBNh@|@dDNh@DPd@bBd@dBHZPn@ZjAv@vCv@rCl@~Bn@|Bb@bBn@~BZhAZjAl@|Bl@zBFTjAjEn@~BPl@Rt@j@xBRt@ZhAZjAJ`@V~@Rr@ZjAd@hBn@|BXfAJ\\BHLh@Rp@XdA@DLf@Nh@t@nCFTHZDLJ`@Rr@Pl@t@|B\\fAh@~A~@jCb@lADHLZPf@Rf@Rf@b@fA@Bf@lARd@Rd@Rb@?@Tb@f@hA@@Rb@NX~@nBHNP\\Xd@@Bh@dAR^B@Zj@d@z@@@\\l@d@z@NX\\l@j@`AZj@T\\BFf@|@fAlBh@|@@DZd@jCtE`AdB|@|ADFpBnDVb@Tb@@@bAfB\\l@jBbDJN|@|AFJd@z@^p@Zj@n@fA|@~AFHTb@LTb@r@BDFLj@bAT`@Xd@@@@B@@Xf@t@pAXf@T`@BDr@pAXf@Xf@Zh@r@nAfCnET^`@p@f@t@hArADD\\ZHF`@ZBBt@f@RJRLFBLHz@b@x@\\r@Tr@RRDTD|@N@?h@Fl@Fl@Dz@BV?H?V?T?f@?B?f@?Z?V?d@?l@?F?`@?J@h@AB?`@@h@AB?D?l@@b@?b@?F?j@A@?F@pABB?B?X@x@Br@DL@J@b@DVBJ@fANXFF@x@N`B`@h@Lh@P@@B?ZLVJf@PxAn@r@\\NFNJ`@TVNLHRLTN`@XDD`@XXT\\X\\XTRBBBBh@f@j@h@l@l@zAzAB@VVBBt@t@B@h@h@LLx@v@ZZZZHFn@n@v@t@dE`ErBrB\\ZpApA^\\XVvAvA@@XVx@v@PNh@b@JHx@n@d@\\r@f@TP^Tl@`@v@d@x@d@lAl@pAl@bBr@tAf@~@Zv@TXHj@Nh@N~A^D@\\DdBZd@Fb@Fb@FdAJv@Hr@FlAJnCTbBN`AHzAN|BRbAHlE`@`CT`CT`CRtALxALL@jAJtALh@Ff@Fj@Hl@Lb@Lh@Ph@RZNLFNFJFFDVL`@XTN^Z`@\\B@XXFH`@b@`@f@@?@BX`@JNJNBDNVVd@@BHNXn@Xp@Pd@@FL^@BL`@Pn@Jf@FTLn@ZdBFXd@hCDTJj@FZ@DJd@BLH`@Jf@H\\Rz@DPFPJ`@HZHTTt@HTRn@JTl@|A@DLX@DRd@P\\Td@f@~@Zj@NZfAbBb@n@h@r@l@t@PT`@b@l@n@vAtAt@n@z@p@DDZVtAfA^Z@@tAfA`@\\RP~@t@|ArA`B~Ar@x@f@l@V\\f@l@bAzAt@lAh@`A\\p@Vf@JRLXVj@N\\HPDLBB?@JTBHFPTl@p@pBb@|ADPLh@@DXhALn@Pv@F\\RhA@Jb@`CFb@RjAd@jCHj@FXZfBHj@Jh@Lv@F^VvADTDTTtABHDZ@DHj@TvADXF\\BJDTHf@BJDZDTNt@D\\RjA@HFXJp@BHLx@Jl@\\pBJr@Jf@@L@@h@|Ch@bDLt@F^Hb@Jn@Lr@FZH`@Ll@FXBJ`AnDfA|Cv@lBz@hB`@p@NVV`@NV\\d@NTJN^h@JL@@JNJL@@BBb@h@JLNPNNRRVVl@j@b@\\p@j@NLTNf@\\B@ZRTNHDJFRLNHRJBBPHB@\\PHDNFJDPHJDHDB@t@Z@?HD\\LZLJBh@RNFHBdA`@LDl@Tj@RdA^VJh@R`@NB@z@Z~@\\n@Tb@P|Aj@~@\\LDjC`A`A^f@Px@Xl@TfC`A@?|Ah@?@jA`@`@P@?THf@RD@l@TPFh@RD@RHfBp@F@p@Vv@XXJD@b@RD@RHDBb@RFBRFTLPHXN@?BBb@RLFJF\\RFD@@b@VTNr@b@XRb@\\FDr@f@`Av@XTh@f@j@h@JJNNTR~@~@ZZx@v@ZZ\\\\rArAZZ@@TT^^ZZ\\Z?@v@t@ZZ\\ZfAfAtArArAlAtAlA^Zd@^`@\\`Ar@fCjBbAr@VP|@n@b@ZvA`ADB^XrA`ADBLJvA`AdAt@nA|@DBRL\\Vl@`@`@ZLFPNJFzAfAPL^VJF|@n@n@d@JH\\TRNhAv@PLHFRN@?FFB@NJ@@HF@@FDdBlA|AdA~AhAlAz@fAv@zB~Av@h@PLHDl@b@HFj@`@@@x@l@VPVP@@~@p@PJVPZTFDNJBBd@\\\\TBB^VPLJFXRHFTPB@FDTPDDZTh@b@HHBBPNJHRR^\\z@|@p@v@b@h@NNXb@fA~Ah@x@t@vAbAzBd@`Aj@vAL^Z|@j@fBDRd@jBh@pCX|A\\hCTrBLxAHhAB|@@l@D|A?@B`A@r@@L@b@B`B?d@BjA?FDfB@d@@ZHxF@p@@H@r@FxCFjE@\\BtA@t@@f@Bv@@Z@d@Bd@Br@@LH|@@LNjAJt@@HJj@N`ALn@H^Jf@DLNj@Tr@JXJXFLN^Rf@\\r@R`@PZHNLRT\\?BX^FJPRRVPT\\`@DDZZBDVTNNJJTPFF\\V^VXRB@b@XZPFBTL\\PD@RJJDHB\\Nl@RNDXJj@Pz@Vr@Rt@Rr@R~Ad@ZJ`@L^J@@|@Vv@Xl@Tj@Tb@RVLRJh@Xn@`@RLj@`@v@l@RPNLr@p@n@n@^`@p@r@v@x@`AdA`AbAbAfAx@|@zA~Ah@j@tAvAx@|@v@~@n@r@bAhAXZb@f@hBrBlAxA|@fAn@|@h@t@`@l@^h@f@x@^n@^n@d@z@@BXj@\\p@Xj@`@x@Pb@NZXp@LXb@fA\\`ABFd@rA^jAVv@ZfANh@Nj@@BPl@H`@XhADP?BVhABHPz@H`@Jl@P`ADRV|AHn@PhAF^XjBXtBR|Ab@vCL`AL|@d@zCHh@d@fDXhBn@bEj@zDlAnInAnIFf@Jt@ZtBzBdOP`ABNNx@VdAZnAVx@HZHVL^Rh@Zz@Zv@fA|BPZf@`Ah@x@HNHJt@hAHLbB~Bf@r@vApBn@|@pAjBVZHLt@fAhAzAf@t@|@nA|@lA|@nAl@|@|@nAlBhCLR\\d@`@j@\\f@^f@\\f@^f@\\h@l@x@b@l@Zb@\\d@\\f@|@pAl@x@^f@LRNTHHBD@@NT\\f@j@|@Xb@BDLR\\n@JTFJDFJVJTLTJVJTJXJVFLNb@FPJXRt@JXPn@Lh@R|@FXHXDXHb@@HTxADZDZBNFd@?@BTB^D\\B\\B\\@XDn@@Z@Z@`@Br@@b@?j@@V?l@CfA?^AXAZAZAZCn@Cb@G`AK`BC\\Ex@KpAEn@Cb@K|ACj@KpAE|@OtCEjACfB@v@@z@@`@Bl@@\\Bh@H`AFp@J|@Nx@DRVnANp@Pr@HZb@`Bb@fBZlAXlAXhARt@Pp@XlAZjAXlAJ^Nj@b@bBZnAb@bB^zAh@pBXjAZlARv@j@zB^zA\\tAj@|Bn@bCp@lCRv@d@lB\\nAd@dBPl@Vr@Xr@Vh@Xl@Zh@\\l@fAzAl@p@VVNPd@`@b@\\RLPLRNd@VRLj@V`@Ph@Rh@Nh@Nh@J~@Pp@F`@D\\Dn@D|@JbBNv@H|ANx@H~@JzAJVDjBPlCVbBNj@Fz@Hp@Hh@Fx@FfAJvANlBPnALnAJdE`@xAL\\D^DnAPXBXDpARLBVFVDXF\\FRDXFVFVFTFz@RjAZVH`DbAdAZdAZ^LPFPFd@Lf@NNFHBF@vAb@PFjDdAt@TtBn@ZHrAb@h@NZJPFhA\\pA`@h@Nd@NbAZh@Nd@Nl@PPHvEtAlA^vDjAr@TxAb@`@Lz@V~@ZRF~@Zh@RpAh@l@Z`@Td@Xr@d@JHdAx@b@`@b@`@nArAn@z@^f@lAjBx@nAV`@pAnBnAnBt@hAb@p@hAdBLRNPh@z@nAnBnAnBtAtB\\h@NTl@z@\\j@vAxBx@nAPVx@nAl@|@z@pAlBvCZf@l@|@j@|@h@z@b@p@f@|@Vf@v@xAz@fBDJJRn@|Az@rBb@fA~@zBhArC`@`AZt@l@zARd@JVDJHRRf@`@`Aj@vARd@FLb@bAb@bAl@hAZl@h@~@x@nAl@x@`@h@^d@p@v@h@j@l@j@n@l@b@^f@`@z@p@|@l@v@l@`Ar@zAfA`@Z@@VP^X~@r@\\Xv@j@|AhAfAv@lBvAdDbCn@d@|@p@d@\\t@h@\\VpA`AzAfAv@j@zAjAlBtAv@j@v@j@zAhAhAx@t@h@\\Vl@b@fAx@zCzBfBpAhAz@`Ar@\\VdAv@t@h@x@l@v@j@lBvAbCfBbBnA~@p@hAz@jAz@z@n@ZTd@\\|AhAv@j@fAx@v@j@\\V|@p@v@j@zAfA`@Zl@b@\\VfBpA~@r@VRRNb@Zx@n@~@v@b@^XVp@p@`@^t@x@^b@tA~AtAhBnAfBh@v@LPRXBDp@~@`@j@t@dAd@n@Zd@tAlBbAvAFJdGpIl@|@tBvCdDxEjCtDj@v@p@~@^h@l@|@zArBpAlBfBbCbCjDbAxAhDzEbAxAtCbEvAnBT\\z@hAf@p@|@jA`AhAn@r@l@n@RPd@d@j@j@~@v@pAdAnA`AZNHJBB^VTL\\TTP^RTLRHTNf@Vb@Rj@ZNJvAr@n@ZhCrAjAl@z@b@vBfA|Av@b@RPJNH`@TVJ|@d@t@^RJXPPHPJf@Vb@RRLl@ZVL^Rh@VTLlAl@b@TTLVLDBRLr@`@TLJFhAt@RNjAz@|@r@t@l@b@^PNp@p@PPp@p@b@b@`AhA`@d@NPPTX\\b@h@b@f@Z`@X\\fArAb@h@NP^b@Z`@PTNP`AjArA`Bl@t@NPbBrBlAxARVVZp@x@PR|BrCRTr@|@PRnCfD\\b@NR`@h@PTjA|AzAxBhAdBjAjBhAfBHLT\\vBhDvBhD~AhCvHxLn@bA~AfCrBdDHJh@|@\\h@`@n@NTHNZf@NRZh@\\h@NTLRx@rA\\h@j@|@\\h@\\j@j@z@LVj@|@z@rAbBlC^l@j@|@V`@T\\Xd@PVx@pAxA~BXd@l@`AZf@|@rAFLTZl@z@jA`Bn@|@|@jA`BnBbBlBbAhAxAxA~@|@t@r@@@vAnALJz@r@PNh@`@^ZxAjAbBnAnA`AJHJHDB\\Vb@\\x@n@h@`@LLLHPLJJHFxAhAx@n@t@j@v@l@|@r@~@r@NLpB~Af@`@v@l@t@l@n@f@n@d@@?HH\\XFDf@^TRn@l@PPHJJJh@p@h@p@FJf@v@JRHNTd@\\p@JTJTRj@L^HTFTFRJ^HXLh@VpAZjBXhBV|Ap@dELz@f@|CBNr@hEvB~MlAlHBHf@fDr@jEl@vD?@X~ATtARlARlALt@ZlBLz@PhAbA`GRpAXjB`@dCDX`@~Bf@xCl@pDVdATbARr@L`@JTJXp@fBRd@h@jAFHj@dAr@pA|@~AVb@f@|@nAzBr@lAVb@FJ@DDFZj@NVPZ|@~AbCjE^t@dApBl@bAR\\Zj@j@dAxB~DBBv@rAbCpEPZJRJPT`@Tb@|@|Ad@v@LV`@r@T`@LRTb@DFBFb@t@HNl@hAj@bApA|BHNLTt@pAR^pA~B~AvCn@hA~@bBZh@|B`EzB`EhBfDdCnEt@nA|BhEdAfBvClFp@nAtAdCx@rAl@hAr@lAv@vAf@bAd@|@t@bBVl@Tf@N`@Pb@Vn@Tl@ZbAVt@JZTt@Pl@Pl@Rx@Lb@Pr@Jd@h@|BXrANl@`@hBb@hBLl@XhAXnAVjAd@pBj@dCl@jCp@xCb@hBLn@Pv@`@bBt@bDv@hDp@vC|@xD\\~AHZJf@^zAh@dCdAlENp@FXJd@Lf@VhA`@dBR|@FTl@jCH\\`@jB`@hBv@dDf@xBNn@d@tBv@fDj@fCp@zCZpAXlABLR~@@DPt@J\\FRRp@Rp@b@jAN`@N`@Vj@Td@BD@DXh@\\l@DFR\\Zd@BDj@x@^f@\\`@`@b@b@d@dA`A|ArATPt@n@`@\\NL`BtAJH`Az@hA~@xApAhA~@hA`AZVt@n@BBz@r@VTdBxAd@^nAfAJJHH@@HHdAlAbApAh@x@dAjBj@fA?@JRTh@Rj@L^BDNb@Tp@\\`ABFLb@Zx@j@`BPf@Nd@h@xA~@tCJVDN@@Z|@pAxDvBhGx@`Cj@~AXx@FR@@b@lAFRj@`BFN?BFNx@`C~@jCRn@@BPf@BHDHDLdA~CBD@FJX@DN`@Xz@FRVr@@@HV?@@BN`@L\\HVTp@Vp@FRFNFLRj@@BRd@L\\BF`@|@FL\\t@`@v@Rb@?@Vd@Zp@r@rATf@BDTb@DJNVh@fAVd@P^LTJTl@jAP\\Vf@`AlBd@~@@DLTFLBFVh@Xl@HPTf@P`@@@HRTn@Th@N^BH@BL^JZRj@DJNd@\\jARp@ZhAZjABLV~@DPRz@V`ARz@d@jBj@zBNh@@BZlALh@@Fl@`Cd@dBh@xBZlAd@dBTz@b@hBZjABFLf@Ld@f@`Bz@fC\\`A`@fA`AxB\\x@h@jA@Bd@dA?@p@xAr@`B@@P`@Td@^z@f@jATd@h@jAf@lA|@pB|@pB|@pBTf@dDnHRd@fB~DpAvCRd@rAxCdDpHlEzJzBdFdDpHRd@DH`F~Kz@nB@@Rd@DJlAlC`ClFr@~A@BVl@h@jA`@|@h@lAz@nBd@bAVl@pAtCf@jAl@tAh@hA|@pBlBhEDLJRP`@FNXl@b@bA^x@R`@t@bB^|@nArCz@jBP`@Tf@f@jAZr@DFBHLXZp@f@jA`@|@@BDFf@jAR`@L\\Zp@`@~@f@fAh@jADJN^bBtD`AxBXl@Rd@^x@tBzEt@`BRd@@@fAdCZr@Td@Zr@^z@?@DHd@fAd@bA?@f@dAd@dAp@|AjAjCHPJTv@fBh@lAxDrIRd@Rb@zBbFpBrExAbDZt@h@jAzAhDRd@Tb@Rd@Rd@f@jA`BpDJT@BFNx@jBDHJRvDrIn@xAlBfEnAvC^x@b@bALVNZ@B@@b@dAp@xA^z@`AvBLXn@xAr@~AtDnIl@pAVj@v@fBBHjAhCDJnArC`@|@p@|Ah@hA`@`Ar@|ALV@DP^N\\jAjCt@`BP`@DHVl@f@fAd@fAJTJTLXhAhC`AvBJVjAhCXp@JVVl@Vp@Tl@JVJZTl@JZHX\\dATv@rAtEBHJ\\Nh@n@xB^pANf@Nh@~@bD^pANb@lBtGjCdJf@dBnAlEl@nBnIvY`@tAx@pClBtGZjA|@zC`ChIzD|Mh@hBn@xBpAnEjAbE^pAj@lB`BrF|CrKdCrIxAbFp@~Bz@rCxAhF`@pAt@jCJXJ^~AlFvDzMhAtDdEtNd@fB?@HXDNJ`@Np@@DNr@Np@DP@JFX@DDTDRNx@Jp@Nx@@FHj@?@PpAD\\BVDZNvAFp@?DFl@B^Fv@Dl@@JFlA?DJnB@^JnBP~DB`@Dv@?@Bj@LfC?@Bj@Bj@Dl@JfC?@Bj@Dj@XpGFnAPbD`@lJ@PDt@@X@JBf@^bIFfABt@FnABj@LbCBp@B`@HfB?DB\\H`BBl@Bj@J|BHdB@@\\~HJdBHdBB\\@VJrA?@HdA@DVlCDVFh@@HJt@Hn@VjBDTBT@H@FNdAHh@@JBLd@`D\\fCBPN~@Jv@F^?@Hh@f@nDb@|CL|@Hj@NdAT`BT~AT|ANfAN`AXtBPnAVhBF`@DXJt@Jr@DXJr@@HHj@DVBH?HBN@FBH@FRvAHn@Hf@BXBLJr@F^NdARxALv@DZLr@@HBTRjANt@^hBLh@Jb@Pr@Pr@L`@FVFRRp@FTRl@HX@FTr@ZfAPf@@DHXDNn@rBJ\\Rp@Pl@Vt@BJFPNj@JZPf@@D?@HVDNL^JZ\\hA\\jAHXHV^lABJFNl@rB@DPf@Nf@HVTx@z@nCBH@FHVFNNh@hAtDVz@nE~N`@pAZdA`@rA@Db@rA^pA`A`D`A`DtArETr@Pn@Tt@pAhEj@hB`AbDtApEjCvIbAhDhArDlBhGjBjGDLX~@r@|BBHJ\\^nA`@pAb@xANd@Nh@bBpFNh@t@dCvEpOjAvDJ\\Vz@Rr@\\jAd@nBPt@V|AFb@ThBBRB`@Fn@HnABp@Bz@@r@@l@?f@?r@A`@?l@Cj@IvDI`EWpKIzCC~@C|AEbBAb@ClAAx@?NAdA?D@l@?h@@fAD`AJhBHhAH`AFf@Hf@Jx@RjALp@Pz@BHH\\?@Pp@ZhA@Bf@~AfDrKr@xBzAzEPf@@DfAjDX~@l@jBFP^jAdC~HRn@~@xC|DbM\\hA@DN`@@Dd@vAlAzDrAhE`AzC@Bt@`CTr@b@vAPp@L`@Pp@XfA^bBXpAX|AVtA^zB?@@@Jj@RrA@@Hf@ZjBBLD\\PbANt@TtA`@`C`@`CH`@b@jCl@lDl@jDpBrLBNJh@l@lDTtAX|AXfBX|AfAnGTxAdB`Kp@zDTtApAnHV~Aj@`Dv@xEJh@Hj@Jf@`@bCVvAp@~Dd@tCb@dCBNZ~ATlAf@xBd@dB@HVz@FT^pAVr@\\dA|AzDh@rADLd@`Ad@`AHNLTj@dAx@xAr@hA@@f@|@BDjCrEHLTb@HL\\n@hAlBhCnEpAzBp@jA|AjC@??@T^@@Tb@Vb@`@p@rBpDnAxB^n@R^HJFJ~B~Db@v@bEbHn@hAtFrJr@lAtBpDl@bAr@pAd@|@@Bd@bAp@fBFL?@FNHVJ`@`@vALh@Pr@PbALt@TrA?@Hf@?BRrARvAHj@@@\\~B?B\\~BHh@@Bv@rF~AvK?Df@fDHj@@DFd@@D\\zBHj@@DHj@PpAHj@TtAHj@?FJh@ZzBJr@PnAfApHTtA@H?@p@rETbBnAxIJp@Jt@RlA?@\\`C\\bC`AvGtAtJpBdNJv@xA~JPpANpA@JLzADh@JtAFr@\\~EB^@JBX@XJhATbDPfCJxAVlDFp@PfCPdCj@zH@LNvBDl@RrCPxBVrDDj@Dl@hAzOJxALxAPdC|@`MPdCRjCPhCDl@j@xHDl@JxALxADj@@Nl@vI|@`MpAfQnAfQ\\~EFl@PdCDl@Dj@j@zHDj@Dl@JxAj@xHT|C@TPdCDj@^dFP`CDl@PdCDj@PfCBX@Pl@pINzBPtBL`BFr@Df@L`BNnA?@BTHp@@HBNFl@DVFb@BLJp@F^Hf@Ln@Nv@RbAXpAR|@BJXjAf@xBH\\T|@r@vCb@tBJ\\Nl@Nn@BJLf@Nt@FV@HDPNp@TpABL@FDXJt@Jr@Jp@F^Fn@@BHv@Hx@JlANlB@FFfABPBd@?@BV@L@NFt@@VDZ?DHz@Fl@LlAJv@Fb@DZ@J@FZ`CHn@D\\Jt@Fj@BJBVJv@Hf@@LD\\Hl@Hn@D^BXDb@BVBX@XBZ@XBZ@Z@X@Z@X?X?\\?\\@VAt@An@?VAd@AVAN?FCd@AZC\\C^ATCTE^CVCXE^Ip@[bDStBGj@It@WdCGr@Iv@CZAXCZA\\AZAXA\\?X?T?F?V?L@L?^@X@X@XB\\@XBZBXBZHr@HdAf@dFTdCPdBH~@Fv@LlABXFj@J~@VfCJbAN|ALrAFj@Bb@Ht@Hv@Fr@DXB\\D^DVBVDZFXFZDZDP@BFZFXHXHVFVHXJZJVJVHTN\\Xj@HPNVV`@R^RTV^n@t@NNPPTRLLTPJJb@Zd@ZTLLHTLRJ|@`@ZNLFl@VnB~@tB~@B@PHJDRJr@ZlCjAd@TbBt@nCnA^N?@RHJFTHJF`@P^N~@b@n@X|Ap@PHtAn@x@^l@Z|@f@v@d@TPXTz@t@fAfA^h@T\\Zd@NVHNR^\\r@h@nAJVJXRn@Pn@BDNn@FT?DNr@FTJt@Jt@Jt@JnA?BDt@@R@`@Bv@@L?f@@t@@vA?r@B`C@pBBbCF|AF`AHz@Jx@Nz@Nv@DTH\\L\\Tj@Th@@BLTLTLV@@T\\?@DFl@x@l@x@b@h@RVX\\p@z@l@x@Zf@LPNTLTLTZj@DJDHLXTd@JVb@fAHRNf@DJFX@BJVXbAH\\^bBJh@DRLf@TjAPt@Px@FXx@|DFTv@vDXpABJF\\R|@Pl@DPJd@L\\Vr@L\\P`@DLb@|@R`@Vh@DFNXp@bA|@jAn@p@LNfBxAl@d@RL^RBBPJdAj@`@NVLLF|DlAd@LF@bA\\hA^dBh@VHvAb@\\JfJvCtA^XJdAZ^JTF\\LJDFBD@PHB@f@PnAp@TNjA|@h@f@LL~@dADD@@NV`@n@HNVf@Vl@Xz@`@pAZjA@H@BFXBJJd@R|@R~@ZjBJh@@DNx@?Db@tCL|@n@xD`@nCDXr@rF@JVfBDh@Bd@R~A`@`EHdAXpDFp@NlC@H@ZDl@Dv@@`@Bl@@N@\\HpBBd@@Z@VBpADhABzABxA@fA@`C@Z?@?X?P?|@?\\@V?nB?P?Z?L@^@fB@lA@jA@|@@Z?N@PDzBFxAB`A@TBr@Bd@?LH~ATlEJfBb@zIPfDDx@LfCBl@NfCFrALbCNpCL~BTxE@LNlCLpCPdDBn@@JBj@DrABhA@fA?P?H?j@?@?P?XAn@?PCfA?H?FAX?@Cj@An@EjBAHAVCr@Cp@?FEp@G`ASvBKbAO`AObA?BKj@CROv@CHKh@Mh@?@Mf@I`@Oj@ADOh@ABMb@_@pAABMb@Oh@]jAADOf@[fACHOf@_@nA?@[fACHQx@M\\YdAEJo@xB_AbDoAjEoAjE_AbDIVkBjGMd@_@rAq@nCWnAg@hCW|AUxAMdAKt@AFGn@Ip@KbACPI`AGbAEr@Cd@GbAGzAAJCz@AHAn@CdBAN?T?XAR?~A?P?ZAV?V?|A?L?`@?fAAdA?l@?p@?@@xA?tBAfB?p@?|@?j@AD?dA?t@?d@?DAd@AxE?dBA|EAhEAzB?B?@?d@?DAtAAjFClG?BAzE?FAjD?HAjFAvF?PArB?T?dB?B?@?j@ArAExJAnFA|A?t@?~@AlG?hDA|E?J?tAAfD?X?X?FAhD?b@AT?PAzCA~BAdG?p@AvBAdHAjD?l@AfC?@?j@Mvi@CfJ?zAAjB?l@?F?`AC|F@TApBC|H?~AAx@?Z?~ACvGA|DA|D?hA?T?J?xAEnMC~M?zAClG?tDApDAjEA~AAvB?bB?\\?@?v@?lAD|DD`ADtABj@Bl@F|@FdA@HDj@HpA@FT|BPlBBNNxAV`CBXNpA?@DZBXHv@Fh@RnBXlCJ`AFh@|ApOD`@^jDTfC?HBR@HFp@J|@B\\@LLnATbCPhBBV@LD^J`AJx@D^\\`DJ|@TpBDf@Fl@XrCh@|EX`CVhBRxALv@?BRfAJl@DRJn@VfATfAXnANh@^`AHR`@bAT`@Zl@Td@DHHLDHn@dAfAdBl@~@FLHL`@n@jFjIdC~DXb@tBfD@@dAbBV`@?@V`@n@bAT`@@?V`@l@bAV`@V`@JPd@n@TZl@v@Z\\NPRTJJNLNPLJFFRRt@l@HHp@f@@?b@ZVN\\R`@TB@NHj@ZZPbB`AFD`@R|Az@bBz@`@PvAt@f@X~@f@vAx@f@X^RVN`CnAFB^TvAt@xC~A`ExBpFtCt@`@`@R`HtDbEzBDBpAr@PHpBnANF~A`AFBHDTNHDzBvAVL`Af@|@^`@PZNj@Tv@b@NH`@T\\Rd@XNHf@\\^VBB^XVPDBXRbAp@VRDBb@ZpBpADDtCnBb@XhAv@f@^f@^RNHHPNDBDD\\Z`@`@`@b@h@n@LRHHJNBBHJPV\\h@Zf@Zj@f@~@Xl@BFVj@Vl@DJ`@lARn@Rp@XhADRJb@Ll@?@F^BJJh@?DDZF\\BTPzAFv@Dt@Fv@NxBVnDN~BLvANxAXvBBPZxBJn@Jh@?BTpAVtAZbBLp@FZJn@@BNv@BN@F`@`C`@xBd@fCHl@Jp@F\\@BTnAThAPv@FTFRPt@HZNh@HZLl@BHFVBPHb@Jr@Hr@Db@BPFt@Bx@@BBn@Bt@FpABr@Bb@Dl@Bb@@FDj@J|@Lx@Jf@Jb@Tz@^lANb@Xn@Vl@LZHPHRJVXn@@BTj@P`@P`@?@@@Tj@N^FLTh@\\z@z@pBFJLX^z@f@jAd@jARd@Rd@BHv@fBtBbF?@\\t@d@bAXl@Xl@Xj@Xl@f@~@JRLTPZHNZf@HJPZDD?@HJNTZ`@PVPPLLVVLJNNTT^XRLPJd@VRLRJRJTJJDFBTHRH@?NDRFLB?@^Hd@H?@@?`@FJ@RB@?@?PBf@Bj@@B@b@?B?^?d@?`@?@?X@F?b@@l@Bh@FVBRBr@Lp@Nh@Pz@Zj@V\\PXPd@Xz@l@hAv@|AfAd@\\fAv@z@j@d@Xd@X^PZN`@Pj@Rd@NNDF@VFh@Jh@Hh@F`@B`@@n@@b@?vA?`A@b@?R?r@?b@?F?l@Bh@Bj@Df@FvAPhBVvCb@lAR`@Fv@JrEp@n@JxBZrBXtAThDd@jLbBb@Fp@JVBdBVb@FjC`@z@LdBZpB`@jAVPDzA\\zAd@jC~@v@\\FBh@VLDDBNH~A|@d@Z`@Zf@`@f@`@B@VVh@f@`@b@\\b@BBZ\\V^FHX`@PVZf@Vd@Xh@@?d@bAb@`AJTLXJVFJRd@t@bBr@bBzAbDz@nBVl@P\\Rd@Rb@?@Rb@f@jA~@tBd@fAj@xAN^Nf@JXRt@J^VfAR~@DV@BLz@Jt@Hn@Fb@Dl@H~@@PB`@BX@r@Bj@@l@Bl@LnG@X@`ADxAHbFNjHP|IBlAD|ADdC@j@JbF@l@HtDDxAJbF@j@PjJ@l@BhADjBLnFL`HR|JLdFBdAN`H@d@@j@FjDV`ND|AJfFJhF@p@@r@?HHnDB|@BfADxBBz@Bn@@PDdALvAFn@@JD^DZHn@@JDRDVDRDVFZBLJd@Nr@VbAL`@Nf@DNBDVv@Vr@Vj@Rb@BFLXJRXj@FJPZBDXd@T\\FJTZHJZb@`@d@`@d@TVJJp@p@tFfFh@d@nCdC~@z@`A|@LLvBpBnAnAfC`Cp@p@r@p@lAjAb@^f@b@|@t@LRXV~CvCx@v@|IfIvClCzAzAtDjDZZdA`AbCzBrBjBFHfBfB@Bt@z@p@z@HJ`BbCv@zAr@vAtB|E|@`CHRJX^~@N\\\\x@r@jBjA|C\\v@JXd@hA|@fBv@vA`A|AXb@hA|Al@v@LNb@f@l@n@`AdAbA`AxD~DhAjAd@f@",
                      },
                    "start_location":
                      { "lat": 38.5056275, "lng": -90.67413669999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "23.7 mi", "value": 38206 },
                    "duration": { "text": "21 mins", "value": 1257 },
                    "end_location": { "lat": 37.7545173, "lng": -92.5021009 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-44</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "__}eF`tbqPdAdAx@|@t@r@vAzA`@b@~@fA`@j@VZPTpAhBPXzA`C^l@RXR\\LRZf@JPV`@V`@`@p@d@t@b@p@V`@JNBDt@jAT^r@fAXb@FLf@x@Zb@Vb@Xb@pArB~@|AnEbHJLtBhDjE`Hb@r@~@bBLV^v@`@bALZL^JZX~@Ld@R|@FXRfAHr@Hr@Ft@Fr@FjABj@FzADfB@d@LfE@b@PnG@l@HbDBx@@^p@zVBp@PdH@Tf@fRDhB@b@FhBDpB\\bMFxBBp@?R?@V~Ib@`QDpAD~@?R@J?TB~@DfAFlBBbAB~@F~B?JFlC@FFzB@V?R?HBt@@XHlCH|CFlCBl@?DDtADxAB|@@j@B~AHjBB~AFdC?tBKlBKnBkAfIE\\o@rAIl@?@StAKz@WhBUhBYxB[zBK`AMv@Gj@Il@Eb@I`AGt@G|@AVEt@C|@CnAAdA?D?f@?X@f@BnABnA@vADvBDjBDfC@b@D~BB|A?NDxCBfABjAD|CBrABxADnB@b@@`A@z@Bv@?DBpA@t@@Z?PB|@?V?@@n@Bf@@`@LrBFj@Fx@NfAHp@RlAVlADRPv@Nl@Rn@J\\L`@DLFPFR@BP`@HRDJJT@DLXDJVf@Tb@DHJR@@BFNXl@hAFJVd@LTTd@PZBD?@DFHNDHTb@HNJPTb@JPFLP\\JRLV@@Xf@LTJTLTLVf@~@LVLRZl@Xf@LVXh@LTLTLTHP\\n@Zl@f@~@Zj@LVJVLTVl@JTVp@Tl@Rn@?@Rp@HXPn@HXFXFXFXJl@FZF\\FZBP@HHt@DVBXD\\JpA@ZBZ@ZBXBv@?H@PBv@@t@?t@?t@AnAAxAAJC|AA~@AJArAAl@Aj@Aj@?BA|@ChA?ZCtACvACjBA~@An@EfBCjBC~ACbBAhAAl@?`@@v@?@@Z?NBj@Bl@Bl@Ft@BXBXDZBXLbAF^@HLp@DZNn@Jh@^vAPn@Rp@HXN^J\\L^N^JVHTHRTf@b@dATb@?@LVXh@Xh@DF\\l@HLFJx@tA\\h@T`@LRv@tALR`@n@h@~@p@jAV`@FJLVn@bAVb@fAhBlCrEtG~KjCnEjCnEnH`MFHBDnEvHR\\BB@@HNDHDFp@nAn@fAb@x@DH@@b@z@FJZl@FL\\p@d@~@NXBDFJj@fAZn@LX~@hBl@hAZl@v@`Bd@|@\\n@Tf@p@pAR`@Vd@Vh@T`@tBdEzAxCl@jAnE`JHRLVHRJTJTHRJTHTJVHTJVHRHVBDl@dB\\`AFNp@pBJZDJJZTn@^fA\\dAZz@JZTn@\\`AHXXx@@B|@fC`@jA^hAJXb@rAd@rAd@rAn@`Bf@nAVn@Vj@JRLXXl@Xf@Tb@JRHNFJLVDHn@fALRHLNTV`@PV\\d@JNNRLPrAdBl@v@f@p@f@r@\\b@NRn@z@^d@pBjCjCjDLP@?LPJLTZZ`@PTNPPTLPNRNRLPPRNRNRNRNPLPPVNPLP@@JNNRPTDHHHFLDDLRNTLRJRLTLTDHHNHPBDJPJTJTJTXp@Vn@Rh@Tr@L^Nj@Rt@XlAVnALl@Hd@T~AFd@@FPhBJjAF`AVdEPnCJlBPpCL|B@NB\\Dj@RpDFv@Bj@@BHxANhC?BBV@TPtCHlADp@Dl@@TR|C?DFz@X|EZdFLrBBd@FfAJxADv@HlANfCDx@HjARzC@VDl@Dp@N`C?BHxAHtAJxAJjBr@dLHhAHbADl@JfBHtAJpA?VNvBDbAr@~Kh@hJJzA^jG^lGHrALjBFlAB`@`@vG@Pn@bKPzCBVRrDDh@HpAh@|Id@rHJbBNdC@\\@NZ`FB\\NtCTnD@VP~CB^BZ@ZJhBN~BJfBJvAL|Bl@tJ@RBd@NtB?HFz@TbEBZB^RbDh@tIFjABVBn@b@fHBTF`AHpA@TDh@FjAFpA@TB`@?J@L@P@\\@Z@X@r@?L@j@@n@?D?v@@L?L?F?V?L?F?d@?NArACpA?DAXAZA^?PAJCdAGrAAVEv@KjBARKxBc@~IMpCSfEEx@A^Ej@?FIhB?BANMnCEr@GpAC\\Cp@C\\AZAt@AV?FAR?D?X?P?d@?|@B`A?N@JBz@BZ@Z@TBX?BBZHr@@R@FFn@BT@DPnAJj@@DJj@F\\H\\TfANv@d@~BNt@Ln@F\\ThALp@d@~Bt@xDXzAP~@^dBb@zBXxA?@h@jCF\\Lh@F\\BL@FThAJh@FZPx@?@H^Nr@b@~Bt@rD\\hBLr@TjAJn@F^DXDZDXHl@DZD\\DVHt@D\\BZHr@B\\BXFp@Dv@HnAFv@HtAHpAHnAJhBFv@Dj@Bb@JhBHrAHrANdCLjBRdDR`D@RJvANfCLnB@VHxAJbBVbEDl@Dp@HlALnBNdCh@nIDz@F|@PpCLnBJjBNhCHlAFx@TxDR`DPvCHpAJfBNzBLvBHtABXB\\JfB@DBf@@LDl@`@xGj@jJPvCVxDT|DLnB?@Dn@?JHhADl@RtD@JHtAHpAD|@R`DBj@@PBh@f@tJR`ER|DBt@Fz@L~CLfCj@tK\\lHLfCDp@PrD@JB`@FxA@J?BB\\HxA?HB`@FnALdCJhBLbCBh@Bn@Dx@NtCZxGHjA@`@@TB\\Dx@Bf@PxDHxAFjAD~@@H@VFdABf@Bl@LxB?LBf@H|A@JJzBLxB@b@V`FLdC@J@NNxCLlCBd@TrEBj@@N?H@RDj@LfCBj@BXDr@?JH~A@T@P?DHzA@TBt@?F?^@j@?z@?XAx@?DAd@?LCr@ALAPARCt@C`@AHSvCEx@YvEMnBARG~@InAS`DKtA?JEh@?BIrAQjCMzBSjDKpAK`BCj@APC\\KtAATKjBADAT?XAXAZAXA|@?p@?jA@|@@\\Bt@BZBp@B^Fv@BVHt@Hx@Jp@D\\Lr@ThA@HDPFXHZFTPn@Rt@DJVv@HVVn@JZRd@Zv@fAhCzFhNRf@Pd@j@rAN\\zArDj@tAx@pBh@lAPb@Rd@j@xA`@~@Pd@hClG|@tBpA`DrAdDBFlAvC@BP`@h@pAn@|Af@lAPb@Vn@Rd@`@`Ax@jBDNr@bBDJ\\|@Tj@Rl@Rn@HZHXHVNr@VjA@BHf@BLDVFZNhABXD^BRD`@Fr@@VBZ@\\BZBt@@R?`@BtA@`CAV@N?~EBtI@zG?vE@vE?r@?D@l@?lA?r@?X@dA?d@?d@?B@rE?z@?|@@dB?rABlAD`BF`BDlAHtAJvAL~AJjAHx@J`ANfA^bCV~A^tBFZBH@FDVBJ?@Jj@Hb@?BH^X~AVtA@DHb@RjAZ~A?@Jh@`AlFRfAl@fDRbAVxALp@^tBDPHb@Jj@VzAHb@H^@JPbAX`B@DF^@J@HDTZvBBTNlABTBTP`BJjALrAL`BNrBFjADr@HhB@d@?FDrA@r@@d@@`B@t@?pAArAAp@A`@?JAj@?@AZ?PGlBIvAIxAUdDW~BMjAKv@UzAY|AsAjH",
                      },
                    "start_location":
                      { "lat": 37.8367953, "lng": -92.09681309999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "124 mi", "value": 199918 },
                    "duration": { "text": "1 hour 48 mins", "value": 6451 },
                    "end_location": { "lat": 37.0822984, "lng": -94.3601995 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-44</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "w|leFbyqsPk@|BGTIVs@fCSp@GROh@Of@m@nBsArEW|@o@rBOd@GVAB_@nAM^yAbFSr@c@vAq@zBcArDm@rBq@tBWz@_@pAGRY|@]hAIXGTGRGRADOj@M^CHYfAMh@Qr@YnAOn@I\\?BCLENEP?BCNI\\Kp@QbAAJStAe@`ECRCZAJG`@Eh@Gv@C`@GbAC`@C`@Ep@EnAEfAAx@C~@A|@?v@A~@?d@?H?v@@|@B|AD~AFbBJ|BF`AB\\Fz@TbCBVHn@LrAPzABLp@|FLdARjBZfCLlAFf@Hl@?@Jt@RjBLdAD`@@BFj@L~@V~BXdCb@rDThB?@J`A^~CFd@\\|CDXBPBR?DJx@\\zCNrAp@xFLfAZhC\\zCPpAXfCRhB?@L~@LdANpAFh@?@Hl@\\vCf@lEPzAhAvJb@lDXlCJ|@d@xDTnBHt@VxBVzBHr@XbC@@`@nDFj@Hj@Fj@RbBD\\V|Bx@dH`@fDl@bFf@nENpAHj@Fh@rBpQFd@Fb@TvBVnBVxB^jDF\\Jx@TfBV`Bh@|C\\hBTlAf@`Cp@rCTz@Rv@T|@r@~Bd@|ADLb@rAZz@Z~@FN`@dAdAnCd@fATf@d@dANZj@jA\\t@R^Td@PZNZn@fAxAdC?@~@vADHDFdA|AjA~A|ArBnB`CbCnC\\\\lAjAjBdBbBxAlAbAxAjApB`Bn@f@l@f@PNvAhArB`BDDRNHFBBpAdAbAv@rAfAVRDD\\X\\X^Zz@p@b@\\z@p@r@l@FDx@p@z@r@z@p@z@p@^ZbCnBzBhBdAz@hA|@xAjANLDDxBfBp@h@^Zp@f@bAz@PLnAbAbAx@JJJH^XbAv@x@r@HDLJNLhA~@j@d@x@p@|@r@j@b@d@^RPVRpB~AHH|@r@`Av@pAfApAbA^ZfFbEz@r@JHbAx@`CjBJJPLjCvBFF^ZTPDBtBdBhBvAjDrCbDhC|BlBz@p@bAx@hA|@~ApAXT@BzAjAHH|@r@PLz@p@BDNJbAz@hAz@xAjAjCxBfCrBlEnDp@h@xEtDdDlC`BrAt@l@p@j@fAz@|@t@@?jBzAHFJHFFfAz@p@h@x@p@@@JHRNh@b@lAbAJJ@?PLTRd@^JH^X\\XPNdBtAb@^NJJH@BNJHF@@^XPNxBfBfBvA@?x@r@RNDBVTJHn@f@JH|@r@p@h@\\Xh@b@n@f@vBdBlA`Ax@p@fA|@t@j@zCbCXTlA`A\\XjBxALJ^ZxBdBLLNL`@XjB|AvAhAPLfBxAB@tBbBJH`@\\l@d@v@n@hAz@t@l@LJPLDDpAbAf@b@`Av@tB`BnAbADBDDtAdAr@j@@?d@`@pB~AHD\\X`CjBt@l@pAbAr@j@hA|@x@p@LJh@`@d@^~AnARNrB~AdAz@t@j@t@l@|AlA@@v@l@vAfADDf@`@f@`@zAlA^Xf@`@n@f@HHNJfBvARNxBbBx@p@\\XnFfEvDxCpB~A@@vBbB\\VRNf@`@\\Xv@l@DBvBbBdBtA~BjBJH~AnAdDhCtB~A@BxAjA\\V\\XdBtAPLnA`AXTdDhC|@t@bAv@v@n@fF`EnCxBxBbBbCnBlCrBdHtF`@ZdBtAtHbGjA|@bAv@zAlAXThCpBf@`@`BpA|J~HnCvB\\XVRnFfEzAjA\\XB@h@b@RPbHrFb@\\vBbBpB|AFDhA|@TRv@l@JHbBrAfAz@ZVf@^~BjBlCtBhCrBdBrAlG~EtAfAzGlFpAbA|AlAvAhA~ApAbAv@hBvAtGdF\\VZVzAlA`@\\nCxB|@p@vDxCXRz@p@jA~@jEhDjA~@jCrBn@f@dBtAfA|@^VPNrAdAlA`Ab@\\VRnFfE~AnAn@f@zDzCx@n@lBzArCzBRN`K~HnCxBr@l@hA|@rB~AbBpArB~AdHtF\\XxFnERPRNvGhFf@^RP`CjBp@h@\\X~@v@nBbB^Z@@tAnAt@r@z@x@pAnA~@`AbAbAzA~A\\^z@`Af@l@DBz@dAbBpBFH@BBBJLhB|Bd@l@fAxA`B`Cf@r@r@dAhAfBtAxBjAlBz@zAl@bA`@t@Zh@d@z@l@hAh@`Ap@pABFv@zAh@jA\\t@Vh@|@nB|@lBVj@l@rAzAfDhC|Fp@zArCjGdCrFLZx@fB~@tBpBlEj@nAfCxFbAzBj@nAr@|A`BrDd@bAN^`BpDvBxE~ApDbClFhAfCdBxDvA`DrBtEpCfGvA`DvA~Cz@nBp@xABFx@jBtAvCjAjCz@nBh@hAn@xAt@`Bb@`Ad@dAtAzCf@fAzAhDnLnW`@~@\\p@rA~Ct@`BdBzDdBvDhCzFnBhEzB`F`FzKvB|EhB`E|AhDnGnNx@fBP`@N\\nAnC\\r@x@lBFL~AnDLVhBbERd@NXnApC\\v@d@dAVj@tAxCbAzBlCbGbBvDBFx@dB?@HRZp@~@rBRb@?@JRDH~AnDFN@@JT`BpDdBxDhAfCBDx@fB?@HRBDbAxBFNJTHRvA|CBFJRp@zAl@tA|BbFb@`AP\\HRVh@n@vAHR@Bz@jBn@vAt@`BhDvHVh@Zr@^z@Rb@FLZr@`@z@pArCv@fBHP@DP^@DbBrDr@~A^z@p@xAlC`GVf@^~@f@hAlBbE^z@zAdDFNBBFPdBxDVj@z@lBHPJRHNDLBFHNf@jADFZt@jAfCLTp@zAd@~@FLh@fAP\\d@~@HN\\n@b@z@BBf@`ATb@BFLRBFVf@j@`A|@bBBDT`@R\\BFV`@Tb@DFPX|BzDdBpCvAxBvBbDh@v@jD`FPTjA~A|BzC|C~DDBV^@?~AnBvA`BvAbBd@f@d@h@j@l@NR~AbBhAlAtAvA~B~BXXb@`@@@`A~@PPjBdB@B~@z@ZXZXpAlAx@v@^\\v@r@hBdBxBrBlCdCJHx@v@dAbAxApAt@r@fB`BvArAfAbA?@\\Zv@r@ZZ~@z@tApAPPDBv@t@\\Zv@t@h@f@VThAfA\\XBBh@h@h@d@hBbBf@d@ZZRPhBbBvApAzAvAf@d@HHfB`Bb@`@nBlBl@h@dA~@x@r@PNtAfAhAx@@@ZRHFr@d@FBBBRJ~@j@DBXNJDRL@?HDt@^HFB?PHVJRJTJfAb@DBTHJDvAl@JD\\Nx@\\JB?@hCdAd@R|@\\pAh@@@JDn@VZNJDj@T`@NhAd@RH`@PdBr@VJ~Ap@lAf@~B~@DB^NRH~@`@p@Vt@XxB~@j@T^PdCbA|An@FBXLf@Rz@\\DBZJDBdBr@~D`BbA`@x@^|@\\\\N\\L\\N|@\\v@\\@?XLXLbCbAzB|@JFn@Vv@ZB@pAh@`@Pf@PFDD@tAj@^NdCdAn@VvAl@HBnFxB`@PlAd@|CrAlAf@d@PvBz@d@RbEdB`Bl@jBx@fAd@f@RtChAl@Vr@ZbBr@zCnAp@XvDzAhEdB|@^xB|@hAd@h@TRHLD`@RlGfCrBz@xB~@VH^P`A^HDnBx@JDLDNFB@`A`@l@Vr@X@@l@VfAb@`DpATHdBp@bBr@TJTHnBx@ZLRHz@^pAh@hAd@b@PnCfAFBpAh@ZNl@TXLdDrANFjCdArB|@fAd@@?j@TB@jAf@PFbA`@^PVJFB`Bp@~CpAlBt@`@N`Br@x@\\bC`A^PdDtAvAj@~@`@bC`A@@pAh@nBx@^NXLhAd@hDrAvB|@dGdCjFtBxCjAlChAtAj@~@^lHzC~@^hBt@XJp@ZvCjAr@XnChAlBv@ZLfAd@bBp@jAf@v@\\@?pDxArAj@lGfCz@^FBVJFBXLjAf@^NvCjAlDvAjBv@VJ^N~B~@f@TdBr@xB~@r@XlIfD`Bp@l@VVJdCbADBzGnCnChAf@Rb@P\\Nl@Vv@ZpBz@jAd@tAj@b@Pz@\\r@Z\\LxB|@VJnAh@RH`@N^Nx@\\|Ap@l@VlDxAzB~@v@^tBz@XJRHt@ZHBvAl@lBx@hDtA`A^p@XlAf@LD~B`AhEdB`Bp@VJHDfA^~@`@XJNFh@Th@T`A`@PFNFrAh@pAj@jAd@RHdHtClEfB`CbA`@N^Pj@T`A`@bBp@bBr@zB|@TJdBr@bGbCn@Vp@X@?^PdCbA^NjAd@f@T|@\\z@`@pAn@j@X^RBBv@b@`@T~@l@n@b@`Ap@nBtAd@\\PNhAv@DB@?z@l@?@dBjApA~@fBlArA~@^VRPHFXTtA|@bBdAnAr@`B~@hAl@|BhAp@\\|@`@d@T~@^@?`@R~@\\d@Rb@NZJ?@d@Pz@X@@HBt@Vd@N@?j@RhCt@~DjAdAXfBf@fCr@x@PJB`@L`@Jb@LvBn@@?zBn@LDD@fBf@XHFBdAX`@LJBTF`@LdAX`@LdBf@fCr@fAXhA\\`Cp@@?`@L`AXb@LjBf@PFbGdBFBfEjAtA\\hBd@jAVtAZfAT`Ex@zBf@h@Jz@Rn@Ld@J~@TnGrA`@HvGtA`@JbATzBd@|Cn@nAVz@R`@Hb@H`LbC`Ez@`@J`@H|@RRDr@NRDXD|@RLDRDJB^Hj@Jv@PvAX`B^tAXlFhA\\FVF@?dDr@h@L^HlAXZFtFjAjAVHBH@h@L|Bd@pAZt@NPBbATzBb@`AT\\J~@Tl@Pb@N~@ZRH@@`@NXLd@TRHLHD@f@Xd@VXPLFb@Xd@ZB@dAx@NNDBb@^LLb@`@^\\TTnAvANPPT^d@\\d@^f@?@r@~@TZ@BRXbCdDxBzCBDr@~@~AxBdAxAdAvAx@jA^d@|@nAnAbBj@v@RXpAfBPVx@fAvC`EnH~JdAvAbB~Bx@fAvBvCjA`BfAxApBnCr@bAJLNRpA`Bb@h@TX\\`@@@Z^\\`@Z^dAlAx@`A@@VX@@t@|@RTdAnAXXBBRV~BnC|ExF~DvEdDxDxAbB`AjAjArABBTVpGrHRVnAxA`AfA\\`@`@f@h@p@TX^f@n@|@RZPVFHh@|@h@|@\\l@h@~@d@`ATb@\\t@Zp@d@hAb@fAXr@j@zA`@jAx@vBf@rARf@Rf@?@BFBHHRFP@@FRN^Tl@v@vBVn@b@jA`@fATn@d@hAj@|ATn@fBvE`@dA`@hAVn@^dAVn@Tj@Rj@Pb@Zx@Vn@Vl@Tl@d@`AXl@Vj@HLR`@Xh@LTVd@PXXf@LRPX\\h@X`@HLT\\JNRVJNHLh@n@X`@PRNPNPLLTXPPNPzD~DvKjKrYbYxEpE|b@fb@hBfBb@b@^`@r@x@VZVZn@x@^f@^f@V^^j@p@dAh@~@l@bAf@`AVf@Xj@r@|Az@rBv@rB`@jA?@`@fA\\`AHRPh@JZ^`AL\\L\\Nb@^dAb@hAVv@HT`@dATn@L^?@FNHT?@JX^hAZdAPn@FRNj@DPPr@BJJf@Ln@Nx@RdAJt@F^L|@Hn@H~@Fl@Fp@Fv@Fv@?LDh@?@?@Bv@Bx@B|@DzA@NFfCDpBBv@?f@@Z@r@@j@?J?f@?vA?t@A^?RA`@?ZAR?b@AZAX?XAZAZARA^CbAEbBATAb@Al@Ab@Aj@ADAf@?JA\\Aj@Ad@Aj@Ab@Ad@?f@?RAf@?l@?b@An@?r@@\\?`@?t@@n@BrA@t@Bz@?PFvAB~@@RD~@Bd@@PDz@HnAFx@Fd@Dd@Fh@b@nDl@xERjAnCjNbCxIlCbI~DxKxGlO~EvKpHxPhFjL`G~M`GzMbH`PxF|LbElJvEdKrAxChE|J|AdDz@tB|ApCrAzB~B`CjCtBrCbBnAx@rAx@rAz@^Td@ZZRXP\\RXRnAv@d@XbAn@\\TLHn@`@d@XXPTNd@ZVR`@Zb@\\LLVTZZZ\\RRRTPTV\\PRBDZb@RX@BTZNVPXNV@BNZNZR^P^P`@JXHTHTN`@JZJZRn@Lb@Lj@R|@Ll@Ln@Lx@Hf@@JDX@NFf@Hp@BPDVBZX`CNpANpAVrBn@rFVxBPvAVtB`@rDl@`FThB^hD`@fDLfA@FBP@N@?^bD@Jt@jGRhB\\rCPvA?BPvABZ@H@DHn@Dd@Dd@Df@@J@P@H@P?@B`@Bd@@l@@^@b@@b@?d@?z@?pACnG?l@AZ?hAApAAnEAz@?xA?ZAXAjDAxD?F?R?XAfCAP?tBAvA?@CxE?r@AnDAp@?z@AxB?LCpG?Z?l@AdC?@?d@ChHCdECpE?bA?p@CpFCjG?vAAlAAt@AfAGbFGtDEnBCdBChBGnCCbBEzBC|ACv@A~@KzCOdEGrAEx@ADGpAAFCf@En@SfCEZStCEh@i@vGKjAQvBWzCCREj@APAHIv@AREf@OdBWdDGp@e@nFM|AE\\Cb@Gt@G`ACp@Cj@EdAGhBG~CAv@?b@@nA?T?Z@n@@t@@R@h@?PBz@D~@@`@Dv@@VF`A@RHbAF`AFr@BNLvA@@Ht@LjA@@VjBPjAZfBNt@Nt@H^Jh@@?h@|Bl@xB@@Ld@Vz@j@dBj@|A^fAt@rBt@tBv@vBt@tBJV`@jAr@rBv@vBxAdExA`Eh@zAb@jAd@rAf@|AXz@Tt@h@`BVz@Rp@Pr@d@|ALh@V|@VbAZtAt@vCnBdIvFlU\\rAnAfFh@zBh@vBf@rBDPhBlHpG~WdAdEv@`D|@pDLh@Lh@`AxDdDdNrAnFLh@Pr@`BzGnC|KnBdILh@\\rAhAtEp@lC|Ktd@fEbQJb@J`@dAfET`AJh@VrARbAJv@Jr@Hl@@FJt@Jr@Hr@Ft@DZDZFt@JpAFhA@HJhBBv@FlBFfD@lB?l@AbN?vW?n@?xL?p@Av`@?b\\Ad_@?`B?rB?nD?rD?rU?P?hHAhC?dA?T?l@?|H?pO?n@?@@f@Ax@?bM?zKAxH@vMBb}@?^?fHCte@AxP?l@?jIApL?hA?V?rA?vKAxM@fHAtF?`C?|JA|M?zB?dA?f@?jE?p@?n@?tV?`@?`WAxA?hb@?tD?`FAnf@?x@?v@?`F?J?L?pBAjL@r@?p@?tF?rAA^@J?@?J?NAjI?jB@fF?pB?pAA|A?~I?d@?Z?X?zD?pF@l@?bAAj@?tH?dJ?bD?p@?lG?V?tF?`L?fC?jX?l@?fCAnI@rB?hAA`C?hK?l@?tA?tK?pK?pB@d@?T@\\@l@Bj@Bh@Dx@Df@Fp@Fn@D`@BRLhAJd@VxAb@lBf@dBZ`A`@dA^z@h@hAx@|AJPpAnBr@z@xAbB^b@j@l@HJlAtAz@`APR@@DDbBnBFFNPVZJLPRXZJJHJ@@fBpB|BhCBDl@r@tB~BzClDfAjAtA~ARVZ\\d@h@bAhALPTTDFv@z@RTFFPTl@p@|@dA`DpDbAjAh@j@TXfAnAjBtB`@b@nAzARTZ^z@~@@BVXBBbBlBvA`Bx@|@lAvAZ\\d@h@NNBDLNdBnB\\`@`ClC@@pBzBn@t@zH|Ib@d@tIzJ~@bAj@p@vA`B~@dAtB`CfBrBjD|D|AbBrA|ApB~Bf@j@|AjBf@j@fAnAdBnBlBvBRVb@f@b@f@BBfCtCNN\\`@x@~@nBzBNNlBtBt@x@|JfLdDtDbBnBvHvIRTx@|@BBZ^|KlMxBbC\\d@x@fALR\\f@Zf@p@fAVd@NZj@dA\\t@DJLXf@hAz@|B\\bAVx@Tt@BHNl@\\pARz@Pt@Ln@P`ALt@Jp@Jl@D`@VbB^bDn@`FDZNjALbAdDtWx@nGTfB?@ZfCt@~FPrA^zCL`Ah@bEVpBpBdPF`@PxA@DFh@v@hGh@bEhAzIPtAL`A`@dD|@lHT`BDXX|BR|AHl@D`@Jn@`@hDNhAf@zDXvBVxB~@fH?Bf@|DnAzJDXd@|D\\dCD^Jz@Hl@b@lDZbCVnBf@`EzArLF`@NnAb@dD^`Dj@lEf@~D~@hHpAdKNlAPpATnBHh@j@tE@FHh@b@jDj@rE@HPzADX?@BR~@rHLz@ZhCDXHl@Fh@Jz@PpA`@`DRvApBzOVrBD\\lAtJ|A|LpBzOvAbLvA~K|Dd[Fj@F\\@HBTrApKTbBbA~HBVRzAPrAJv@jAhJX|BbAbI?@Hp@T`BHp@NnADRD\\R`BRbBTdBBLJx@PvAFj@@HPjAPrAHn@n@`FDb@PvA@LDZ\\bCLfAXvBTlBBTJx@PfBHz@BZJnABTBd@HlADv@Dv@D~@D~@D|AB`A@l@BtA@V@v@?^?d@?h@?lB?d@AdBC`GElGC`FKhQCrCA|CApBAxACbC?|AGlJCpFEvGM`UCdC?j@?`@CrCAlA?J?j@Al@?j@Al@?^?j@Al@?l@Aj@?L?^Aj@?zAAJ?D?fAAdBA^AfCAnB?VC`C?|@A^?hACvB?lAAZAhBAtAA`DAfBAbBIbM?LAjAGjLEtGAvCGtKALAxBAdC?LAt@AbAC`FQd[AxA?\\EpF?j@?NA\\AhBAdDAj@?L?l@A|AApC?^?`E?rB?~@A`F?j@?fA?xC?~C?n@AdHAhE?nG?LAhB?vC?`@?xB?~F?zD?dDA~E?v@?J?t@A`@?rO?vE?vBArD?pA?H?xA?xAArD?X?R?l@?~C?lBAzKA`YAhJAlA?^Aj@?~@CtBAf@?BCfCAV?RAl@GrD?l@S`MKxHU~OAj@Al@s@lf@cAbs@MzHe@r\\GrDIpF?ZQdLMzHAbA?T?`@AXAvAAj@?FAl@At@Ad@EnCCjAAl@Al@AX?RCxAEdCEfCCfBANChB?PExDCfAAp@?HAz@?PCpBAn@Av@?t@?`@?V@r@Bv@?BBr@Bv@BXBXDr@Ht@Jx@@LFb@DVDZLr@Ln@F\\^~AFRNf@BHJ\\Nh@Xt@LZHRTf@Rf@`@x@LTvBhElBvDtCzFlD`HtCzFj@fA~@lBbBdDFLtAnCv@zArBbEnJdRBD|@dBr@xAv@zAjBpDb@|@R^z@dBxQr^Tb@zFbL~MdX|BnEjBtDhAzBzLdV~BxEbIzOh[ln@xKlTfJzQzDvHtGpM`GpL`b@ry@jBtD|G|MtB`E|CdG\\v@p@pANX`CvEl@lALVR\\Vh@fAvBLXvCzFjA~BLTrEbJ^p@HPnBxDfBnDlBxDhUhd@bEdItCxF^t@zKlT|FhLTb@zAzCd@z@Rd@Tb@Tb@h@hAjBpD`CvEr@vAlA`C@BR^Rb@j@fAHPt@xA`AjBtAnCh@fATb@vEhJ`AjBjBrDxI`QbApBd@|@rAlC~D|Hv@bBnAbClA`CR`@R^R`@`B`D~D`IVd@P^@@Xj@pCnF|@fBHRzA~Cp@rA`@|@`@|@b@~@`@z@`@|@`@|@r@|AbA|B`@z@JVb@bA`@bAb@`A?@`@~@Tj@LVHTP`@DLLVHTFNJRBH`@~@HPd@jADHXp@BDVn@Rd@JXDJh@nAb@bAl@vAVl@Vl@Tj@Tj@n@xA`@bAv@hBZv@JRPd@JR^~@\\t@DJRd@HRJTl@xA\\x@HRDHhAjCFP\\z@DFd@jAVj@\\x@?@DHpAzCHRDJRb@b@bAvBhF@@v@jB|@tBdHtPfCfG~AtDBFf@jAPb@b@dApA|CRb@Rf@dGrNXp@BDZv@vCdHN^JXZr@lDjIDLd@jAZv@`DtHv@hBDLRb@Vj@Rd@BHXl@tB`FfAjCl@vAHT|EfLJT@FJTFJN`@nAvCx@nBLXbExJnHfQTh@Pd@HPL^HVHVHXHVHXFTHXFXFVFXFXFXDXFVDZDXDVDZBVDZBZBXBXBZBVBZ@N?LBV@Z@Z?X@^@j@?Z@HAfCAnA?r@?ZAX?X?@?@?N?F?t@AlBAdC?d@GnN?l@C~EAtDAj@AlBArDAvCC`HAvB?DAfEA|BCvGGlMAzEClA?H?J?HCfJ?j@Ah@?h@AjFAD?\\?N?N?D?VAv@?X?nAExJAl@?Z?NAz@?j@AxA?xAAhBAxC?HA|ACfIArD?p@?D?F?J?LAl@?H@z@@j@?B@r@@RB^Bb@@ZDh@@JB\\BLBXDd@DVDXHp@DRBPBN?@DRF^Lj@FP?@J^Lj@V~@J^`@xAh@jB@DNh@jAhE?@|@`DHVDN?@zCtKZhAp@dCbCvIZfATv@`@zADLBJl@vB\\nARr@J`@DNJZzArFJ`@DLNh@@DL`@Tz@HXh@fB?BHVBHV|@Rv@Lb@L`@?BHVBJh@jBh@hBXdAHVh@pBHXh@nBRp@ZbAb@|Ap@`Cx@xCNf@BLv@rCd@~AHZDJ?@V`A^pAVz@x@xCx@tC`@|AhA|D?BZfABFLb@BHf@hBXbARx@Lf@@HLh@F`@H`@Lr@Ht@Ff@?@BJ?@?@JfABVF`A@P@V?N?@Br@B`A@v@?X?F?T?T?N?@AhAC`FEjKAt@IpN?tA?NA@?XAtDAN?@?XAzA?N?@?l@AdA?N?@?LAz@?~@A`A?n@Ad@AdCEdIAjBEtH?H?DIxQ?j@?@A`AMtUAnDAfC?TAl@C|D?`@AxA?V?R?@A~BIbOCrFClGAdCAtAAjBAjAArA?RAxB?x@AjDEnNAvEA~D?bEAt@AvEAjGAlGAhHClIAxE?l@AnDAtB?p@?NC`K?bCAxAA~E?v@?l@?@Ah@?b@AzD?|BAxA?R?~CAnB?@AnC?HA\\?@?~A?fBAxHArC?NAp@?|A?f@ChM?f@A`EIr]E`Q?dAA`GAv@?l@?j@?xAAbA?T?l@?j@A|@?dA?BAj@?l@AjAAx@?h@?BCxDEjGCxE?@CdC?j@Al@AxA?j@AzACrDGrJCjCC~DGdICnGA~@A|BCfC?r@?l@AbAArBElFEnGAxB?rACzA?l@EvD?T?RAj@ExGE~DEdECfDErFAt@MnP?NQ`SE`FIzI?FCxECzCAdAIzHAhCKtKEvF?PElGAxAC|EG~IEnH?rAA\\?L?^?XGtLIlNGvLAj@?lAAXA`B?lAAnA?ZCvB?lA?HApAChDCjEAxA?T?RArA?dAA`AAxAAxA?n@CbCAhAEhE?z@?t@E|FIpG?`BCjCAn@A~BCvBC~DA^?R?l@?NAB?dAAj@?l@?DAf@?RAh@?\\CvA?J?F?FAZ?H?b@?FCfCCfCA|@?ZCxA?F?ZA`BAl@?F?ZCdC?H?FItI?H?j@GrHCdC?PAZ?NCvDOrR?H?NCdBGpJAdA?j@Al@EpE?`@AhAIdK?@?\\E~ECjC?h@?@?@GnHGrHCbC?@?|@KfNChBCnD?l@ArAExFEjFAbBA^?j@AVMfRIlLEtFCpFA`AAvAAz@Al@?HC~D?TAT?j@AdAAj@?LMhREtDCtB?vAAx@CrDCxDA|BArAAX?j@Al@CbCEbFAxBErFCzDEfDCfEAfBCzDAf@ArB?HAf@AzAAv@ApB?j@CzBAf@?\\?NAl@?LApBCdC?XAlBCnDAD?j@CxCA`ACjC?j@A|@?PAnBCxAAvA?B?j@AbA?f@AZAvA?@CxCAdAIbMClCC|C?FAhAGdH?JA`@?J?p@IbJC~EArACzDAlAAj@CrC?h@EbFA~AEzECfDC~C[~d@GzI?FI~J?@C~E?@C|CEbGApBSnWA~@IbNAfAChBGdLAlA?DArAE`F?@?H?`@AF?|@EfE?r@AlA?NC~A?jAA`@?~@E`EEnHEfGCtCEzE?`@AfBCvBCnECfEAj@Aj@?l@CfCGfJAnAAlBI~JIlNEvFApAC~DI|KG~JAv@MxSAxAAj@CbFAh@?n@AvAAf@A~AElG?@Ah@?@GtKAj@?j@?@MrQEfIIrMM~QG~IIjLCvBGdLEtEO~VGdIEvGEfFAdACrFEdE?b@ApBAbA?`@Af@?^AfEAzKAv@?N?F?T?XAjGAjEAjE?rB?fBChMCdM?`A?vC?vBAnCAhHE~YEzZC|HCvRGte@?xAAnGA`F?l@?DAfGEz[CbJ?fAAlG?`AA~C?dA?zCAzCAlE?zDCzQCrKAzLAxFA|DA|D?tDEzW?bIAbCAtKAbB?rBA`CCzA@rD?l@?lG?r@A|AA~HCbM?lA?nAAlGAlHC~M?lG?l@CnMKhx@AzH?l@E`_@C`M?j@Irq@?rA?t@?t@?r@CxK",
                      },
                    "start_location": { "lat": 37.7545173, "lng": -92.5021009 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.2 mi", "value": 271 },
                    "duration": { "text": "1 min", "value": 12 },
                    "end_location":
                      { "lat": 37.0828531, "lng": -94.36316219999999 },
                    "html_instructions": "Take exit <b>15</b> toward <b>Duenweg</b>/<wbr/><b>Joplin</b>",
                    "maneuver": "ramp-right",
                    "polyline":
                      { "points": "ksiaFfv|~PKTA@Ct@Gt@AFCXe@pEg@vE" },
                    "start_location": { "lat": 37.0822984, "lng": -94.3601995 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "5.5 mi", "value": 8842 },
                    "duration": { "text": "8 mins", "value": 475 },
                    "end_location": { "lat": 37.0839082, "lng": -94.4627819 },
                    "html_instructions": "Continue onto <b>I-44BL W</b>",
                    "polyline":
                      {
                        "points": "yviaFvh}~PEl@AHGz@A\\Cl@CbA?`A?L@\\CxA?h@CvB?z@?^?V@b@?NBn@Bn@HlAHlA@HPnCDt@@\\B\\@z@?^?R?z@?R?tDArDArBAdHA|EAjCAnDAjGAbF?l@?DAvFA`@?v@?l@?j@?l@?l@A`FAdC?j@Al@?fCAxB?\\CjEAj@?xAAl@?Z?NCtD?j@CrD?n@?v@AzAAz@?hACjC?bBAl@?fAAf@CjE?XA`CArA?~AAzAAxA?p@ArAA`FAj@?v@CjEChGChC?JAvFIdKB`DAhD?pA?zBAvAArIAjFArFCtKArD?vCAhDA~J?bC?L?l@Ah@@R?b@?d@@vA?HEjB?xA?l@?lC?zC?^AX?h@?L?fACpBCxA?TA~@?JA~@CxAGnFGhHEpE?`@?f@AhB?j@?dCAfC?j@AfCAfCAnBA~EAxCEvOCrEAzEC`F?tAArACtKEzOEnGAfF?^ElH?pBAhBA`F?l@AdC?j@AfC?`A?j@?^A^?n@AjAC~A?p@A~@K|L",
                      },
                    "start_location":
                      { "lat": 37.0828531, "lng": -94.36316219999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "2.8 mi", "value": 4508 },
                    "duration": { "text": "7 mins", "value": 412 },
                    "end_location": { "lat": 37.0840469, "lng": -94.5134959 },
                    "html_instructions": "Continue straight onto <b>I-44BL W</b>/<wbr/><b>E 7th St</b>",
                    "maneuver": "straight",
                    "polyline":
                      {
                        "points": "m}iaFjwp_QE`ICdCCfDCdDAfCCbCAr@AxAA~AAxAAxACdDA~@CzC?|@Ax@At@A~@AfAGh@ALAR?@?P?bAAdBAfBCbCAtAA|BAb@?n@?tC?~@@n@DxALXH`BLpBBZBl@Fp@HxAHpAHrABv@@DDxA@lA?`F?f@?~AAzA?|@?bA?rB?T?pEC`F?~EA`F?xAAl@?|A?jA?rC?~@AxB?h@?jBA~AAb@?\\?~A?pA?r@AbA?TApA?xEAr@?fAAv@@`@AP?JIV?x@?vACxDAvE?|BH^A|@?tBAfB?hC?pAAtA?tACnG?j@?N?lA?RAx@?zB?T?hAAhAAj@A`BAnAA\\ClB",
                      },
                    "start_location": { "lat": 37.0839082, "lng": -94.4627819 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "151 ft", "value": 46 },
                    "duration": { "text": "1 min", "value": 10 },
                    "end_location": { "lat": 37.0844619, "lng": -94.5134815 },
                    "html_instructions": "Turn <b>right</b> after Arvest Bank (on the left)",
                    "maneuver": "turn-right",
                    "polyline": { "points": "i~iaFjtz_QcACM?" },
                    "start_location": { "lat": 37.0840469, "lng": -94.5134959 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "59 ft", "value": 18 },
                    "duration": { "text": "1 min", "value": 4 },
                    "end_location": { "lat": 37.0844602, "lng": -94.5132756 },
                    "html_instructions": "Turn <b>right</b>",
                    "maneuver": "turn-right",
                    "polyline": { "points": "{`jaFftz_Q?g@" },
                    "start_location": { "lat": 37.0844619, "lng": -94.5134815 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "79 ft", "value": 24 },
                    "duration": { "text": "1 min", "value": 12 },
                    "end_location": { "lat": 37.0842449, "lng": -94.513284 },
                    "html_instructions": "Turn <b>right</b>",
                    "maneuver": "turn-right",
                    "polyline": { "points": "{`jaF~rz_Qj@?" },
                    "start_location": { "lat": 37.0844602, "lng": -94.5132756 },
                    "travel_mode": "DRIVING",
                  },
                ],
              "traffic_speed_entry": [],
              "via_waypoint": [],
            },
            {
              "distance": { "text": "217 mi", "value": 349512 },
              "duration": { "text": "3 hours 17 mins", "value": 11799 },
              "end_address": "Oklahoma City, OK, USA",
              "end_location": { "lat": 35.4675612, "lng": -97.5164077 },
              "start_address": "Joplin, MO, USA",
              "start_location": { "lat": 37.0842449, "lng": -94.513284 },
              "steps":
                [
                  {
                    "distance": { "text": "79 ft", "value": 24 },
                    "duration": { "text": "1 min", "value": 8 },
                    "end_location": { "lat": 37.0844602, "lng": -94.5132756 },
                    "html_instructions": "Head <b>north</b> toward <b>S Main St</b>",
                    "polyline": { "points": "o_jaF~rz_Qk@?" },
                    "start_location": { "lat": 37.0842449, "lng": -94.513284 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "59 ft", "value": 18 },
                    "duration": { "text": "1 min", "value": 7 },
                    "end_location": { "lat": 37.0844619, "lng": -94.5134815 },
                    "html_instructions": "Turn <b>left</b> toward <b>S Main St</b>",
                    "maneuver": "turn-left",
                    "polyline": { "points": "{`jaF~rz_Q?f@" },
                    "start_location": { "lat": 37.0844602, "lng": -94.5132756 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.1 mi", "value": 187 },
                    "duration": { "text": "1 min", "value": 65 },
                    "end_location": { "lat": 37.0827841, "lng": -94.5135602 },
                    "html_instructions": "Turn <b>left</b> onto <b>S Main St</b>",
                    "maneuver": "turn-left",
                    "polyline": { "points": "{`jaFftz_QL?bABbABV?`DF" },
                    "start_location": { "lat": 37.0844619, "lng": -94.5134815 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.6 mi", "value": 2552 },
                    "duration": { "text": "4 mins", "value": 240 },
                    "end_location": { "lat": 37.0598499, "lng": -94.5146147 },
                    "html_instructions": 'Continue straight to stay on <b>S Main St</b><div style="font-size:0.9em">Pass by Hardee''s (on the right in 0.8&nbsp;mi)</div>',
                    "maneuver": "straight",
                    "polyline":
                      {
                        "points": "kviaFvtz_QjABdABdBBbFHtA@bA@R@R?nAB|@Bb@@f@@~DF|CDx@@V?f@@t@@~@@`A@`ABb@@~AB~CF^?|CFvABpABj@@H?jABb@?^@x@@T@L?N@T?z@@fABZ@r@@V@nAB^@rABnABr@@zAB^@xA@pABx@BlCDZ@nABV?rBDbEHJ?`AB`@@~CF^?X@v@BbABb@@",
                      },
                    "start_location": { "lat": 37.0827841, "lng": -94.5135602 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.2 mi", "value": 302 },
                    "duration": { "text": "1 min", "value": 21 },
                    "end_location": { "lat": 37.0571337, "lng": -94.5147455 },
                    "html_instructions": "Continue straight to stay on <b>S Main St</b>",
                    "maneuver": "straight",
                    "polyline":
                      { "points": "ageaFh{z_Q`ABh@@x@@r@B\\?p@Bd@?nABlABp@B" },
                    "start_location": { "lat": 37.0598499, "lng": -94.5146147 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.3 mi", "value": 2113 },
                    "duration": { "text": "3 mins", "value": 159 },
                    "end_location":
                      { "lat": 37.0381852, "lng": -94.51489959999999 },
                    "html_instructions": 'Continue straight to stay on <b>S Main St</b><div style="font-size:0.9em">Pass by Jimmy John''s (on the right)</div>',
                    "maneuver": "straight",
                    "polyline":
                      {
                        "points": "avdaFd|z_Q~@@bCDv@?NHD@F@F?dABt@B|@Bb@@~@Dh@?T?J?rA?z@Eh@Cd@CH?`AKp@I|B[zAQf@G|@ITCt@E|@AXAxEFzBDx@@jBDxAB|EFnGJjBDbCDnFH~BDjBB|EHjDFZ@fAB",
                      },
                    "start_location": { "lat": 37.0571337, "lng": -94.5147455 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "94.3 mi", "value": 151786 },
                    "duration": { "text": "1 hour 20 mins", "value": 4807 },
                    "end_location": { "lat": 36.1678313, "lng": -95.7322449 },
                    "html_instructions": 'Merge onto <b>I-44 W</b>/<wbr/><b>MO-43 S</b> via the ramp to <b>Tulsa</b><div style="font-size:0.9em">Continue to follow I-44 W</div><div style="font-size:0.9em">Toll road</div><div style="font-size:0.9em">Entering Oklahoma</div>',
                    "maneuver": "ramp-right",
                    "polyline":
                      {
                        "points": "u_aaFb}z_QTJF@vABJDNJHFBBVVJTLPPRFBNJXJnA\\l@R@?pAv@t@z@@?@?H?l@`AlGbLh@z@Xd@f@~@zH~Mh@`AvAhCJPt@nADH\\n@HJT`@bAfBXf@Vb@P\\bA`Bj@dAXd@b@p@LP`@l@f@r@RV`ApA`AjAn@t@d@d@BDTVRRdAbAjAbAPN`DrC|IzHxTtRB@ZXfErDvBlBv@p@|@v@ZXvAnAvAnAZXtBfBhC|BdA`A`A~@r@t@p@v@r@x@n@v@`CfDrEhIb@x@^z@d@fA^~@j@zA`@hAPl@JV\\jAV|@Nj@Pl@Nn@Rz@ZpARdANv@f@xCDZBPLt@H|@lArLjBlRzAzOPfBtAnNdAdKFj@TzBH`ABR@FDf@Hx@^rDT`CRlBBTDh@DZH~@JbA\\pDXjCTbCRnBT`CZxCJbAD`@PhBDb@BNZbDVlCRhBRzBBLDf@h@pFRjBDh@VfC?@n@tG@Fb@fERvBFb@?DD\\Z`DZfDj@vFTfCNrAl@lGLrAHr@@RJ|@B\\J~@PdBLpA@F@LXtCJfA@DJdAJbAH|@@@@N@H@PLfAJhA@H@D?HPhBNzANtAN|AJ`ALnAb@jEH|@@DHv@RrBPfB@ND^JbA@N@?Bb@BLFv@BL?BD\\Fn@Fn@Db@@JPfB@JDZ@HD`@?@BZJbAFh@?DDVJ|@N|ANzA@Fb@pEVhCRjBVfC?FHl@NpAJt@NpADXXjBPnAXhBDRXjBJl@Hd@Z~AHb@Hb@@HFZH\\Jb@FXXhANl@HXLf@BLl@`C~AfGJ^HRBLNb@Jb@L\\Ph@Tp@f@vAFPLZ?@Vp@HTRl@Tj@Vl@@Bb@fAf@lAv@jBJRP\\`@z@JTPZP`@BBJTLVXl@Zl@Xh@LXFHFLLTJPTb@@BNVNVJTHNBB?@Zh@NTBDDFLTDHJPd@t@Zf@DHDDn@bADHPVd@r@@@xB~CLNxAnBV\\V\\`@d@p@v@p@z@nBvBXXJJLNb@d@hAhAv@x@rAvABBt@r@BDNN`@b@ZZB@VXDDp@r@@@XXDBDFj@j@VXBBj@j@JJX\\DBTVjClCv@v@rAtAZZZZNPfBhBRRZZRRf@h@p@r@TVDDX\\DBVXt@v@X\\@?LPJJNRHHBDjApA\\^PRFF\\`@BDn@v@d@h@JL^d@X\\@@JNRTJNX^TXBBRXLNd@j@DFf@n@r@`Ax@fA`@j@Zb@h@t@DHBBLPFHLP\\b@DHp@~@DDJPFHNTJNJPNRPTV^PR?@FHPTZd@TX\\d@LPd@n@PXFFV`@Zb@LRFFLPJNV^DFLPDDPTDHbAvABBt@dAV^DFJNv@dA@@hA~AX`@h@v@X^l@|@BBDFPTh@p@z@nApAhBbAvAnD`FNRPTNTjBhCbAvADFPVX^bB`CDFPVX^|B`D^h@lCvDrHjKbLzOV^rAhBPVV^vF|Hz@lARV|@lAJNn@~@z@jA`@j@h@r@BDLNDHFHHJJL`@n@JNDDV^Z`@RXd@p@X^LPd@p@V\\RXJNPTJPb@h@j@z@FH\\d@f@r@l@x@tBvC`B|BzFbIdB`CbI`LV^X^JPf@p@h@v@`ApA~@pAXb@RTr@bA|@nA`@j@HJDHNP`@l@j@v@z@lAd@n@HLX^~AzB\\b@V^X^p@`AhA~AFFPVX^FHhA`BNTX^?@\\f@~@vAh@|@f@v@r@nAXd@\\j@h@dAT`@j@fAVb@DJLVTb@Rb@Tb@LVDLTf@dAzBdAbCn@~AFRPb@BDZx@`@hAz@~BlAvDZdAx@jCn@bCV|@Lh@Rr@Px@p@pCv@rDf@dCP`AZ`B\\jB^lBH`@BRRdAdArFhAbGNt@dAtFJf@Jj@@DlApGP~@n@bDbBbJDRPz@VtAF\\FZHZFX?@BNFV?@BNj@xCJf@H`@Nv@@JTdAF^X|ADNPbADP@Hb@~BZ`B@@BNFXr@xDvCpOfAzF\\jB@DP|@^pBNv@BNFXZ~AF^VrADN^nBn@hDf@lC|AbIHf@\\dBj@zCJf@Jh@BNh@vCJh@DP@DBR`@tBH\\Nx@F\\VrAXvAh@nCNv@j@xCJj@Jh@Nv@TjAh@vCFZNx@F\\Jd@Lp@FXPz@TrAPx@n@lD@?VrAFXBPVpABNFZJh@VrAJj@BLFZ~@`FR~@j@bDFZXxAbBvI\\fBFZF\\bBzI?@Jf@rAfHHb@XtAJn@Jh@H\\@Ld@|BVtAVrAhA`GTpAVpAhA|FJh@p@nDPz@DX`AfFFZpA~GJd@zEbWfAzFp@lDLr@TjAd@~BFXRfAVjAFZFX\\bBFVFTPt@DRH\\^bBPp@VjAdAfEf@lB^xAl@zBb@~ARp@XbARt@HVX`AZ`A`@tAf@~AFT|@tCPf@Nf@Nf@vAtE`GpRNf@fCfIl@nBNf@`A~CNf@p@vBjD~KlEtNpBrG@B`BnFNf@bBlF`A~CNf@f@bBjBbGPf@dE~MPl@pC`J^nA`@nA`A~CvGfTp@zB`AzC`@tAN`@~@|CFRJZfDvK`DjKnA|DHXRl@f@`BRn@HXPl@Rp@\\dAJXPl@Pn@Nf@Pd@HTbAfDf@bB^lANb@x@hCrAjEn@tBh@fBbA~CBHX`Ah@~A^jAZdATp@jAzDNf@Z|@FTd@xAj@bB`@hA^fATn@JRv@rB\\z@Zt@Xn@Vl@FLLZjAdCz@hBh@bAv@|An@lAPXJRHLXh@RZdAdBl@bAV`@V`@RZBDdAzAT\\X^LRNPxC~DnA~A`BjBr@v@|@bA`AbALNf@f@lAjAx@v@ZXNNXTLN@?ZVb@^t@n@b@^n@f@TR`@Zr@h@h@^PLn@d@?@tA~@j@^z@h@`@VTNLHbAl@n@^TLbCrARJf@V`@P@@ZRLDRHd@T`SzHx@Vt@Tx@XZLnDpArDrA@?j@THBHBXJv@V^N^NtDpAfHdClDnAB@THVHLD|JlDp@VfBn@~Aj@B@FBr@T~EdBdC|@d@Nh@N`Bp@n@Rj@V^Lx@XbCz@xG~BrAf@z@XZL|@ZDBlA`@z@XNFB@d@P\\L\\Lx@X`@NnC~@v@X|@Z@?PHnAb@ZLz@ZnAb@vFnBbC~@dCx@xAf@b@N`MlE`FfB`Bn@pBr@jBt@zAj@XLjAb@`A`@LFRF`@NNHVH`A`@XJ^NlAf@lCdALD@@`@N`@N`C~@NFvAh@VJDBpBv@RH@@^N@?`A`@^L@@`@NLF~ClAn@VlAf@dE`BbA^`A^dC`AbA`@b@P\\L@@`@N`Bp@@?^N@?zAl@hAb@`A^@@~@^@?jEdBdC`AzBx@n@VVJb@P@?VLf@P^L@@bBn@`@L?@p@T`ItCrBr@zEfBb@P~@\\bA^fDlAbA^@@^L^N@?^N`@NbA\\bBn@@?zAj@lBp@xBv@tEbBbA^dC~@n@TtAl@r@VxCdA\\L`@N|@\\B@ZJn@TRF`A\\F@v@Zr@Tj@XhE~A^L@?`@N`@NfHhCF@ZLd@PdBl@h@Rb@P`@LbC~@fC~@`@Lv@Xl@T`@N^L`@Nl@TTHHDlDpAtAd@hE|ArAh@vDvApFnBLDpAd@XJ`@PzFnB|Bz@bA\\LDRHlG|B~Bz@f@PnMzEhBn@zBv@jAd@jE~A|FvBhFlBtAf@`@N`@L`@NbBn@d@NhE|ArJlD\\L^NbA^~Bx@pBt@~@\\d@RhBp@|DtAbA^dA`@THJDdDjAtMzE`@NnC`AzLnE~GfCd@PvK|DfHhCpAd@nQrGFBx@ZnHlCpE`B|VdJ`Cz@LDzVdJHB`EzA`@LjAb@~ChAlCbArOvFlBp@~CjAnIzCjC`AvBv@xAh@`Bj@vDtArBv@rCfAx@ZbAd@`Bt@xBhAzAv@dAl@fAn@z@h@d@ZxBxAtA`A@?lA`AjElD|@x@bB~Ap@p@bAbAxA~AfAlARRV\\bAlAv@`A^j@`@f@dAxArAnBtAxBhBzCb@t@dCtE@@~AjDx@hB~AvDn@~Ax@|Bl@`BZbAx@hCt@fClAnEz@hDx@hD^tAJ^DPJ`@XdAlBpHXhAz@bDv@zC^xAh@tBj@xB|B|IXfADRFTLh@J^r@nCb@bB~@pDrAfFDNx@bD~AnGp@hCHZ`@~AFRDP\\rABH`@zA`@|A^zABLf@jB?@j@zBr@lCbA~DJd@Lb@V`Av@~Cd@bBXfAXhAXdARz@d@hBJ^V~@d@lBdBzGRv@rAfFbCnJtM~g@v@zCzEdR\\pAxKxb@Nh@t@zClArENj@pCvKxAnFf@fBJ\\J\\Pl@h@fBv@jC\\dAd@|A\\hA|AfF@DnEvNRp@vD~LdAhDNh@dBtFt@bC@DpBpGLd@pAfEHVDNbA`D^pApBpGb@vA~EbPrEdONf@`@nANf@pAfEdFnPhAtDv@fCPf@Nf@jA|D`O~e@^nAlPli@Nf@^nAdG`Sb@tAnBrG`AzC^lA^nA`@nArAhEt@bCjBfGJXd@zAPl@Tt@X|@Nf@FNHXNd@~@~CNd@lEtNpKn]Nh@ZbAzEpOdBzF|AbFNd@Nf@b@xA\\dAPh@Pl@lDdLdAhDDNzA|EpBtG`@pA^nATt@Tt@JX^pA`@nAJZTt@Tt@`@pAv@fC^nATt@Vx@^lA`@nATt@Tv@JZTr@`@pAHZTr@`@nATt@Tt@DLp@xBTt@HZ`@nA`@pAL`@Rn@Tr@Tt@^pATr@Vv@Tt@Tt@Tt@BJPh@Tt@Tt@`@pATt@`@nATt@Tt@J^h@fBJXPj@BHJ\\HXVt@Tt@Tt@Tt@Tt@Tt@Tt@Tt@Tt@`@nATt@Tt@`@pATt@JZHXTt@`@pATr@Tv@HT`@nAJ^Tt@v@dC`@rAJ\\Rp@DNZ`ATt@Nf@Pf@Tv@Tt@bA`D^nA`@pATr@ZfADHJ\\vAtE^nA`@pAb@vA`@pAVx@`A`DTt@FPL^Pl@Tr@Tv@Vx@L`@Rl@Tt@Tt@Tt@J\\Rp@Vt@Tt@Tt@Vt@Vt@Vr@Vt@Vr@Vr@Xr@Vr@Xr@Zr@@DVj@JXBBHTLVLXLVXp@Zp@NXJVFLRb@\\n@\\r@b@x@bAjBJP`AdBxBnDl@~@PXDDJNDJDDJNr@fApAlBV^X^V`@JNV`@T^jAbBp@bAHLx@lAz@pAz@pALPLRNR\\f@j@|@jAbBb@n@HLj@z@l@z@jAdBRZV^NTj@z@\\f@`@l@LNZf@^h@Zd@z@pAl@z@l@|@\\f@\\f@\\h@LRj@x@|@pA\\f@LR^h@Zd@^j@hA`Bh@v@PXjAdBBBXb@V\\DJn@|@j@z@j@z@\\d@l@~@l@z@z@pAhBjC\\h@^j@j@v@hAbB\\h@l@|@Zd@l@|@l@|@\\d@\\h@\\f@l@z@\\h@d@r@DFl@|@z@nAl@z@\\f@HL`@n@\\f@HHR\\l@|@l@z@\\f@\\f@\\h@\\f@vAtBbFrH\\h@\\f@|AzBPZn@~@xDxFh@v@h@x@vApBzAvB`AzAlFbIv@jA~BlDJNLTh@v@Zf@\\h@h@~@T\\T^Zh@Zh@Zh@Xj@Zh@j@`AVj@~CvG~B`F|DlIZr@Vf@Xr@HRLXJVHVJVJTJVHVJTJXHTJVJVHTj@~AHTTn@Rn@Tl@HXHVJVHVRn@Rn@Vt@Pl@Rn@HVLd@DJPn@HXHTRr@b@~AV~@BJHZXfALd@BJHVPr@Nn@?@HXNn@Rt@`@bBr@rCXjAXhAPr@XhAXlAPp@Pn@FXPp@Pp@FXPp@FXHVNp@Pp@Pp@Pr@Nn@V`Ab@fBDP\\vA\\pAh@zB\\pAf@pBn@lCBJt@vCNl@XjAPp@Np@BHDNh@xBf@nBLh@Pp@Pr@J^Lh@XhAHXPp@HXHVFVHXHVHXFVHXDLBFHZHRRp@Rp@Pn@Tn@Rn@Tp@Rl@Tn@Rn@Tn@Vn@Tn@`@dATn@Tl@Vl@Vl@Vn@Tl@JT@BHPHR@BVl@Xl@Vl@Xj@Vl@Xj@Xj@Vl@B@Th@Xj@Zj@JTPZFJv@zA@Bd@x@NXXf@f@|@NTLTLRZh@Zh@\\f@Zh@Zh@\\f@\\h@\\f@\\f@\\f@RX`CfDt@`Al@x@n@v@\\b@l@v@^b@Z^RV`@b@`@d@n@r@`@b@`@b@^b@bAdAPP`@`@`@`@`@`@b@`@`@`@b@^`@`@d@b@z@v@`@\\n@h@^Z`@Zn@h@p@h@\\Xf@\\VRbDbCDBx@j@d@Zz@h@PLRLRLTNd@Xd@XTLPLRLPJTNTNd@XZRHFRJTNx@f@d@Xz@h@f@Zf@Zx@f@f@Zz@h@f@XRLx@h@f@Xf@Zf@ZXPLHRLPLh@Zd@Xf@ZRJPLTNPJz@h@d@XRLf@Xf@ZRLRLRLPLRLTJPLf@Xz@h@d@ZRJRLf@ZPLz@f@f@Zf@Zz@f@d@Zh@Zf@ZRL^TDB`BbAnA|@PLh@Zd@XRLRLRJRLVNbAn@ZR`@Vj@\\|@h@JFf@ZJFVPd@XRLRJd@XRNZPHFf@XbCzAf@XRLd@Xd@Zf@XPL@?b@XRLTLb@XJFDB~A`ATNd@Xd@Zx@d@pBnADB^Tf@Zd@Xf@Zd@Xv@f@f@Xd@Xh@\\b@Xf@X\\TFBd@Zf@XPJPLRLd@Xf@XPLd@Xf@Zd@Xd@ZRJPLRJf@Zb@Xf@Xd@ZRLPJd@XRLd@Zd@Xf@XPLf@XPLRJd@Xf@Zd@XRLd@Xd@ZjAr@x@f@x@f@f@Zz@f@jDvBPJRNd@VRLPJd@ZRJRLx@f@p@`@XPRLDB^TTNd@Xz@h@`@VRJVNf@ZNJb@Vd@Zd@Xf@Xd@Xd@Zd@XnBlAfAp@`I|EJFv@f@XNh@\\t@d@jAr@x@h@|@h@PJbCzA~A`Af@ZjAr@`Al@JFx@f@tAz@HDx@f@RLh@ZjAt@f@XnBlA~AbApBjAv@f@d@Xx@f@RLd@Xv@f@RLPLv@f@NHf@\\v@h@d@\\b@Zd@\\b@Zb@\\d@\\NLRNb@\\PLPNb@\\PNPNPLPNPN`@^PNd@`@B@^^b@^dB~A|B|BhDlDt@v@X\\nAxAnAxA^`@rDnEX\\f@l@pCdDhBxBfEbF`BnBvEvFxBhCX\\|@bApJnLj@n@r@|@dDzDRThBxBnAxAv@~@p@x@t@z@pCfDfNnPX\\Z\\|KzMjBxBdGjHZ^tDnE~AjBfAtAPP\\^^d@^b@^b@n@x@^b@T\\HH\\`@`AfAl@r@RTDFhBvBnAzAnElFlGtHtSrVX\\X^xObR~@jAnCbD\\`@X\\FFfApAr@|@Z\\fBvBZ^DD^d@nCbD|DzE^b@RT\\`@^b@^d@^b@^b@^b@^d@\\b@HHDF^`@j@p@PT^`@@@\\b@hCzCvDpE@@|AjB\\b@FHHH^d@\\d@|@jA^d@NRZd@^f@\\d@LT\\f@LPNVDFV`@V^DFhAbBZf@JPNTFJ?@RXZh@Zh@PXJP^n@HLLVJPZh@Zj@Vf@Zl@Xh@\\n@@@FNJP?@r@vAXh@f@`Af@`AtBbErBbEbEfIzAxCZl@d@|@r@xAVf@f@`AfBlDr@tAJTBDTd@t@vAr@tAd@~@f@`AZl@JRp@rAf@`AZn@jA~BdBlDjCfFTf@Td@dAnBLVNXpB~DxAtCrBbE`@v@nBvDN\\Tb@\\p@v@|Aj@dAN\\Xh@|A|C`CvE|@jBTb@Tb@h@dAj@hA~@hBTb@tAnCTb@BFNZn@nAf@bA|@fBh@bAbCzEXj@f@bAVf@\\n@p@rAVd@DHHNZn@d@~@Vj@Zl@Xf@Td@BDN\\HLXj@Zl@?Bb@z@Zl@Tb@NXXj@Xj@f@`Af@`AVh@@B^r@FLTd@BDFLHNFJBDTd@Xj@r@tAPZTd@d@~@Xj@Zl@hBnDp@rAzAxCLT?@Vf@P^FJJV\\l@Vh@Xh@Xj@Vh@Zl@Zl@Xj@b@z@^r@Tb@Zn@Vh@Zj@JT@?Td@DH~@hBN\\FNLRJTLTLTLVVb@@DP\\FJVh@LXd@|@Zl@NXRb@Xj@f@dALRJRLTJRJTLTZl@Vh@b@z@NVJVLVd@~@LT@?Xj@Vj@JRLVLTd@~@LRFJDHJVLTLTHRLVZh@FNTb@FLLTJTd@~@v@|AJP^t@DHt@zAb@v@HRR^Td@Zl@Xl@HNR\\LTJVf@`Ab@|@`AjBFLP\\@DJPHPNXXh@Xj@Xh@Xl@d@~@h@dAXh@Xh@r@vAf@bAJRxArCPZVh@Zl@Rb@BFHLTb@FL`@x@BDLTXj@Rb@`@t@Xh@Xl@@@Rb@NXXj@Tb@BDP\\HNh@fAT`@JTT`@DFNZHPXj@Zl@JRHN|A~CJRj@fAHPJPLXf@~@\\r@HPXf@LVd@~@h@bATd@T`@?@R`@|AzCLV?@HNHPLTFLj@fABDN\\Tb@DFZn@BF~AzCFLJTb@z@dArBh@bAr@xAd@z@@DHPJPBDNXTd@Xh@P^^v@Xj@LVZl@b@x@Zn@Zj@b@|@Zj@Xl@t@vAj@hAP^LTLVJRLVLTJTXf@NXTf@LTJTNXHNLVLTXj@Xj@Xh@Xj@|@fBDFLZ@?r@xAz@bBb@z@P^BBb@|@Zl@JTf@|@f@~@r@rAHLPXf@z@`A`Bl@`A\\j@f@r@j@|@b@l@\\f@\\b@b@l@\\f@l@t@TXFHPT@BJJJLVZp@z@l@r@d@h@BBBBNPBB@BJHPT`@`@~@bAVVVXNLRRXVl@l@NNTRXXVTb@`@d@`@`@`@XVDBPPb@`@b@`@RPFFZVTRJJb@^HHTTDD\\Xb@`@RRTR\\X^^d@`@`@^PPTP^\\xAtAp@j@b@^`@^PPPNB@?@VTh@h@lAdAdA~@ZZZXl@h@XXh@d@PNFDd@d@DDz@v@f@d@j@d@PPVTJJb@^^ZNNPN?@TRRPFFVVtAnArAjAt@r@DDhB`B`@\\JHNNrAnA`@^JJDBVTBBHFLLb@^TTZV@@v@t@\\X`@^`@`@DB^\\`@^b@`@LHZZHHDB\\Zr@n@PNb@`@LLDDNNDDHFLJf@d@r@n@TT@?JJNL\\XDDDFNLNLPPNNv@r@p@n@`@\\dA`ANLJJJHPNZZBBFDTRFFNLPNt@p@rAlAPPZXBBDDn@j@@B\\Vv@r@\\Zb@`@p@l@x@t@~AxAnDbDl@h@ZXFDRRFFp@l@\\ZFDRRFDjBdB|ArAZZf@`@b@b@bA~@fA~@dB~A@@v@r@ZX~AvArAnA\\Zx@t@x@r@ZZlAfA\\ZFDZZ\\Xv@t@lAfAFFRP\\ZFFrBhBx@r@x@v@tAlALLj@f@lAhAFDZZZXTRFD`A|@n@l@rAlA?@^ZZXTRFDXX\\XnAjAv@r@^Zv@r@\\Zx@t@pBfB@@tApAZXx@t@pCdCNLh@d@t@r@ZV`@^ZXZZ`@\\r@n@d@b@TRl@j@xBnBRPdA`A@?r@n@xArA\\ZZZJHPNZZZXx@t@\\Xx@t@tAnApBhBrBjBrBhBx@t@fExDd@b@vApA@@ZV@@XX\\XFFRP\\XXX\\Z\\ZNLJJ\\XZZLJfAbA\\XZXZZFDjBbBrBjB@@XV\\XtAnAx@t@@BXV\\XhKlJ`A|@\\XZXx@t@ZXtAnAx@t@TRb@`@\\X^\\p@n@rAjA\\\\DBr@p@BBPLFFZZ\\X@@XV^\\JJh@d@\\ZPNHHx@t@^\\XV@?XX\\XZZ\\XpBhBRRHFv@r@h@d@dA`ARPbA~@b@^FFZXp@l@FFvAnAZZx@r@ZZrBhBnCdClD~CRPb@b@\\XtAnAnCdCh@f@hA`AtAnAvApAtApAZVZXZZz@t@nCbCZZdCzBxEhElBbB`HjGv@r@t@p@t@p@tAnAFDn@l@FF~@x@hB`B\\ZnCdCx@r@zBrB|W`Vj@h@nOfNnAlAd@d@ZZj@j@JJf@h@p@t@p@v@p@v@|BrClDvEpAhBV^n@`Ah@x@DHl@bA`@n@dAhBdB~Cj@dAdAvBr@xAj@nAR`@zApDp@`B^`AVr@z@zBx@bCj@fBf@~Ax@rCPr@HTv@xCXjAT`AZtAVjADRXrANr@`@|Bf@nCRlApAlIr@lE\\xB`A~FbAtGt@tEPjARfAr@tEt@vEHf@rAlIv@~E~@zFh@hDh@hD@Hf@~CLv@f@|CV`Bl@tDBN|@vFf@zCd@~CN~@b@lCXhBJh@@HRjADXBN@DFb@Hj@F\\BJ?DHd@?@Hf@Jh@?DH`@?BHh@TrAJj@?BHd@BPx@dFt@jENz@Jh@H^b@zBNx@d@vBVdAPv@ZrA\\xAv@vC`@|AXdAVx@n@xBh@bB?@p@tB`@lAtAbElDfKf@|Al@dBp@rB@@Nf@dAzCNd@@@p@rBHTFPl@fBf@zANd@@@pGpR@?Nd@f@zAhAfDL\\d@vAn@jBRn@L\\~@pCzAnE^fARl@~BbHXz@r@rBPh@`@lARl@dDvJjBrFPf@@DL^Nb@bAzCPd@DLHVt@vBLb@bAxCdA~Cp@nBd@rAvCxIRl@^fA@B?@h@|AXx@@BNf@FPz@dCPj@Pf@^fAPf@Pf@Ph@`@jADLHVdA|CBFL`@h@~A^bAh@~AzAnETt@nAtD@@bAxCDNhAfDVr@Rl@f@zAHPPf@`@nApAzD|CfJ^fAf@vAxC~IlAnDRh@Rl@Tn@Tr@JXVv@l@bBNf@bAtCPl@Xx@hBtFlBrFNf@Pf@Nb@vAdENf@Pd@dAzCNf@Pf@|@lC~B~GNd@@?r@tBNf@Pd@X|@FPtA`E@B^jAb@lARj@^fAf@zAJX`@lAb@nANd@N`@Pj@FNx@`Ch@~Ar@vB~@pCf@xAhAfDLZPh@j@dBDLBHn@jB@BZ~@Nd@f@vA@FNb@Nb@Rh@JZ|@hC@DFNNd@HRDLtAfEZ~@L^l@bBFPl@fBj@`BL^`@lABJj@fB@Bd@rANd@r@vBJV@D@BDL`@jAf@xAHTL^@DHVFLJXLb@nApD|DlLtCvIXv@j@`B?@@BNb@Lb@Rh@HVb@nABJ@@FRXv@?@Rl@`@fANb@L^BFL\\@FTr@b@nAZ~@N^Pj@L^DJLb@@?Nd@Rl@h@~ABDZ|@HPNb@@@Zx@JVl@xAXr@Xn@Zr@DJ@??BP`@@@Zp@d@~@NZTf@R^?@T`@?@b@x@h@`Af@|@f@|@x@tAh@z@z@rAXb@RZBDV^JNLP\\f@|AvBv@`Af@p@pA|AZ^~@fAbAfAdBfBpAtAt@v@\\^`@b@|@~@ZZHHPRVVv@x@\\^j@j@LNNLPTn@n@z@|@z@|@bAdAdBhBLLLNJJNNf@h@RTp@p@ZZVXBBXZZZ@@Z\\XXBBXXr@v@ZZDDTTZZFHl@n@TTVVHHj@n@BBr@r@v@x@h@j@JLrAtA^`@|@~@Z\\NLXZXZz@|@zA|ApAtAd@d@~@bAdAdAd@f@HHXZh@h@d@f@rBvBfAhAZ\\^`@zA|AXX?@r@t@dBfBJL`CdClAnA~@`A^`@XZf@f@b@b@pBtBjCpCrBvBhAjAj@j@JJPRRRzEdFbAbAb@d@x@z@j@l@f@f@dAhAx@|@lDpDt@x@ZZrAtAj@l@`@^|BbCNPx@z@v@x@bEhERRhBlBz@|@x@z@XXNNv@z@\\\\r@t@rH|HrI~I`OrOz@|@j@l@x@z@xAxAtAzA`B`Bt@v@fAjAfBhBv@z@tAvAz@|@XZfAjAbCdCvCzC~EhFfAfA`AdAjBnBv@x@zE`Fx@z@VVNPLJhBnBh@d@DF^`@vB~Bd@d@\\^pCtChBlB~AbBxC|CFF`D`DlL`Ml@n@rAtAvBzBjAlAh@j@JJ`@b@^^`@d@x@z@bAfAbAfAbAhAJLjAtADD`AhA`AjA~@hApA~AhAxAfAvAr@~@`ApANPHLPTtCvDjA|AzCbE`@f@LNJNLN|B|CjEzFJLf@p@~@lAbDjE@@vAjBpAbBtAhBhAzAJL`BxBv@`ALPDFPX|DjFJLLNZb@d@l@l@x@|ApBp@z@p@~@FHv@`AxAnBvCzDdB|B\\b@TZf@p@bDfE?@nA~An@z@jA|Ap@~@\\b@dBzBbArAX^Zb@RVDHf@n@FHZ`@RVr@z@nA`BFHNRLPJLf@n@l@z@NRLPNT^f@?@~AtBJLl@v@HHjA`Br@|@X^r@~@x@jA@@V^TZh@v@PV@@V^d@r@\\b@l@z@X`@\\f@p@|@NRFHp@|@?@`AlA`@h@DFHJ@?VZRXLLLLnBnCr@~@V\\LNHJNTJLJNDDHLLRJLJN@@V\\PTLP`@f@~@lAV\\HJh@n@\\b@`AjALNV\\d@h@b@j@FFh@p@hAtAJLV\\BDFFf@n@BDl@v@j@v@FFp@|@@@V\\d@n@|@jADDfAxA`BvB\\d@JNLNHL\\b@n@x@bAtAj@t@nGlI@@b@j@f@p@BDDFh@p@z@hAf@r@X\\HLZ`@bBxBNRHJTXZb@jA|AjA|Ar@~@X^X^X^jA|Ar@|@r@`ALNb@j@dB|BLRHJhChDJL\\d@FHDFHLj@r@z@hA|@lAx@hANRZb@hAzALPX`@h@r@TZHLLPJLVZ`@d@l@n@`@`@TRVRj@`@p@d@j@\\t@^l@Vr@XnA^hAThAPjAHlAD`BBl@?pB@xB?pB?`B?\\?`B@`D?zA@fA?tB?L?d@?v@?b@@fBBhC?V?vB?rBBdLDpD@tDEx@@dA?",
                      },
                    "start_location":
                      { "lat": 37.0381852, "lng": -94.51489959999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.5 mi", "value": 782 },
                    "duration": { "text": "1 min", "value": 30 },
                    "end_location": { "lat": 36.1631556, "lng": -95.7376342 },
                    "html_instructions": 'Take exit <b>34</b> for <b>I-44 W</b>/<wbr/><b>US-412 W</b> toward <b>OK-66</b>/<wbr/><b>Tulsa</b><div style="font-size:0.9em">Toll road</div>',
                    "maneuver": "ramp-right",
                    "polyline":
                      {
                        "points": "}_w{EnuhgQTLB@B?pAF\\Bj@DVBZFPBD@VDRD@?PFNFd@P^PFBJDHDHFXPZVVRB@PNRPVR^d@\\b@PPR^NXRZXl@@BRb@JRDPFPN`@J`@L`@DRJ`@F^FTHp@D`@Dd@@FL`C@FJT",
                      },
                    "start_location": { "lat": 36.1678313, "lng": -95.7322449 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "4.6 mi", "value": 7414 },
                    "duration": { "text": "4 mins", "value": 265 },
                    "end_location":
                      { "lat": 36.1626445, "lng": -95.81974849999999 },
                    "html_instructions": "Merge onto <b>I-44</b>/<wbr/><b>US-412 W</b>",
                    "maneuver": "merge",
                    "polyline":
                      {
                        "points": "wbv{EdwigQJ~ULzZBdFBvA@jC?f@?pCA`@Cv@CT?DE\\E^CNKf@EVGPEPK\\]dAa@rAELGXI\\CJCNCNAHIp@AVE`@Ad@Cj@?N?j@?HBd@@P@TDl@?@F\\ZjBBDJf@DNd@tBd@nB\\vANv@L|@Dh@Dn@DfC?L@p@?z@@r@?xA@bBBbC@fB?d@?D?rA@J?@?L?B?B?tB@lAB~DBtBBvG@vB@lABpCBjH@jB@pI?~B?xE?nC?l@?|E?|E?@?vH?`G?fA?D?B?dB?lI?lS?~A?X?fB?j@?V?rC?vACrU?`@?tCAdG@xA?pA?@?D?DAlA?xC@fK@`F?hB?`A?J?tA?n@?J?fD?^AnC?zA?\\?x@AzBA`CAl@?j@?j@?hB?X?f@?j@?p@?pD?@?nD?f@?B?pD?B?zE?~E?|BAp@?dC?j@?xA?dC?nE?N?`F?Z?F?H?|C@pGB|C",
                      },
                    "start_location": { "lat": 36.1631556, "lng": -95.7376342 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "13.4 mi", "value": 21608 },
                    "duration": { "text": "13 mins", "value": 781 },
                    "end_location":
                      { "lat": 36.0890137, "lng": -96.02788559999999 },
                    "html_instructions": "Keep <b>left</b> at the fork to continue on <b>I-44</b>",
                    "maneuver": "fork-left",
                    "polyline":
                      {
                        "points": "o_v{ElxygQAx@@tBJjEBx@FjA@LHxABj@JtA?@Dh@?@Dh@T~BHx@@HBPNlAHh@Hp@FX?BJf@?@Hf@FX?D@?VtA@@?@Jb@@Fb@fBNj@Pp@X~@L`@@B^hA@D@@FP\\fAFJN^d@jA~@vBpApCb@v@p@pAr@jAx@pAl@`A@@T`@HJ?@nAnBn@~@~@|A~@xAb@n@FJT^\\f@`AbBp@fA`CtD`F~H@@PXBDJLDFnAnBbDfF`A`BnGbKZd@f@v@bCzDFHVb@`BfC@BhBtCdAdBXb@?@l@~@Xb@BD`A|Al@bAtBdDHPdAzAp@hAp@dAHJ@Bd@t@b@p@`@n@nB|ChCfEfCxDh@x@b@r@d@r@pCnEDFvA|B?@nAjBzGpK\\h@@BXb@FJxBhD|@vAdFbIvA|BhDnFr@hAj@|@n@dAl@`Av@pAr@fA`@l@dA~AfAbBXb@BDBBPZ@@l@`Az@tAV`@dAbB`@r@LR`AzAR\\p@tA^d@l@t@h@z@FJ`@n@h@z@d@t@V`@@?d@v@`AzAvCrEv@pAXb@z@rAfBrCZf@Zf@FJj@|@fC~Dx@nAPZr@hAh@z@pApBb@p@|AbC~AfC`@n@vAzBXd@n@`AV`@n@`APVr@jA|@tAx@pAT`@HJtAxBl@`A?@JNHJ@Bb@r@JPb@r@FJJNJRX`@BDBD@B@@LRRXh@z@|AbClAnBRZPVfAdBx@pAnAlBDFbA|A@DTZVb@p@bAdEvG|AbC|AfChCbEdA`B?@@@?@T\\r@hA|DjGhCbE|AdChFnIHHR^T\\@Bl@~@rBdDV`@tAvB\\j@f@v@BDh@z@xAxBJNhA`BV`@vBdDfAjBbC|DdDlFb@n@B@jFfIt@lAPXBFLR~@rANT`AzAnApBPXbA|AJTvAzBV^fAbBNVbBlC?@FHlB|C|@xAnAnBJN\\h@`A|AV^@Bl@~@Xd@bA|APZ\\f@d@t@\\l@jAhBJNb@p@@@l@~@JPb@r@`@n@z@tAp@bAlAxB^r@jA`CfArCb@fA`@lAVz@ZbAp@|Br@nC\\|AF^b@bCT`BBRLbARjBFf@?HPrBNjCFpAVnGDnD@FL|F@b@@j@HxCPlI?P@f@?LBpBFxDF|D@bABvABrABfF?`@@X?zA?@@vF@hA?l@AnB?^?V?vA@nD?pD?h@?@?hG@p@?vA?pD?\\?z@?vA?xAA|EAfH?d@@bA?dB?fB?j@@R@dA@j@@J@^Bb@@F@^DbAB^HbA@RJtADl@Dn@b@pGTtDRtD@d@@h@?@@h@@j@?t@@jA?F?b@?dC?dI@jBAtF?bC?l@?|D?dD?H?zA?l@?~@?n@?p@?hA?PAF@rC?J?nB?l@?J?~@@`C?fCAv@A\\?TATA^An@WjEC`@Ch@Cx@EvAClA?n@?pA?tB?D?b@?x@?F?n@?|@AnG?dCAjA?z@?rB?d@?\\?F?^AxO?J?D?L@\\?N?D?V?hB?xB?`B?jA@rB?f@?d@@jB@`ADhADl@B\\BZPvBb@xDFd@X~Bb@tDP`BHv@Fl@?BDf@@NBj@@ZBf@@xA@zA?j@AvI?~A?p@?`B?l@?`@@\\C~K?j@?j@?bD?jF?@?BA|I?hG?zF?zCAfC?|@A~@@rD?rC?rA?R?p@?rD?bCApKApDAtN?@ApA",
                      },
                    "start_location":
                      { "lat": 36.1626445, "lng": -95.81974849999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.5 mi", "value": 820 },
                    "duration": { "text": "1 min", "value": 32 },
                    "end_location": { "lat": 36.089042, "lng": -96.0370057 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-44</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "isg{EhmbiQ?bC?pC?n@?D?@?f@AhG?|C?dA?zA?p@AvB@jBAhBCrE?z@?@?x@?H@d@Aj@@v@",
                      },
                    "start_location":
                      { "lat": 36.0890137, "lng": -96.02788559999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.3 mi", "value": 513 },
                    "duration": { "text": "1 min", "value": 21 },
                    "end_location": { "lat": 36.0870794, "lng": -96.0417449 },
                    "html_instructions": "Take the <b>OK-66 W</b>/<wbr/><b>Interstate 44 W</b> exit on the <b>left</b> toward <b>Sapulpa</b>/<wbr/><b>Okla. City</b>",
                    "maneuver": "ramp-left",
                    "polyline":
                      {
                        "points": "osg{EhfdiQAfD?nABx@F|@BRBVHh@@B@H@BF\\Lf@Tn@BBVl@FHR`@RXHJFHDFLLNPNLLL^Zr@l@JFp@h@FT",
                      },
                    "start_location": { "lat": 36.089042, "lng": -96.0370057 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.0 mi", "value": 1653 },
                    "duration": { "text": "1 min", "value": 63 },
                    "end_location": { "lat": 36.0757441, "lng": -96.0534505 },
                    "html_instructions": "Merge onto <b>I-44</b>/<wbr/><b>OK-66 W</b>",
                    "maneuver": "merge",
                    "polyline":
                      {
                        "points": "ggg{EzceiQhCnBNJ`BlAb@\\fBxAx@z@@@XVx@t@bA|@bCxBx@p@vAnAf@d@l@f@dCzBHHdCvBnAhA~@z@f@`@zBnBJJh@d@BBNNn@j@RPfAfAl@n@V\\`@h@PVvB`EvB|D\\l@t@vAt@vA",
                      },
                    "start_location": { "lat": 36.0870794, "lng": -96.0417449 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "86.2 mi", "value": 138740 },
                    "duration": { "text": "1 hour 13 mins", "value": 4378 },
                    "end_location": { "lat": 35.5999421, "lng": -97.4260288 },
                    "html_instructions": 'Keep <b>right</b> to continue on <b>I-44</b><div style="font-size:0.9em">Toll road</div>',
                    "maneuver": "keep-right",
                    "polyline":
                      {
                        "points": "k`e{E`mgiQnBrDh@`AbAjB`BxClAvBj@bAf@bABDz@dBBDh@dAlBxDxArC~ClG~@hB~@jBJR^r@|@fBj@fA`A`Bv@lAJN^j@NRpAhBt@~@@?X\\t@x@Z\\vAvAJJt@r@z@t@PLfBvAh@`@B@z@l@hBhARJl@\\p@^NHpAn@\\P@@~@b@`Af@VJHD`CjAz@`@dBz@jAj@vAr@nB~@pBbAh@TzE`CVL`Ad@fBz@`Ad@\\PbAd@TLnB~@ZP^Pt@^vAr@LFjAj@|@b@~@b@`Ad@^Rj@VvBdADBZNj@X~GfDv@^hD`BRJd@TjCpAzGbD^RlB~@`Ad@l@Z~@b@dClAbAd@?@n@XvAr@XN|@b@B@`Bv@lAj@r@^~@b@`Af@`Bv@tHrDjCrADB\\T~BnA^T~A~@\\R@?@@zBpA\\R@?~@h@|@f@@@`CtAXN@@dB`AvAx@~@l@h@ZPL@@RNHFhAz@RPVTBBNNp@r@LLh@n@HJDFTZpAfBNRhA|A`@h@j@x@v@dAp@~@b@j@LPNPRV@?VXPPRR`@\\\\Vp@d@^TVLj@XTJVHl@Tp@PTDVFt@N|@PdARb@HdDn@tB`@n@LVFjATh@LZHzA`@TFZLbAZ~@\\ZLd@PLDLFf@V\\Nf@Vb@RZPPJ^R^T~@h@DBXN|@h@XNdAn@nAt@\\V|@l@FDnAdAx@t@r@t@XZXZBDVXNRX\\TZTZ`AxAl@dAHNJPTb@\\p@HNHR@@P`@HNHTBFN\\FNHTPd@@BLb@HTFNJ^BFNf@Lf@HZDLLj@Jd@BHH\\Hd@FZ@BP~@@@TlA^pB|@vEDTP`A`@pBBJf@nCLr@Lj@BPF\\DP?@p@jDLl@rEhUl@fDLl@Nv@BPf@bCf@pC?@d@bCDLd@jCb@|BNr@P~@Lr@Jh@BH`@rB@HpAzGDTDRJh@Jh@Jh@TpAJh@VrAVrA`@|BZ`BFZX`BFZb@|B@Lv@dEDTThAp@pDz@nEz@pEl@~CbAlFJh@b@|BJh@VrAJh@n@dDz@pEVrAz@pEVrAd@bC`CdMVrAVrAn@fDZbBFXJh@n@fDJh@~AlIb@|BJh@n@fDJh@VpAJj@Z~Av@dE`C`M|@zE@HN~@n@`ED\\Z~BBLD\\X`CFh@PtAZ`CX`CX~B|@lHnAbKX`CHh@X`CFh@NjAR`BFh@Hj@Ff@Hh@Fj@BNDX@PDXFh@Hj@Fj@PtAPtAPtAPtAX`CX~BdAxIPtAZ~BX`CFj@j@tEj@vEPtAb@jDr@|Fh@dE`@jCf@xCDXv@`Ej@jC?@Jd@n@jCV~@?B\\lA\\nANh@j@lBb@nA`@rAn@hBDJhArCDN|ArDx@fBvAxCv@zA`AfB`C~D`@n@T^DFRXZf@j@z@Zd@j@z@Zf@HHLTX`@h@z@fA`Bp@dAlAjB`AxAV`@T\\p@bARXl@~@BD@@BB?@?@BBDHHLDDDF~OhVrEbHd@r@vIxM~BlD|BlDp@dAt@jAPVfAbBV^`BbCzCtEJPvBbD\\f@`AzAlBvCHLxBbDvKpP|A`C`G`J^l@pCdEbD`F~AbCp@`AnCdE`@l@dF|HfBnChCzDpHdL\\f@xA|Bh\\fg@`BbCZd@bAzARZrApBf@v@HL|A`C`@j@DJx@lA|@vAp@bA~@vA|@rAf@x@NRpAlBb@r@b@n@Xb@dBhCnBxCRZjAdBVb@pAnBNRf@v@bAxAz@pAfBlCpB|Cv@lALPzBjDxCrE\\\\Xd@f@z@d@x@t@dAxD|F~A`C~AbCt@jAt@jAhAbBHLpAnB|@rA?@~@tA^j@V`@DF\\h@n@~@b@p@V`@lAhBPVz@pAb@p@h@v@jAfB~@vAvAxBhAdB`AxA^h@d@t@f@t@^l@V^|@rAt@jAh@v@v@jANVn@`AbAzA~@vAnAlBDDvBdDDHvAvBXb@Zd@zA|BlBvC|A`C~AbCfBjCt@jAJNzA~BdA|A`AzAn@`A~@tAFJfAbBrArBJNjAdBj@~@V^|A~Bl@~@n@l@?@`AzAzD`GV^fAbBV^V`@n@`AhGnJv@dAnFhIp@dAn@bAV^dA~AzBfDj@|@|EpH|A~BBDRXfDfFnDpFd@r@vKpPBB|@rAjN`Tn@`ATZp@dA~@vAFJTZrChE~DfGtEbHZd@HLd@r@j@|@Zb@tB`D@BTZ@BfAbBTZhAdBl@|@r@dAbA~A~A~BhAdBXd@dA|AXd@|A~B@BxBdDrB~CBBRZhDfF@BPVlAjBdA|AXd@nFdIT^BBbA~AZb@bA~ABB|A~BXb@dFxHT^rGvJ@BJLjIfM~@tAV`@V^V`@nIlMV^Zb@HNx@nAV`@r@bAHNn@~@JNV^fAbB@BJLHL~AbCV`@Zb@HNzRfZLPBDHJ|A~BV`@JPLPzL~QJLV`@@BHLrApB@BJLpApBLPT\\JP@BdAzAdBbCzBxC|AlBxAbBt@z@hApA|A~AnAlAv@x@fAbAlAfAB@@@|ArARPXVB@ZV`@ZZTz@l@\\VbCdBpBxAt@l@DBFDRN@@ZV\\TRP`BjA@B@?XR@@@@HFTNVR~@r@^VVTb@ZVRB@`@\\ZRXRBBZVx@l@@@@?v@l@BBtAdAHFRN@@@@~ArAx@r@nAhAXVZZ@@VVNNj@h@VV\\^@?XZ?@VVNLLPZ^t@x@VV@BTTDD`AhAvAhBp@x@r@bAX^@@?@rAhBJPX^@@@@R\\@@d@t@FFl@bA@@@@n@bAPZBDT^R^@@R^BB?@tAdCBB~@fB?@R\\@B?@n@pAb@|@dBxDPb@P`@@@N`@Pb@BDPd@b@dA@BFLFNBHvBfG`@hA`@pATv@ZdAL`@HZTx@`BjGp@hCvApFLh@Nf@Lf@|@lDx@|CLf@tAnFlD~Mf@lB~@pDXdAHXLn@~@nDb@bBlBnHnAzEZpAZpABHDP`@~ADNNh@@@Nh@j@xBBHH\\\\pALf@FT`ArD\\pAfAjEvApFLf@Nf@Nl@DPFR@BDNPv@HXFRDR\\pAFRTz@Lh@DP@@DRDP@?BP@BBHHZ?BBHHX?BFTDRLj@XnADRDTLf@n@bD?BBH@HDTBF@JTjAd@dCP|@BH@HH^P`AFZr@tD@D@HBJF\\Nv@Pz@DTDRHb@@D@HBJF\\H`@VpAJd@@JBJDR@HBJH`@R~@Jh@F^BH?DBHF^DR^jBRhAZbB@Bh@nC?BJh@BNDRDTFX?DVjADRBL@FFVZdBHb@@D?@F\\Nr@l@bDn@dD@FDN@HVtANp@?BDP@BHh@DPVpADTDR?BDRh@nCJh@Jh@?@DPt@zD?BBLdB~In@bDd@fCVrA@@@DTnATnA@@?BHb@@@PbAf@hC@@?@Hd@~AlI@B@JFXJh@p@hDHf@@??@H`@?Db@|BLj@ThA@FHf@H`@f@fCHb@@DJh@Hb@X`BFV@FFZBL@HTfA@JH\\FZBL@HJh@l@|CH`@BPZ`B^jBn@hDRdAd@`C@HH^@HH^b@|BLp@H^@HH^Lr@H^Lr@XvAHd@z@nEHd@p@jDr@rD^pBpAzGrAbHTnA~@zEJh@TjAb@zB@HBLFZ`@rBXzA~@zEDTJh@@H~AjIH`@BHj@|CBFn@fDtBvK@Hl@|C@HZ~ADRXzAZ~ADRh@vCBN@Hn@lDp@pDd@lCl@hDf@rCBRLr@ZdBBL`@|BBHF^BRf@pCFZd@jCF`@Lr@@@Hh@FXBLHh@Jj@VpAJj@Lv@r@`EJf@l@fDdBvJl@lD?@Hf@DPf@tCLp@H`@Jj@Hf@`@|BTtAJj@H^VzAJh@VtATpAJj@`@|BHf@`@~BbAzFPbABN@@TpAHh@H\\Lv@Jf@Hh@F^BJTpAJj@Jf@DVZdB~@rF~@dFd@pCZ~A?@Hf@H^b@fC?B@BH`@TpATtA@BLt@^tBHb@Jh@?@Hf@\\pBBJJh@?@Nv@VxAN|@@BRjAf@pCd@pCLp@Jh@?@j@dD@@F\\@H`@|B@BHd@r@~Dp@zD@@BPDV`@|BTlAJl@Jj@j@dDPbADR^rBtAdIDRJh@DTDRN`AP|@DRHh@Jl@Jf@BRP~@BRDTDR\\hBF\\z@~EDPf@rCN~@f@pC?@Nx@?BN`ALn@Lv@\\dBJn@VtANx@Lx@VnAb@bCN`AN|@TlAJn@XbBRbAPfAf@nC^nB^xBzArIhC`ObA|Fv@pEJh@j@`DJn@x@pEJh@hBhKDZJh@TrAb@|Bj@fDJh@|CjQz@zEF`@nAdHlA~GBPVrAVvANt@DP@JRx@b@rBNv@BFDP@BDPDRFTFVLh@V`AH\\DR^tADNf@`Bt@fCj@jB`@jALb@HRJXd@pAZ|@DJJ\\@@FPP`@\\dAZx@BH^dABF?@FPb@lAFP^`ABHHRHTHTVt@`@jABFL\\HRHT?Bd@lAL\\FRL\\Xv@DL\\`ALZNd@FLVr@^dADHVr@`@nAr@jBb@nAb@lAb@lAb@nAd@nAb@rA\\z@HRHTVt@n@jBVn@FPDJ@D`@hAHVFPPd@Pd@@BFPFP@BFNXv@Nb@Z|@?@FNHRFPRj@FNL^Tn@Xt@Vt@Vr@b@jAPf@FRBHLXPf@LZFTBDHXLZTl@Tn@BFDJPh@Vr@Xv@b@jA`@lAd@lA?BPb@Pd@?@FPHTFPHTd@pALZPf@BH`@hAFPFNNb@DJh@xADN`@hA@BJXN`@Tl@Rj@Z|@d@rAn@dBHTJXZv@L`@@@HTJZTn@DNh@xAn@hBp@hBRj@Z|@Ph@\\`AJV@Bn@hBp@fBFNDNJXdAvCPd@Rh@Pd@FRjBlFDJx@|BpCxH`BvEtA|D@Bz@bCJTPf@L`@b@nA@@N`@@BNb@`@jA@BNb@LXVt@Pd@bArCPh@Rh@HVz@`CJVBJPd@Rh@FPXv@@BRj@L^^fARh@Rh@HVf@vARh@@Bp@jB`@lA@??@?@Vr@pCzHz@bCBF\\`A@BXx@Xx@Vp@\\`AFNFRRh@Pf@Nb@Xr@FTd@nAfBdF\\`A^`AtAbE~@bCFR`GpPtAvDrAtDRj@rEnMd@pAzBnGTn@t@tBJXJTvAbEjBhFl@bB\\`AbAtC`@fA`@hAbArClAhDj@`BjBlF|@fChAlDnAjE~@pDf@pBd@pBPt@l@vC\\bBV|A\\nBn@rDTnA@HDZtAtHHh@\\lB`@`CX~AbAzFj@bDb@|BzBrMJh@nAdHv@pEN~@bBrJn@jDfAlGtA~Hn@vD`ApFJj@Jh@nAlHJj@`@`CJh@zAxIJh@dA`GJj@Jj@`@~BJj@Jh@hCdOJj@zAvIb@`CHh@n@jDPbAN~@P`A\\jB@FLr@FZF\\PbA`@|BZnBR`ALn@TrANr@RnAb@dCb@dCb@dCr@dEn@vDt@fEx@rEv@pETrAbAzFnAdH@HF^l@hDJh@?Dv@jETfBT`CBj@D~@BhBA|F?f@ClI?~BAdE?fB@z@Bx@@TFp@Dd@B`@Jz@PlAXxARz@V~@\\dA\\fA\\bAv@`C\\bAnCnIhA|DLj@VnAPjAHh@Hz@Db@RpC\\pEh@hHJxALxAFz@JtAL|AB`@PbC@LPrBDd@XrDRpCBZXnD?FDb@tA`RXlDVnD^xEDj@hAjODh@|BlZt@zJ?@Dh@d@dGDj@Dh@XnDDj@Dh@\\zEDh@^xE?@d@bG?@@L~@~Lf@tGF~@H|@~BzZt@xJ@NVlDBZ|@lLDl@@RFj@@N@JPdCr@hJBZ~@bM\\hE`BhTDh@vBnYNpBFh@b@dGRbC|@rLnAvPh@`Hn@nIDn@R~BZdEF|@Dj@@NV~CFt@B^LtARnCLvA?DDb@NvADh@LvAFj@VtCd@pEl@hGbAxJN`BrA|MXvCFj@b@vE@FDb@f@vEh@rFT`CNtAjBbR`@lEf@bFFh@XtCnBtRr@hHb@rEnCvX\\jDT`C^lDrAzMz@zId@vENtAjCbXnBxRr@hHVfCpAzMxAbO|AjODj@BPBVh@jFnAnMhAlLFl@rBhSx@hId@xE^jDFp@ZfDb@fEjAnL~@nJxCrZFh@NtA\\lDpAzMVzBB\\d@lEP~AFj@Fb@`AhI`AfIf@pEbAnIFj@PtAFj@NtAPtA`@jDFh@j@vEvCdWHj@h@vEdBdOj@tEFj@fBrOXzBVzBFf@@HNrARdBF^Fr@v@tGR|AD\\NpAJ~@Fj@Hn@D\\BXBJ\\zC^~Cd@zDf@dENtAFj@Hh@BRPzAPtANtAX`CX`CV`CR|AVvBV`CHh@`@jDdAbJ?@Fh@z@lHFh@PtAx@lHD\\b@xD`@jDHh@jAbKFj@z@jHFb@lAhKlBnPd@xD`@jDfCjTHz@vAzLJz@r@`GJ`A\\rCFj@h@tEd@zDDZFh@p@`Fl@nE`BvLpAlJHh@D^@Jx@|F?@\\~BNjAJr@R|APjA@LF\\Hh@NhAr@jFv@rFl@tEf@jDPrALx@x@hGVhBThBd@fDRxAT|APnAh@nDPrAPnAbApHlAxIl@nEFb@h@pDd@lDTdBHl@`@pCl@lEXtBDZn@lEBTT~AXrBRtA?B`@pC^rCLz@|@xG\\~BtA~Jl@jE@Hd@hDJv@PfAF`@R|At@lFPvAt@hFBPHj@d@hDHh@VhBVjBFh@?@RrAZ~BHh@?@ZvBx@dG?@@@v@zF?@NdAh@vD?@BP`AbH`AhHXrB?@L|@h@vD^hCD^?@XnB`@rC^jCFb@RxAVhBVlBJn@`AbHp@`Fv@tFJt@d@hD@HF^d@jDF`@l@lEBNHh@XtBl@nELx@f@nD^pCRtA^rCLz@RvAL~@RrAXpBL`Al@lEDRBTbAjH@LDZHh@RtAd@hDHj@@DFb@PnARxAHj@Hh@l@nEPpAZxBBPDZHj@Lv@@LBNBPBLTrAJh@BPNz@DT@H@HFXLj@P|@P|@j@pCxAzGVlAVlAJd@Lh@d@zB`CzKt@pDXpAvG|ZLh@VpALh@rBrJlCdMLh@Jf@zCnNzEfUH\\FXFXHXH^BLDT@BNr@@DLl@j@nCf@xBb@xBZtAr@dDF\\@@DVPx@VlAXnA~@lELh@pDzPt@dDrBtJH\\l@rCPt@Pz@`C|KdCjLf@`CLh@Jh@Np@z@|DFVj@lCBLn@tCXvAJb@Ll@XrAhCvL~BrKp@fDrHt]bAxELf@~@lE?@d@zBf@xB`C|KzAfHJf@@@xA~Gd@zBLh@~@lEJh@Lh@r@bDJh@Lh@Jf@Lh@Jh@Lh@XpAd@zBr@dDj@jCh@dCr@dDr@dDR|@^dBd@zBDPR~@BHThADNR`AXrABH@DR`ALh@h@bChAnFb@rB`AtE^`BFXPx@l@rCDNFXBNJd@TfAd@tBLj@DNVjAThAR|@XlAP~@@@P~@bAvEDLv@vDBNnAxFb@pBDRPz@Pz@ZrABNBJFVH^H\\FZFZJ`@DVNp@J`@Px@h@fC@FFTH^FX|AlHHZBLDRt@lDDPx@xDDPXpAJh@Jd@VfAPx@ZvAH^H^BLJd@Pv@Nr@BLdBfIDPDLJh@Pt@FXNn@TjADLp@~Cb@vB`@jBjBxILh@lAtFJh@f@zBJh@HZ\\`BJd@r@dDJh@r@bDXlA\\dBPp@R`ALn@HZHb@Jb@Nr@H^DLBNNt@J^FZXtAP|@Nr@VpAF\\XxATtAFXDRPhAx@bFF^Jv@Hd@BTv@xFv@vG`AxJ@N?@l@nHXlDR~B?@@DB^Fr@JxAHx@BT?@?@Df@@H^nEDj@XlDDj@VxCTtCDh@?@@?Dh@JvADf@@BP`CFj@P`CH~@H`A?@h@lGr@zIDj@f@dGDh@hBvTDj@n@tH^vEFj@d@bGhA`Nd@bGJjAFv@HdAD^HfADj@BXFl@PrBZxD@RJfAZzDFv@@FB`@ThCDb@@NB`@LzA?@\\xDn@fIh@lGXnD@NFj@@T@H@J@PD`@NdB\\nEHt@?D?D@FNlB@LFn@BRJxAPpBDd@@FLbB@JV|CLzATpCHfAJhA@JJnAFr@BT?BTrCBZXlDt@|I^vEXlDNhBDh@@LBZBN?F@DV~CFv@LzAHx@?LBNB^LxAHx@@V@BBb@L|ADf@JhAD^@R@HFz@BX?BDZ?DD`@@LDd@PvB@J?B@JBZH~@B^BPF|@@@Bh@VnCB\\PzBFl@@N\\nEBLRlCJlAHv@VzC@RFt@Fn@BZ\\dEXhDx@~JdA|MD\\B\\?BFl@Dj@BPDj@Fj@Dh@Dj@JdADh@JvALtARbCl@nHFj@TnCB\\XlDDh@@LPtBZlDj@|FFl@?B?@p@xFrBlPj@tEd@vDtCvUv@fGVlBFh@Ff@BTVlBTfBBXF`@PzADXFd@b@hDD`@DV?B@HL`AJx@\\pCPtAJx@Jz@Jx@l@vEz@fHFb@XtBTjB`@fDL~@f@`EBRtCnUp@tFHp@XvBTnBF\\D^Fl@XzBXtBTjBD`@Jv@Jz@ZlCnCjTdAnIl@|E`@jDHh@b@jDj@tE`@bD@FHp@b@dDLjA@FL~@jC`TNnAFf@Fd@LbAL`AHn@t@`G?@\\hCNhARbBl@bFr@tFb@lDrBhPt@~FJv@f@~DHr@b@jD\\jCD\\~@tHNjANtAL`ABP?@Hj@X|B?@NnABTv@xGFj@h@tEHj@^jDX~BFj@X~Bx@jH?@X~Bh@tE?@f@lEpEz`@@?n@~F@?x@jH|AhNh@tE?@f@tE?@Hh@?DtBtQh@tE?@X~Bp@`G@?Fj@RbBBZF\\r@nGHj@^jDHj@l@rFBLFh@?@Hh@?BFf@RjBBRRhBBRHn@NtA@H^`DHh@Hx@`@fDP|Ad@dE@DDd@Hh@b@zDDZFj@Fh@`@jDFj@PxA`ArIHj@h@vEFh@h@vEFj@bAvINtAz@lHL`AB`@Fb@Jv@XbCBRD^BTNrAR~ATtBJv@Jz@LlA@HF^Ht@NxALfA@FF`@Jz@`@nDNvAPrAZnCXjCFf@Ht@^`DBLNrANvAVpBVzBTrBTrB^~CNhALrABLX`CDZ@L`@jDBPHx@P|AHl@Fj@NpAh@xEBTHp@D^D\\Fj@Fh@H~@PvABNFj@Hx@Jx@Hv@L~@Ht@NjA\\vCBRh@xE|@zHTvBPvAVtBBXHt@Jx@PxAJ|@@JFh@D^PxAP|ABVBPP|AtCxV\\xCDd@J|@^jDnC|UHh@Fj@p@`G|AvM`AxI^jDHj@?@Ff@NfBHz@Dl@?FBZDf@LdCD|@?@J~BThDZnDHl@BRBVB\\dAdJn@zFf@nDv@pHDZL|@RnAHj@@B\\hBNv@?@VnABLJj@H^Jj@TjAHf@Hh@DTDTRtA@NLfABPRfBFn@d@|DFh@DZFj@RdBXdCt@lGd@rEFt@BX?^@vBErBIxAKn@Kp@Oz@",
                      },
                    "start_location": { "lat": 36.0757441, "lng": -96.0534505 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.5 mi", "value": 733 },
                    "duration": { "text": "1 min", "value": 35 },
                    "end_location":
                      { "lat": 35.59713989999999, "lng": -97.431654 },
                    "html_instructions": 'Take the <b>I-35 S</b>/<wbr/><b>I-44 W</b> exit on the <b>left</b> toward <b>Okla. City</b>/<wbr/><b>Downtown</b>/<wbr/><b>Kilpatrick Turnpike</b><div style="font-size:0.9em">Toll road</div>',
                    "maneuver": "ramp-left",
                    "polyline":
                      {
                        "points": "sbhxEtosqQBR?@?@Kd@Qx@Qx@AH[tAAJEPCNCPAHANARARA\\?@?V?D@\\@RHr@BZBL@@H^BLBFNj@DLVr@T`@Xb@LRFFJLNNXPVR@?RJ\\NjBh@^JnBh@z@V`@LXR",
                      },
                    "start_location": { "lat": 35.5999421, "lng": -97.4260288 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "4.2 mi", "value": 6679 },
                    "duration": { "text": "4 mins", "value": 224 },
                    "end_location":
                      { "lat": 35.5419621, "lng": -97.45950979999999 },
                    "html_instructions": "Merge onto <b>I-35 S</b>/<wbr/><b>I-44</b>",
                    "maneuver": "merge",
                    "polyline":
                      {
                        "points": "cqgxExrtqQt@R@?RHVJb@PLHj@Xx@^`@TVPVLj@XrBhAfCtAzBpATLTLPHLF~@h@\\R`@T~@f@FBp@`@`@RtAv@bAj@@@bAh@zDvBPJVLfB`AlEbCLF@@dGdDd@XNFBBJF|BnANHBB@?HFpBhAJFNFDDHDtAt@fFrC\\RbE|BhB~@VNrBhATLzAz@JDfBbAvBjAf@X~@f@`@TDBNHj@ZXPjAl@f@\\nDlBVNd@V^R~GvD`@RdDjBvC~ATLv@d@vAt@p@^BBJFfAj@j@ZDBPJ`@T@?b@V^RNHhAn@LFvBjAdCvApAr@x@d@TLRLPJB@bAh@|DrBv@b@LFBBPJLF^T\\Pj@Z`@TRJHF@?FBTLB@x@^ZLHB?@^LTHXHl@NFB@?@@TFB?f@Lb@HVDn@NdF|@bARdBZ\\H|@N^HH@RDJB@?n@L^F^HF@^FB@n@L^FF@\\HD?nB^rDr@D@B?bB\\lCf@\\FVDVDbBXl@J~FdApAVb@HTFt@N~@Px@Nj@JB@H@TFZFlPxCj@Pt@Nh@HrAZhB\\tFbANBPDNBF@fDp@XHb@Jv@Vp@Tb@P@@z@`@TLDBRLnBnA",
                      },
                    "start_location":
                      { "lat": 35.59713989999999, "lng": -97.431654 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "6.6 mi", "value": 10645 },
                    "duration": { "text": "6 mins", "value": 383 },
                    "end_location":
                      { "lat": 35.4629807, "lng": -97.49024430000001 },
                    "html_instructions": "Keep <b>left</b> at the fork to continue on <b>I-35 S</b>, follow signs for <b>Okla. City</b>/<wbr/><b>Dallas</b>",
                    "maneuver": "fork-left",
                    "polyline":
                      {
                        "points": "gx|wE|`zqQJ?@?@@FBpClBn@^`@Tl@XVN^NNFr@VFBVHTFn@Pl@L\\D`@FJ@|@FB?\\@XDp@Bp@?@?l@Ah@CVANANAl@GRClAUz@On@Ol@MRGdCm@vA]nCq@ZIh@M`@IJEb@Kj@M~@Qb@GF?PCF?^CB?l@CPAbA?N?fI@hB?r@?f@?fBA~A?R?jB@nC?bCAL?D?rB@|K?p@?@?@?r@@pD?vA@r@?nC?lL@xF?t@?P?H?H?F?L@zA?f@?H?r@A|B?D?F?z@?@?H?xA?nDBL?xCFL@P?nCTL?VBXDp@FTDfAN`@FLBTDNBPDfFfAd@L@?~@Tj@NjCn@bEbAPDr@PnM`DfAXd@Jd@N@?LBjInBl@ND@?@d@JxCv@NBxBh@j@NdBb@xA\\~FvAHBv@Pv@P|Cj@x@JbAJ`@B`@DB?h@Db@@D?z@@T?tA?l@Ah@@~A?hA?nB@hDAnC?|G@j@?pBA`CAT?f@ARAl@AvEQpBI~@EXAdAAvFGX@lADB?R@N@B?jAFp@FtAJdAJvBT`AJ`AHzHv@b@DLBd@DjBRjAJ`AHlAJrD^j@F\\Dv@H\\BdAJv@HfBP`@Dd@DD@XBN@jBRh@Ft@Hz@NPDr@Nv@PjAZfA\\XJVHjAf@~@b@f@Vf@Vn@`@r@d@\\TjAz@ZVRRDBx@v@NN`AfALJdAtAPZl@bARb@\\r@FP`@jA@BDJd@jB?@FPDTLx@D^Ff@Jt@HhADd@LzD@l@FhBHzBD|@@XBj@Bh@NnD@F@b@?FNfD?FBb@Bj@?HLbE?lCCrECnICxEEpJKvJAn@C|B?|@",
                      },
                    "start_location":
                      { "lat": 35.5419621, "lng": -97.45950979999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.4 mi", "value": 572 },
                    "duration": { "text": "1 min", "value": 20 },
                    "end_location":
                      { "lat": 35.4629005, "lng": -97.49655519999999 },
                    "html_instructions": "Continue onto <b>I-40 W</b> (signs for <b>Amarillo</b>)",
                    "polyline":
                      {
                        "points": "sjmwE~``rQ?B?~@ApA?h@@j@CjDAxDAr@?F?z@Av@?zAB~A@j@B|@JjC@^@Z",
                      },
                    "start_location":
                      { "lat": 35.4629807, "lng": -97.49024430000001 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.1 mi", "value": 1786 },
                    "duration": { "text": "2 mins", "value": 144 },
                    "end_location": { "lat": 35.4623125, "lng": -97.5161835 },
                    "html_instructions": "Take exit <b>151A</b> to merge onto <b>Oklahoma City Blvd</b>",
                    "maneuver": "ramp-right",
                    "polyline":
                      {
                        "points": "cjmwEnharQKN?@?H@\\@h@?F@XFrADt@L`BBVRfCDj@L`BDb@@n@F|ABzA@nAAnA@|A?fAAz@Ej@Cj@?F@FBDB~C?P@R?T?P?B?H?V?H?`@?F?P?X?bA?R?j@?dC?j@?j@?j@?j@?j@?b@?F@j@?j@?BBf@@\\@HBn@Dj@Bj@?X?P@j@?f@?n@CdB?J?f@?R?V?N?F?hA?F?Z?d@?n@?V?\\?vA@j@?N?NBvA?@?j@?D@bB@dA?`@AvA?^",
                      },
                    "start_location":
                      { "lat": 35.4629005, "lng": -97.49655519999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.1 mi", "value": 215 },
                    "duration": { "text": "1 min", "value": 42 },
                    "end_location": { "lat": 35.4642458, "lng": -97.5162095 },
                    "html_instructions": "Turn <b>right</b> onto <b>Thunder Dr</b>",
                    "maneuver": "turn-right",
                    "polyline": { "points": "mfmwEbcerQg@?[@U?e@?OCKAUAqEJ" },
                    "start_location": { "lat": 35.4623125, "lng": -97.5161835 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.2 mi", "value": 242 },
                    "duration": { "text": "1 min", "value": 53 },
                    "end_location":
                      { "lat": 35.4664193, "lng": -97.51632769999999 },
                    "html_instructions": "Continue straight onto <b>Ron Norick Blvd</b>",
                    "maneuver": "straight",
                    "polyline": { "points": "qrmwEhcerQiJNo@@WD" },
                    "start_location": { "lat": 35.4642458, "lng": -97.5162095 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "223 ft", "value": 68 },
                    "duration": { "text": "1 min", "value": 14 },
                    "end_location": { "lat": 35.4670278, "lng": -97.5163219 },
                    "html_instructions": "Continue onto <b>N Robinson Ave</b>",
                    "polyline": { "points": "c`nwE`derQyBA" },
                    "start_location":
                      { "lat": 35.4664193, "lng": -97.51632769999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "197 ft", "value": 60 },
                    "duration": { "text": "1 min", "value": 7 },
                    "end_location": { "lat": 35.4675612, "lng": -97.5164077 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>N Robinson Ave</b>",
                    "maneuver": "keep-left",
                    "polyline": { "points": "}cnwE~cerQKDQ@M@K@M@O@Q@A?" },
                    "start_location": { "lat": 35.4670278, "lng": -97.5163219 },
                    "travel_mode": "DRIVING",
                  },
                ],
              "traffic_speed_entry": [],
              "via_waypoint": [],
            },
            {
              "distance": { "text": "1,328 mi", "value": 2137682 },
              "duration": { "text": "19 hours 28 mins", "value": 70097 },
              "end_address": "Los Angeles, CA, USA",
              "end_location": { "lat": 34.0523525, "lng": -118.2435717 },
              "start_address": "Oklahoma City, OK, USA",
              "start_location": { "lat": 35.4675612, "lng": -97.5164077 },
              "steps":
                [
                  {
                    "distance": { "text": "69 ft", "value": 21 },
                    "duration": { "text": "1 min", "value": 4 },
                    "end_location":
                      { "lat": 35.4677346, "lng": -97.51648039999999 },
                    "html_instructions": "Head <b>northwest</b> on <b>N Robinson Ave</b> toward <b>W Main St</b>",
                    "polyline": { "points": "ggnwEpderQA?MJQ@" },
                    "start_location": { "lat": 35.4675612, "lng": -97.5164077 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.2 mi", "value": 327 },
                    "duration": { "text": "2 mins", "value": 91 },
                    "end_location": { "lat": 35.4675748, "lng": -97.5128869 },
                    "html_instructions": "Turn <b>right</b> onto <b>W Main St</b>",
                    "maneuver": "turn-right",
                    "polyline":
                      {
                        "points": "ihnwE~derQ?I@QD}BD_@@_C?gABU@M?G@K?C@q@@[AaBD_B",
                      },
                    "start_location":
                      { "lat": 35.4677346, "lng": -97.51648039999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "410 ft", "value": 125 },
                    "duration": { "text": "1 min", "value": 27 },
                    "end_location": { "lat": 35.4664669, "lng": -97.5130464 },
                    "html_instructions": "Turn <b>right</b> onto <b>N E K Gaylord Blvd</b>",
                    "maneuver": "turn-right",
                    "polyline": { "points": "ignwEpndrQ`@Ab@@J?RBtBZ" },
                    "start_location": { "lat": 35.4675748, "lng": -97.5128869 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.3 mi", "value": 485 },
                    "duration": { "text": "1 min", "value": 88 },
                    "end_location":
                      { "lat": 35.4621308, "lng": -97.51304859999999 },
                    "html_instructions": "Continue straight onto <b>S E K Gaylord Blvd</b>",
                    "maneuver": "straight",
                    "polyline":
                      {
                        "points": "m`nwEpodrQdBVVBX@nA?x@?V?~BFp@@J?@?HAZALAHAd@Gn@Kd@GFALAJAXAj@?@?R@@?B?B?T?P@",
                      },
                    "start_location": { "lat": 35.4664669, "lng": -97.5130464 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.3 mi", "value": 474 },
                    "duration": { "text": "1 min", "value": 40 },
                    "end_location": { "lat": 35.4578767, "lng": -97.5133626 },
                    "html_instructions": "Continue onto <b>S Shields Blvd</b>",
                    "polyline":
                      {
                        "points": "iemwEpodrQ\\?fABjBBtEFV@n@B@?hAD|AHl@DbBLX@B@F?",
                      },
                    "start_location":
                      { "lat": 35.4621308, "lng": -97.51304859999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "2.1 mi", "value": 3405 },
                    "duration": { "text": "2 mins", "value": 136 },
                    "end_location":
                      { "lat": 35.4619173, "lng": -97.54894039999999 },
                    "html_instructions": "Take the ramp onto <b>I-40 W</b>",
                    "maneuver": "ramp-right",
                    "polyline":
                      {
                        "points": "wjlwEnqdrQHH@@B@@@@@B@F@J@N@V@R@H@V@F@P@HBD@FBFDDBBB@@DFBDBDBF@B?@@FBLBLDZ?h@?@Aj@?j@Aj@?j@?j@A^?\\?XB~DL`EBrA@hA?@Pd@ArCA|B?z@A`@A~AAb@Ax@GjAGvAATC^I`AGl@Gv@OhA?D_@jCKbAeBdLqBzMYjBGZIh@cDjTEX?D}@rFyChSCLAHABALG\\AJOz@QjAG\\?@CLCLoBpMQdAQhAAFObAY`CAFAJOzAU~CGjAEzAAtB?|@?zAAbH",
                      },
                    "start_location": { "lat": 35.4578767, "lng": -97.5133626 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.2 mi", "value": 1939 },
                    "duration": { "text": "1 min", "value": 67 },
                    "end_location":
                      { "lat": 35.4607928, "lng": -97.57027819999999 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-40 W</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "_dmwEzokrQ?bC?pB?`@?j@@`H?j@@nC@\\?L?F@b@B`C@d@L|EB|@?N@TBt@PdEHvAFvAd@fIFl@PzC@DNxE`@`R@`ADjD?@@n@@B?h@?DFpDFrFB~BBlE",
                      },
                    "start_location":
                      { "lat": 35.4619173, "lng": -97.54894039999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.5 mi", "value": 2463 },
                    "duration": { "text": "2 mins", "value": 90 },
                    "end_location":
                      { "lat": 35.4602233, "lng": -97.59745480000001 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-40 W</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "}|lwEfuorQBjF?zAB|A?JB~A@p@B|AHnEBxA@n@?@@d@?PBfA?@?DB`BB`B@b@?J@n@@T?@?V@V?V@n@?D@b@?HDzB@|@F~DLbHFnDD~A?@?B?N@P?JBvA@lB?LBjC@t@?t@?B?j@?f@?B?\\?H?B?vAAhE?tJ?tB?~@?nF?lB?vB?J?dG?zCAbA?RAlB?T@fF",
                      },
                    "start_location":
                      { "lat": 35.4607928, "lng": -97.57027819999999 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "9.4 mi", "value": 15107 },
                    "duration": { "text": "9 mins", "value": 520 },
                    "end_location": { "lat": 35.4846502, "lng": -97.7559067 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-40 W</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "kylwE`_urQ?fB@|B?dA?j@@|C?B?bC?T?F?x@?bC?xF?`A?L?jB?|@?nM?lB?bB?n@?P?zD?xB?zJ?L?bS?P?b@?r@Ah@@~B?Z?B?`A?nC?v@?j@?JAbD?v@?r@@pE?H?@ApE?VC~B?@Aj@AvCEtGEfEIpHa@na@CtAAvC?T?rC?bG@hC@z@?PAH@xG?dE?~@?p@?Z?J@z@@bN?nD?pA?L@f@@pJ?vE?tD?n@?X@hB?jD?N@lG@tM?l@?B?^?F?@?~A@pC?|A?nA?n@?b@?h@?R?R?R?zA?l@@t@?R?N?x@?x@?p@?n@?B@tK@fG?vB@`J?vA@zI?V?V@`E@xCArC?bCD``@@d@?`@?dA?l@@lC?TAtBDbU?r@?B?N?J?lD@`E?@?hD?rC@lE?fA?bD@zA?xA?H?R?B?N?@@tB?j@?hA@jH?fE@|B?xC?fA?@?^?N?^?~@@hD?B?N?x@@vH?lA?`@?~@?p@?z@?x@AxBCvAAj@?LErAI`DE`AGrAOhDQtCGfAEb@OjBI~@QlBCP?@QnA]dDc@~C]|BKl@UzA]hBOv@CJCNGXCLI`@YpASbASv@YpAMf@Md@Oj@Ol@[hAm@vBW|@[bAg@zAm@dBKZ_@dAM^O^KXABA@Qd@?@A@a@fAc@hAy@pBe@bAa@|@MXYl@Wf@_@x@}@hBe@`AoAjC{@tAiC`GqAtCWh@ABMVWn@IPwA`D}AnDWl@kBlEM\\GJwCnHIP[v@IRQd@[v@eInTQd@EL]|@]|@]|@IRg@tAM^?@Ul@e@nA[z@ABYv@KZe@lAe@pAO`@u@pBQd@e@pAu@rBQd@O^e@pAa@lA]`ACFs@fBABGPELITGNCHELe@fAoGnOmAlCUh@Yp@g@fAgAbCSd@Ud@w@`Bg@dAYj@y@`BMVKTu@xAoBrDoAbCq@lAaAhBaAjBKRMTU`@Yl@o@pAg@bAWb@e@z@k@jAS`@",
                      },
                    "start_location":
                      { "lat": 35.4602233, "lng": -97.59745480000001 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "8.2 mi", "value": 13195 },
                    "duration": { "text": "7 mins", "value": 417 },
                    "end_location": { "lat": 35.5008876, "lng": -97.8963328 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-40 W</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "arqwEl}ssQQ\\m@rAIN]p@]t@c@|@Sb@}@jBS`@?@y@dBCFQ`@Sb@A@Uj@y@fBWl@EJCFGPA@ADUf@y@pBa@|@yAhDkBhEIPaA~Be@jA[x@wAnDSf@Qd@Qd@qCjHITM^MZeAxCKZyA~DgAtCqB~FgAxCGPIROd@Ul@m@`Ba@jA_AfCk@~AGR}@bCITAB{@~BYz@a@dAUp@_DxIQd@a@lAgAvCwA`EO`@ABo@hBo@lBm@nBk@nBi@nBUx@Sv@g@rBg@tBc@nBc@xB]rBYfBEP]tBG`@If@Ij@c@jDIh@Gd@]jDYzCq@~JCp@ANC^KpBIdCGdCCzAEtBAjB?bCAxJ?|A?j@?fGAlIAnFAvE?x@ApD?f@?N?l@@xD?fF?jAAbA?rB?bB?r@AxI?tA?`@?vBA|C?nJ?XApC@hCBpI?H@vBDlD?h@@fA@`@BpB@vA@vA@x@@hAF|EFrE?FDnDF|EN|MHvFJjIJ`J@j@@j@?XHxGNpL@vA@bABjAB`B?f@@x@@j@BbB?f@FjFBjC@b@?BJzIDdCJ~IFdFHxGBjC?J@L?L?L?b@@hC?zD?rDC~CA`BAn@Az@Ar@?r@Ab@Aj@At@C`A?DC|@CdAAZEdBGtB?NGzBGvB?BI~CCbAGzBKpDQbICf@EzACp@I|CCnACh@QvHG`BEpA?PAF?NEzA?DCbAAf@QvGObGALMfFAXMxFAjA?F?F?HE|C?D?J?VAhAAvCAbD?fD?nB@f@?h@@fA@nBB~A@nA?d@@R@~@@RBfAF`CFbC?F@`@@h@TvGRbG@RFhBDzADvA?JDdAB~@BnAF|BDlD",
                      },
                    "start_location": { "lat": 35.4846502, "lng": -97.7559067 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "524 mi", "value": 842691 },
                    "duration": { "text": "7 hours 33 mins", "value": 27157 },
                    "end_location": { "lat": 35.0978089, "lng": -106.7231231 },
                    "html_instructions": 'Keep <b>left</b> to stay on <b>I-40 W</b><div style="font-size:0.9em">Passing through Texas</div><div style="font-size:0.9em">Entering New Mexico</div>',
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "qwtwE`kotQFtC@j@@x@BjC@n@@~@@nB?^@nC@rB?jA?dA?~@A~C?vB?b@?d@?l@AjAApAInDGlE_@|OA\\UxIALGjBAr@Ct@E|ACbAAlAAb@Ah@?NCxACnCAv@?V?\\?Z?ZAZ?^?\\?X?\\?Z?\\?pB@~GBnG?rB?bD@dD?hCBzF?\\?f@AdA@hD?bG?xA?lK?`C@vA?j@?b@?Z?X?fC?vA?lC?lA?l@?jA?lJ@fD?`C?l@@bG?nB?h@?`@?xD?z@?`D?@?JAt@?|A?T?xB?hB?nA@fB?t@?d@?l@?j@?pA?rC?H@H?X?vB?P?b@?H?l@?j@?D?f@?l@?dA@dA?bA?|@?VA|A?t@ExBA^A\\Cn@Ab@ABA`@Cb@G|@En@C`@Gj@?BGt@CVIp@EZANK~@SrAMz@Mt@Mn@Mn@I`@[zAS~@Of@Qp@CJYbA}@dDGRuD~M{@~CaAlDY~@_AfD_@vAg@fBeAxD}AvFUx@Sr@o@zBGVSr@_@rAg@dBADMf@ELIXm@zBy@rCQp@K^CHELu@pCsAzEWz@?@ENW~@EN?@KZERKZk@pBw@tCQp@Qn@]rAMj@I\\U`AYpAQx@I\\Kh@[`B]fBOx@WdBKj@Gb@AFMv@Kx@SxAIj@OlAMlACVK`AI|@I|@MvAGt@Iz@QjCKrAIlAOnBUhCKnAYfDOvAObBGl@Gj@UtBWhCUjBK~@MjAY~BQpAIh@Eb@Gd@UdBYnB_@jCWhBOz@SxAk@pDs@bEG^]jBg@vC]lBOv@a@rBYtAADi@nC_@fBI`@Mj@[vAADm@lCYrA_@~AKb@K`@U`AIXc@fBq@lCg@nBAF]nAe@fBSr@iB`HeA~D_@tAq@fCIXg@nBm@zBQl@Ol@_@vAs@lCADMb@ADgA`Em@~BCH]tAe@dBs@jCeA`Eu@pCSr@[nAeA|DK`@St@c@~Aa@zASv@Mb@i@tBYdACHk@tB_@zA[fAKb@Ql@g@lBOj@s@jCU|@m@|B{@`D]nAMf@}@jD_AhDGTc@dBqAzEe@fBoAxE[lA]rA[hACJUz@Sz@Sz@SbAGXKd@ETI`@Kj@Ih@Kv@O`ACNIn@KbAK~@I|@E\\ALI`AGfAG`AGvAGrAAx@C~@CxA?tB?b@?D?`B?xB?`B?vB?bA?bE@nB?bE?rC?`F?H?hA?rL@|L?p@?hE?pC?rF@|J?xA?xC?zA@zJ?bD?lF?jBBny@?jC@xK?fT@lF?bA@tA?|ABxC?bA@j@@|B@|@@z@@z@@vBBxBBxAFbDHdFFbCBlABzABx@FvBHfDLrENnJBvCBvABzEBdIApD?jB?t@AtBAlBAnAC|CEfC?@C`B?b@EhBAx@C|@?JSzHIzDMjGMzIAjACzAAz@AdBEdF?L?PAxCA|A?f@AbB?|B?|A?vA?Z?j@?jA?`A?`C?`A?j@@l@?dM@|E?j@?dH?rB?lE?bA?vAA^?b@?j@?b@CpDAp@Aj@CdC?@CzB?DExCIhEOxEAj@Aj@GvBEvAIbCKnDGbCAHIdDEvAAHErAKhD?HEpAStHOtE?HKtDEhAE`BCf@MjFIpDKxFCtBElD?~B?fBArB?bC@|A@~B@zABfCDjD?@@P?V@TBvABbA@`AF`C@VBl@FdCPjFLlDHhCd@nOLnDLnEDbBBj@HpCFlBTxHDxAFnBHxCHnD@f@?BH`ED`E@dA?TBtBBzC@dB@xE@vD@bJA|BBpR?j@?j@?d@?vA?vA?vA@vA?`@?nC@bG?j@?D?vA?fG@xA?f@?B?f@?B?lF@zC?bC@hG?Z?Z?N?F?X@fG?pDDre@?dC@nD?pD?zE@`@?~DA|BCzCCjAIdEOrEIrAAVGhAKdBEj@Et@M|AMtAGz@UvBCVEb@OpAQxASvAQtAWtBSxAYtBWtBWnBSvAQvAYrBQvAQtA_@rCUbB{@vGETOjAOhAMfACNM|@aApHOjAS~Ac@jDc@hDStAQtAOlAIj@SzACT]lCGb@ALObAIj@YtBY~Bc@jDg@zDQlA_@xCWnB[|BOnA_@rCe@nDOjAaAjHGh@Ij@Gh@EZIj@Ih@Gj@Ih@Gh@Gd@ADQnA?BE\\CLGf@?@QtAIh@CPAJALM|@SvA?FCJE\\OdAMfACL_@tCIp@Gb@SzAIr@YtBKz@StAMbACPK~@In@Eb@E\\ARAHE`@C^Ef@ANC^A\\Ev@?JEt@AXA~@CxA?v@?\\?zA@^?^@t@@@@r@Bh@HfB@PHxALvADZH|@PxAN|@BVTrAPz@FXDRH`@\\xAHZPr@^rATr@J\\Vr@Vr@JXLXLZLXLXJVx@`Bl@pA~CpG`EfI@@pCvFrCxFVh@bBjDx@`Bd@~@Td@Td@NXLVZl@LVHNRd@DFFNZl@bArBj@jAv@zAZn@BFNZFJv@|A`ApB`AlBz@`BnDhHzAzCt@|ATb@jBxDhAzBn@rA`@~@f@lAd@hAb@nABDNf@Pb@?@J^Nf@JXZfAFR\\pAZrAPv@BHDV@DDNNv@X~APhAJr@F^R|ANtAD^BXB\\BXFz@Fz@F~@?B?B@PDz@Dv@@`@Bv@@f@DjC?zCAvAAx@Av@A^Ar@Cb@AZCv@CZA\\Gt@C\\ARAHC^ATCTEb@AFGl@Iz@Iv@?@SrA?DMx@CTCJQfAGf@A@Mz@CJUrAIj@G\\Mt@Ih@i@hDi@fDKj@Ij@_AzFIh@}AzJUrAIh@_CzNs@pEu@rEW~AoA|Hu@zEIh@UrA_@|BaAhGG`@CPKr@StAM~@i@tE]vDW~CKpBK|AGpACb@Cn@Af@Cn@Cn@Cv@ErBAR?V?r@C|B?XAhB?j@?B?j@?fDAtF?lE?|AAtI?l@?rE?r@?F?~A?z@ApC?`J?j@?vB?hB?`D?xAAnD?pB?P?~A?|EApA@pDAtD?R?B?hC?b@?~@?dC?`@?t@?xA?vA?l@?j@?b@AdC?~A?d@?bC?rDAtH?F?H?`@?nE?D?H?t@?lA?l@?nA?r@Av@?lA?nK?nA?lB?`@AvA?nA?t@?nC?V?bB?pGA|P?hG?j@?@?|@Cp_@?nD?@?nE?tA?@?h@?j@?z@?j@?vAAxA?bC?dA?PAbC?\\CxEGlF?BKjH?DEnBC~@?\\GvBAXE~ASlHCj@Aj@?BCxAGvDCrC?xB?xB?xA?|@@\\?L@|@?l@D`CBhBD`B?NF~BL~EBj@@x@DfBFlD@P?\\DlD@z@?@BpCBzC@pE@|@?x@?hA?Z?rC?Z?N?fA?|@?h@?xA?j@AdN?j@?dC?nD?@?dAAlF?@?rH?nDAzE?jD?@?lD?@?zDAlL?xA?zAAv`@?j@?dC?HAxBAbC?j@?j@AbAAvA?vAAlAAv@CzCARChCCzBEpBEzCCtA?FChB?bAA~@AlA?hAAx@?|B?nD@pC@rB@f@?l@?NBbC@ZDrDFzEH~I?`@BlC@fC@hF?bK?rN?bAAnF?dE?V?j@?Z?R?~@?`C?vA?tA?pL?vB?hHA~A?@?zE?l@Ajh@?jD?rD?V?vC?fD?vCAfJ?nGAj_@?lNArB?h]?zHAzH?tE?rJ?fP?f@A`@@R?hAAbA?rB?zC?~D?L?dS?dCAvF?Z?lBAvB?TA`CA`BExBC~AEbCGnBMlECr@ALE`AKbCA\\Ez@MrBALKtBOvBM|A_@xEw@rIo@`G[zBGh@In@YxBQdAWlBc@pCOx@Mt@Kh@CNMz@Mr@]rBWvACPCPs@dEOv@G`@aClNOx@Mx@Oz@UvAOt@Mz@SfAYfBe@pCs@~Di@dDw@hFKt@SxASzAUvB_@`DU`COxAIjAKhAKtA[pEOlCMnCKbCE`AKvDInCEvCC~CApBArG?jF?Z?zA@`C?nA?x@Az@@jD?D?j@?L?zB?@?\\?nA?nB@vF?xB?H?pF?v@?@?`A?~@?hE?R@|D?`F?dJ?dA@`K?|A?V?~@?vB?pD?B?d@?l@?p@?lF@xC?jA?pC?bN?tC?b@A`@@fA?pB?rC?l@?n@?t@?n@?t@?J?bD?nD?l@?j@?~A?rD?^?^?x@?~@?nB?DAxC?nC?|A?`B?`@?F?b@?L?lC?hA?jB?`E?nBA`S?\\?lE?hA?fM?bLAnC?xI?zH?~F?pF?lH?vE?fNAvC?zB?zI?`B?|D?rF?p@?^?J?X?D@f@?hC?J?^?j@?bB?jA?J?^?F?|A?fG@hI?~C?lE?B?F?Z?j@?z@?jA?J?`@?J?j@?nD?dA?L?`@?^?@?V?@?j@?h@?j@?j@?`@?^?n@?R?j@?T?@?Z?D?b@?@?L?B?T?P?@?J?^?z@?X?Z?v@?x@?b@?t@?tA?nA?tA?jA?@?x@?f@?f@?hA?P?bA?nE@pA?R?~@?zA?~A?bA?x@?jA?J?~A?bD?P?X?Z@xD?V?pA?l@?X?X?bB?@?N?zA?xA?bE?xA?R?tB@zE?t@?`@?rC?nB?BAd@?fD@vI?N?h@?J?`@?vA?dA?@?D?^?h@?t@?hI?dC?x@?xF@zC?vA?V?z@?J@nA@x@BlBBhA?FBx@Bt@Br@@JJjB@LFl@Hz@@HPrANbAJh@F`@VjAXfAZjAVt@Xx@`@dAh@lAh@fAdAlBrA|BxA`Cn@fA`@p@vAzBf@x@h@~@jBxC\\l@j@~@DJZf@r@jA`@n@pAvBbA|AJLX`@NTp@~@LNFJFFJJPRHHXXt@v@lAfANNp@n@|@x@r@p@fA~@JJj@h@j@f@l@h@t@l@v@l@`Av@jAbAp@n@PPDDj@n@`@d@j@r@`@h@RZFJDDJPNVXh@BBXj@LTRf@P`@LZd@pA`@pAPl@FV`@jBZ~AJp@Jv@Hv@LrADn@FfBBlA@~@?~@?|B@jE?`B?|E?~A?dB?bA?vA?P?rB?pC?\\?zC?`B?tA?dA?zB?n@?pA?rA?F?b@?p@?d@?^@J?dA?P@j@?~@@hABdA?L@j@?HBlABvABb@@l@?DBf@B~@PfE@NLpBHvAFx@@XDj@JrAPpB@FRzBNpBDh@HhANzABf@TtC@DP`CFdAFlB?H@H@Z?B?PBv@@l@?n@?rA@DCjCAvBCj@EzAE|@Et@Ev@ATGj@?BC`@OzAEh@CRCZMpAEj@ADS~BMpACZAJGf@C`@KlAc@xECRATE\\ARQpB?BIx@?BGr@Ef@Gz@AJ?@MhBEp@Ev@ADEr@Ev@El@AVC`@AP?PAF?BEjAAPCdACd@?LG`B?ZAV?R?D?DCpAA|@?ZAP?@?NAfBAfD?\\?vD?bAAdE?j@?pB?tBAdD?j@?j@?r@?b@?j@?l@?tA?pA?FAnF?xJ?lAAnC?zEAlH?zF?xCAj@?b@?F?j@?h@?l@?vA?P?ZAtE?hC?^?|EAfG?x@AnH?`F?j@?vA?bCAj@?j@?@?j@?xFAnJ?j@?bC?dC?j@AbB?bD?l@?fEAfG?pFArB?`@?tC?t@?zEAjB?jB?vA?vDA~A?vA?\\?tDAd@?xC?VAbD?dDEbb@?j@AhG?vACxVAdD?j@CfYAP?|C?dC?vAAzE?|EAhRAhG?`JAlVAtH?tGJ`GHtCR|EVhEB`@JzAd@|E`@vDl@dFx@vFbAdGl@hDp@vDDXNt@Hb@TxAH`@@FLt@TrAJh@Lx@FXBJPfAF\\FZN|@@DHb@TxAJf@d@pCP`ATtAz@`F\\nB\\tB^rBXbBRfAj@jD@FHh@b@lCd@hDBPTlBF`@TpBLxALlALzAFv@B^@@HnAHjAFpAH~AJtBF`BFlBDrBDpD@~@?d@@j@?H?`@?j@?j@?j@?B?fA?x@?vA?J?^?B?f@?l@?V?vA?B?N?bA?F?n@?`@?F?z@?^?^?t@?`B?H?L?lB?~B?J?vB?P?pB?pB?B?jAAtC?|@?dA?X?B?R?h@?d@?T?R?fBAxC?R?V?xC?T?j@?j@?j@?N?\\?p@?J?j@?j@?v@?^?z@?hA?N?|@?bA?tB?P?xBAjH?P?zG?bA?nB?fA?dB?x@?`A?z@ArA?Z@h@A~A?H?P?X?P?~@?fB?z@?dA?z@?bA?|@?z@?vA?dA?@?j@?j@?xA?|C?p@AbE?bC?j@?nD?rI?z@?fG?`J?j@?dC?tA?j@AtE?r@?vC?nB?nD?h@?@?l@?r@?bB?xA?bB?dA?\\?n@?fC?dBA`A?v@?~B?lA?xA@xC@|@@x@BpA@hAJbDFhAPzDHjALlBNhBNdBNtALjATfBHh@Hl@pBvLBLDNTfABFNp@DRFVDPFVBFRx@h@nBFR\\nAJ^Z~@Rn@Vv@Tp@Vt@Vt@r@nBf@pAn@hBnAfD^fAfBvEJXp@hBRl@b@lAb@jAPb@?@xA~Dr@nB~BlG?@Pd@Tn@fAvCnDvJhBbFb@jA`DxInCpH^dAJXZx@FPFRb@jA|ClIRl@~@fCr@nBr@nB~@fCb@jAj@zAb@lAl@bBx@fCt@fCRx@Rt@H^H\\Nn@Px@FZF\\P~@@DBRF\\Jr@Hh@Jp@Fh@BRHr@Hx@Hz@D\\F~@Ft@@TDd@D|@FzAHtCBv@?Z@x@?|@?\\AvB?f@Ar@Cx@?NAj@Cn@IpCEdACd@OxEGbBAf@Cf@ExAA\\C`@Af@GbBI|B?FA^?DATATE`BCv@AjAAHCfB?N?@AnA?H?`AA~@?pB@tBDxC@l@DfC@\\D|A?NJtCNzB?HB^HpAX~EBRJjA@JJhAJhAJ|@Dd@D^Hn@V`CNjAFn@Hh@^jDXfCb@xDb@~DNfA?@l@pFBZHh@RlBJ|@BTPzAL|@Jx@NrAZjC@?NrANtABNJbAFh@D\\Ht@F`@LrAHj@BTHx@Hz@JdABRJx@Fr@DXb@zD@PNpAFj@BRX~BJfA@BBTFh@BV?@BNDZHx@Jz@R~AFj@?DBNFl@Hh@@JJt@PtAF^BTHh@RrANz@FXLz@`@pBPz@P~@DPZtANn@Jd@Pt@\\tAJ^^pAZhATt@J\\`@pAJZVv@JXPf@t@rBd@lAXt@Xr@t@dBf@hAh@jAZn@NZf@bAP^Zj@n@lAf@|@r@jA^l@^l@^j@NVv@nAHL`@j@`@j@`@j@`@j@b@j@`@j@`@h@`@h@r@`A`@h@b@j@r@`A`@h@T\\JLbAvAj@x@T\\`@n@^j@t@lAr@nAz@zA?@FJVf@jAzBfA~Bj@pADHv@jB`A~BrAvDVt@^hA@Dn@pBr@bCr@fCzB~J\\`Bb@hCFZRjAXpBPnARxAJdAFd@?@Fh@VbCNbBNjB?JHhADl@L|BDx@FvA@^JnCD~B@l@?V@l@@x@?f@@tA?|A?vE?tB?p@?pB?v@?j@?r@AhD?p@?xE?xE?B?f@?zA?f@?bC?hCA|K?V?p@?xI?j@Al@?j@?bA?V?lB?@?h@?f@?tB?l@?pA?~B?`B?dC?T?`A?J?jAAN?`C?jA?`@?`A?hB?lB?r@?`A?x@AjH?F?j@?fL?vDAjB@pDAxH?~FAdM?nJ@T?VAx@?nI?fTAzB?fCAnZ?tE?vE?xG?jE?fG?B?f@?B?jEAhN?vK?F?vEA|L?|A?hA?L?t@?nA?j@?@?rC?J?N?Z?N?fA?dA?tA?h@?rH?nBA|C?R?j@?nD?R?V?dC?j@?j@?j@?R?jB?pB?t@?N?j@?xA?x@?hA?rB?NApG@`B?vA@X?`@@r@BfA@PBbAFvA@RDx@HpAJjALvAFj@Fh@Jz@LbAPlAZnBNv@TlAPx@R|@Nj@\\tAZlA^jA^lAJZL^Ph@L^DJBHDJx@jCVx@^fA@BPf@BLt@zBvBxGjAjD`@rAXv@pAbEFLjApDNb@?@|@pCb@nAdAdDnAxDTp@HVBH\\fATp@dA`Db@nAVr@b@nAPd@Pd@DJn@`BVn@\\t@d@jAXn@Xn@Vj@R`@bAtBP\\h@fAx@|AZj@^r@Xd@BDlAtB|@xATZ?@\\h@n@`A`AvAhA~AFFd@n@\\d@X\\l@v@x@bAHLNN~@fA~@hA\\`@VZ@@`@f@zAfB@@VZpAzAVXZ^jAtAnAzAlFjGhBvBt@|@fBtBpDhEz@bAZ\\nAxAtA`B`CrCfApAzAfBbAjAv@~@xAdBl@r@b@h@HHdAlA?@tA~AfArA@?PRpDhEbBpBnAxAp@x@hBtBx@`AjBzBf@l@LNxAfBr@z@b@j@bAtA`ApArAnB~@vA`A|A|@|A`@n@v@vAdAjBhAxBv@|AbAzBlBlEhAnC@B@BJVRf@f@pAh@`BDJHTJ\\DNFN?BJVTv@Rp@FR@BL`@FVHVFNNd@Pn@Rt@DPRt@BHRv@T~@DR@@Jd@J`@Pv@BLRx@XxAXpARfAj@vCp@nE\\lCVrBNx@ZlCb@lDJ`ANhAFh@BXb@lDLdAXfCL`AVzB\\vCLfAL~@XzB`@`DF\\NlAV`BLx@`@`CNt@^rBP|@XpAXtAXlARx@Pv@l@`CV|@V|@XdAb@vA\\dAX~@Z`AZ|@Rj@v@|B^~@|A|DP`@x@pBx@dBRb@LV|BrEzCfGJRHL|A|ClIfPT`@Tb@@B|@fBR`@fC`FbFxJTb@R`@@@zCbGv@|ArAjCzBjE@?bArBb@|@\\p@Pb@N\\dB~Dd@nAFNr@hBf@zABHh@~ATz@L^Lb@Rt@Nf@f@hBLd@v@bDn@tCTfA^pBZdBj@lDx@`Gb@`E^nEH`ADj@HpAF`AJpBN|DFzBB`ABdB@xA@tA@dCAnO@|E?zE?rF?pH?fE?r@?fD?|E?dY?zE?pJ?dA?hG?hR?j@?xB?zF?T?~F?dF?j@?|G?XA~BCj@C`ACr@CbAKdBGjAMvAKhAKjAUfBa@zCWrAALG\\Qv@Ox@YlA_@|AgAfE]nAMf@m@xB}@jDi@rBW`AW~@s@tC_@xAi@xBYzAKh@SjAQjAIj@QfASrAGh@Kt@[hCU`CKlAYnDGlAMhCK|BCbAEzAAt@AzBA|A?pA?~A@lBFjCD~AFvB@NPtD@H@TJ~ANdBJhAH`APxAFf@Hz@T~ABTHj@T|Ab@fCd@dCLp@R|@`@hBbA~DLb@d@bB`A~Cx@dCNf@p@tBDJHXt@jCf@nBLj@Nn@BJTjAP`AVxANbAVdBBXFf@TrBPrBFbAFbAHfB@FFbBBvA@nA@dA?N?@?j@@zC@nQ?^?~@?j@?dC@x@?Z?N?X?R?`CBt^?@?j@@fG?n@Bdd@?B?@?l@?|B?D@rC?`J?T?j@?H?xB?j@?j@@z@?hB?dC?J?`@?H?jA@nD?zD?jA?@?H?j@@xB?v@?j@?L?lE?j@?lA?nD?j@?H?`@?hG?F?P@X?j@?nA?xC?`A?jC@rH?l@?hD?|A?j@?bG?B?f@?B@jK?f@?nD?dN?xA@bC?@?j@?vE?bJ?fA?dEJbIBdANjC@RLjB@DDd@Df@LxANnANlAN`ABNHh@@DHb@Nz@DVTjAZvADPJb@FXHVDNJ^`@vAH\\Tr@Tr@DJFPHVJZ@Bh@xALXFPHRRd@j@tAp@tADHTb@HN`@t@d@z@\\l@DFd@t@`@l@l@|@JLLR\\d@RVX\\PTBDRTJJNPdAjA|@~@j@l@rBtB|@~@VVpCvCxA|At@t@rArApBrBp@r@lDrD~GdH|A`BrCvCVVNNf@h@|@~@v@v@dAfAf@h@fChC@BVVBB\\\\hBjBrAvAfBhB~AbBjBnB|A~AzB|Bd@d@b@d@lBpBZZvAxATTt@v@v@x@f@h@j@j@ZZVX@@ZZXXt@t@?@v@v@v@v@t@x@v@v@pAtArArAf@h@RRj@l@JJ|A~Ah@j@@@vBzBNPv@v@XZnBpB`BbBv@x@|A~Az@~@fAjAh@f@DDNNd@f@@@`@`@NPXX^`@VX^b@\\`@b@j@FJl@v@\\d@NTn@~@FJXb@V`@PZ@BRZ\\n@PZR`@n@nANZ`AxBLXp@fBVn@@F`@nAt@zB`@xA`@fBRx@l@rCNbAP`AJj@LbAF\\Hl@@HNvAD^B\\PpBD`@BX?DFz@?DDn@@`@Bb@Bt@@`@@\\Bt@@^?Z@X?~@@\\?|@?|@?v@?z@?pG?`@?rA?zA?p@?`A?N?j@?j@?r@?rA?`A?z@?n@?J?^?XApD?z@?rE?tD?~J?fB?pB?xA?pD?jF?@?h@?j@?`A?bA?P?X?f@?vA?B?j@?h@?l@?jA?bB?j@?~@?Z?|A?hG?|AAx@?x@?vA?`AAzA?v@?FAfBA`BAz@ApAC|C?TA`ACxACzAErCAvAC|@CtBExBEtA?LCj@A|@C|@EvACr@?BAf@EnAEnACdAC|@ANAj@E|@An@Cf@EbAIhDMfFCrAAj@Aj@ChAAfBCnA?FAtA?t@At@?T?nBAV?R?P?B?X?`@@|@?j@?D@|B?^?JBnD?T@f@BrB@n@BlB@PBzADnBFdCFpBJlDDlAF|ABjAHnCFrAD`BDdCDtABvA?PJbFFnE@x@@j@@nABtB@vABbCBnD@pC@lA?fA?jC@bC?v@?|@?fB?hB?F?pC?lI?~@?j@?|@?xA?bC?bC?nB?R?`D?x@?l@?fD?F?rH?nQ?d@?zC?bA?d@@~L?lB?zD?d@?xD?d@CdS@bG?pB?H?dD?x@?z@?V?nE?xA?zA?nH?fC?j@@`C?n@@b@@v@@\\@H?LBd@@\\BZF|@Ft@D`@Fh@Hl@F^BN@HH^?DLj@Lj@Lh@J`@Lf@Nb@@HPh@Vt@HRDLd@fALXTh@Zr@P^N^JRTh@d@dA`CnFr@~AvCtGrClGBDbA|BnArCv@fBdCvF@BXp@Zn@Xl@Zt@Zp@h@pAz@nB@B^x@HPHRZr@LVf@jADJRd@Zr@h@hAh@nAd@bAHNHTHNHRBFBDlAnCdA~Br@`BXp@^t@`AxBv@fBJVXn@\\t@v@dBn@vAFLHP@BRd@Tf@Xn@JVN\\BDRd@x@fBPb@b@`An@vADHLX@Bx@hBDJLV?@BDf@hA@BXl@h@lAt@bBd@dALV?@l@rAh@hAd@fAJVZp@h@jAZp@\\t@Xj@DJTb@?@R^Vf@R^JRZl@LV\\l@@BLTpAzBj@~@NTpB~Cn@`ApB`DjBtCl@~@V`@`BfCn@bA`@n@x@nAxA|Bl@`A\\f@|DfGdCxDxBfDt@hA`@n@\\h@n@`ADFdBlCHNHJbIbMR\\z@rAdA~AJPzAdCn@hAhAtB^t@fAvBx@bBfA~Bj@nArBtERb@vBzEf@fApAvCx@hBf@hAHRbBrDnArC\\t@n@tAt@dBNZvBxERd@JTfDrHzC|GjAhCbCpFnArCFL~AnDN\\Vf@N\\Xp@j@lAdAbCpBlE~@rBhB`EzDzIj@lApArCnArCbBvDj@rA~CbHxA|CFJVf@Zl@R^PZT`@`@r@t@nA@Bl@`Aj@~@Vd@f@x@~@tAXb@lAfB\\f@f@r@\\d@|A|BX`@\\f@d@n@PR`@f@~AhBRTz@z@\\XFFn@h@VTt@n@@@~@v@r@j@t@j@tBbBjFhEB@XT@B`@Zl@d@v@n@~BjBz@p@@@XT@@@@dAx@NL\\X@@\\Vh@b@XTRP\\VtBdBrEpDf@b@hA~@hAz@b@^rDvClA`AtAhAlCvBbBrA~@r@dBnArA`A|@l@`@XbAp@DB?@TLf@Zj@^~@h@z@f@vAt@RLDB@?`Bx@B@vBbAr@\\FBdBt@dBr@t@Z`@NxAh@pBt@xAf@fBn@D@|Bn@tCx@dCn@lAXz@R~Bb@nAVfHxA|ObDtAXrCl@~A\\h@Jb@J~@R|MnCjCj@|Bd@RD|@R`Cd@TFdARfAT@?VFlSfEJ@vAZdAR`@J|Bd@jCh@fB^bB\\bATbB\\h@Lj@Lr@LjGrAbAPr@NnAV~Bf@zGtAnE~@rAVlB`@bB\\F@`B\\vDv@xBd@d@Jt@NzA\\\\HfAV^J^Jr@T~@Xf@NbA\\XJl@Tf@PTJn@V^NdAf@t@ZbAf@`Bz@zAx@`Aj@v@d@dAp@lAx@lA|@~@r@t@l@|@r@b@`@|@v@r@p@t@r@`B`B@@|@~@x@~@DFb@f@|@jAf@l@DF|ClEdA`BdA`Bf@x@p@lAFHDHFNFHb@z@j@fArBjEj@rADLJVDJZv@Tj@Pd@pAzDv@bCv@jC`@~AZfAx@lDJd@Pz@R~@d@dCX`BPfAL|@T`BRlBb@~D@FT~CPfCR`EPfFHtDBrD?r@?tAAzO?R?t@AbOAjJAnP?j@AxI?~L?j@?j@Aj@?~NAlJ?rD?j@AfH?nC?j@ArH?PA~YAfC?f@?bEC|[?bNC|[AxY?xC?`A?bC?vA@xABrCFpEDrCDrA@d@@bABn@DtADvADhAJjCLtCLpCNrCZ|ER`DXlDPvBXlDRtB^nDNvAZlCTrBVrBj@jEf@jDZrBVvAJz@PlAXzATrA\\rBTlALp@Ln@j@tCZtAf@dCl@pCb@lBv@dDXjAz@fDnAzEjA`EdAjDX~@dBlFBH~@tCzAhE@BxBbG~B`GvAlDz@nBz@pBv@dBXn@v@`Bv@dBp@xAx@fB`AtBfA~BbA|BzB|EpAnClDvHhAfCRb@b@`AVf@d@bAj@pAjB~DrCbGx@fBJV\\r@@Bn@xAJTx@hBdCnFz@hBfB~Db@`ABBtClGVj@bFtKnD~HdAzBP^Tf@nAlClAhCnCdG|@lBZp@P`@Rb@bBrDPd@|ArD@BN\\Rf@d@pAr@nBn@bBbB~EL`@pAbEfAzDx@`D@D\\pAJ`@Lf@^zAb@nBXpAz@lENn@Fb@Jh@|@hFN~@T`Bd@fDdAnIPxAPdBHz@PjB@PL|AHz@VnDT|D@FJzBBd@JlC?@@R?PBz@VtNFvD?`A?nE?F?b@?|E?lD?@?|F?zF?V?tG?tD?nA?vF?|MBpLBhFDhFJrI@lAXhOFvCFnB@h@NfGBjAVrGHtB?JHlBL|C@JZ~Gl@tLDj@D|@HrAL`CFvAL`CZdGh@hKFfAt@xNvBfb@V|EBd@Bl@D~@@VDj@Dx@Dz@FvAJbCHxBLnDHnBVhJB^?RJzEH~CFtCFlD@x@DbDFfEBdDD`GDrK?tFAj[C`O?dC?f@?r@AzB@lJ?F?B?PA|A?fB?B?pB?tB?^AfG?zA?XAhFAxC?jKAvWChH?hH?zC?xPA|T?zC?j@AfG?xFAzE?vA?j@CnZ?|AAtM?F?|D?dAAvC?|B?vB?nA?xBAtF?nB?bE?F?pB?b@A`CAxA?v@AvBCbCK`F_@tOElAGbBKnBOxCGnAEbACZEr@IlAIvAGx@CZEj@Ej@ARCRQ`CS`CS~BEb@MjAU`CQdBS~ASdBQbBE^uAtLoAtKqB|PGj@y@hHIj@cB`OY|BW|Bc@fE]tDUpC]rEOrBI~ACTAXK~AIzAGxAMzCIlCIfCCl@Al@EfCEvB?BAt@A`BCjB?dAAx@?l@?D?`B?tA?b@@tCBpB@vAB|A?\\HtDF|BD~A@j@@BDnAFdBFzAJvBNrCLjB?@JbBRvCd@lGb@fGZpERfCJbBXrDBZVjDDh@JrADh@vD`i@Dj@?BpBtXVjDVzDL~AXdEVdDVhDf@lHHjAF~@Dl@Dv@@HBd@LlBNnCRfEJzBD|@FrBLdDR~GLhEBz@@t@H`EBjBBrBBvA@rADxF@jF?hG?h@?B@|E?jD?b@?lU@jD?fG?zA?hF?b@?dI@xS?\\?~D?B?rA?fC?J?rA@pH?bJ?vA?@?d@?p@?D@hY?T?T?l@?j@?l@?|B@vO@dK?j@?j@?nD?|@?|C?bC@nD?bF?nD?j@?hA?x@?j@@bC?~K?V?zE?@?~A@zB?`O?`I?vA?j@@vA?vA?nD?B?f@?nD?nA?@?|A?j@?b@?j@?NA~N?H?`@?bC?H?`@?`B?`@?|B?vOAnD?F?b@?t@?tI?vA?bC?F?bA?J?nD?F?b@?H?`@?`BAtE?rA?H?`@?H?rD?jBAD?dB?jF?`D?pA?R?Z?D?H?`@?H?j@?J?L?n@@h@?j@?P?X?h@?@?P?J?L?j@?h@@bC?dC?jD?~E?d@?D?rA?xA?jD?p@?pD?h@?j@?`CAxA?`B?r@?`C?Z?~A?X?`B?D?X?J?|E?B?hE?nC?\\?rCAj@?X?P?|I?dC?|@?jF?nC?rA?bB?lA?r@?vB?n@A`G?D?j@?R?nB?d@?p@?`E?tA?hC?pF?hG?|C?tCApH?~C?tC?F?P?`E?F?fO?D?N?T?D?rQAfE?xE?`@?xB?RAz@?rB?nD?j@?`E?r@?hB?Z?@?L?jA?pA?|@?dR?fHAjD?~A?vF?tB?z@?L?`C?rA?vC?hB?bB?P?rG?f@?bTAjC?p@?~I?n@?~E?zD?`AAt@?zK?lC@zBAnC?p@?zA?dC?l@?p@?rA?|B?|F?zD?fC?~B?jC?zA?hAAxB?t@?zD?nB?nH?|@?d@?lA?dA@xA?rCAV?d@?`D?D?X?B?BAl@?@?b@?L?bA?p@?j@?h@?B?b@?D?rA?pB?nC?H?j@?\\?fB?jC?nB?dD?vF?XAX?tC?xD?F?bF?fB?Z?rB?xA?j@?\\?jF?PAzC?j@@nBAlC?rA?zD?rB?zD?D@~E?dB?lB?tB?|@?T@`F?|@@fB?tA?BApB?lC?nB?pB?rB?fA?|A?zA?D?~C?|A?hB?nB?x@?v@?l@?~CAr@?rB?r@?hE?hC?~@?pA?\\?dB?B?d@?lB?d@?\\?~@?j@?bA?Z?N?nA?|@?rA?nB?z@?h@?J?pB?bE?xC?fA?~@?hA?fA?lAKlFAP?HCf@C^Cl@CR?HCX?FAPCPAHC`@Eh@CXE\\CZA@Gj@CXCNAHCXAFCPE\\Kp@QnAG`@CLKp@CRE\\ETE\\EXEXEVEZEXEVCRADMz@OfAAJGb@ADCREVCPEVAJGZ?@Ih@?BCNCVABEZAHIh@Gb@ADG`@AFCREVKr@AFEXSpAANG^Gd@G\\Gj@GZG`@AHIn@QlACPMz@_@dCg@fDi@vDGh@CJCPAJc@zCg@jDCNgAbIc@zCY~BQnBIhAOxBAHInACf@InC?HCjACrC?t@@fA@z@BlBDhBB`@FnAFbABl@PlCJ`BRfDJtANdCHnAJdBHnABh@JvAL|BN~B^bGDf@HrAHtAF~@BVLrBHvAJ`BDt@JvAHrAP|CFr@Dv@@TDd@Dp@JlBFz@J~AJhBV|DDh@PbCDr@T|CP`CRdCZlEVvDRdCThDLzAHlAP|B?BP`CLdBHfALjBPxBPhCJxAJzA\\pEB`@NlBNpBDl@HhAFx@Dp@Db@JfBHtABn@?DFpBB~@BhA@hB?lA?b@?fB?fA?F?zB?j@?N?lB?|C?nB?N?~C?X?lB?vE?hA?`C?tE?TAtEAbD?hB?V?RAnBAhBAbCAjBArB?L?pA?jBAbB?~C?~@?j@?lAA|D?vE?l@?zD?xD?vC?~D?vN?xM?~M?bR?hF?~H?dH?~H?bL?|DAxH?nC?nA?jA?v@?vA?lA?t@?Z?|E?bB?bA?dA?rC?d@?hA?rA?nB?jF?|A?xA?l@?B@jC?f@?l@?v@?`A?r@@l@?jA?^?d@?fA@rC?`@?t@?r@?nA?X@~C?nA?tA?R?xA?xB?`B?^AfC?`B?x@?jB?t@?j@?d@AdG?vAApD?jAEjBCbAQlCE^AJMbAKz@g@xCOz@QdAMv@a@vCCZAFEl@IlAAn@GlAGhBGzAEbAIbCEt@MtD?@M|COtDMxDM`DSlFKvCQrEOrESnFWpGGhBKpBCd@IdCE~@GdCAPA|A?zA@r@DjBHlBD~@Df@@LBZFp@Hv@Hj@Fj@F`@f@rCThAn@jCf@nB@Fx@~C?@J^Pp@h@tBJ`@@FZ|A\\|BLjAJdAF~@DdAB|@BdA?z@?f@?nA?dA?X?vA?vA?b@?F?j@?j@?bC?j@?P?pBAnL?F?b@?F?fJAzJ?dA?hB?jB?|C?xDAbC?vDAvDC~CAvBAh@AzCCfCCbCAbCAjBAbC?|C?V?xD?dC?~C?pE?~C?tD?vE?dG?lB?l@?j@?f@?B?t@@vA?P@dA@nD?BBrC?V@n@@|C@D?pABhD?R@h@@|B@~A@|B@~D@`@?lE?L?`D?P?xA?rA?lA?\\?Z?nA?R?V?vA?P?dA?pB?PArB?fB?v@?vBAd@?fC?l@?|D?hA?bC?`@?vA?xE?|H?p@?L?r@?nC?Z?jB@tB?N?V?nA?jB?pA?j@?D?d@?vB@nF?zB?n@?j@?dC?~B?zA?l@?hC?rE?B?tD?rE?B?zE?tE?`B?h@?l@Aj@?f@?D?hCAxEAtFAbDCtEAhCClGC`H?f@?FCzC?lB?h@A`A?lC?z@?j@?hC?nF?R?\\?J?n@?nD?h@?jC?fC?`D?hD@lA@dCBhE@fA?J?B?\\@zA@t@?v@@jB?L@^?~@@pA@rA?V?V?^@pA@fC@pF?rA?f@?B?zAA`E?`B?bB@|GA~I?dC@vB?fF?T?j@?B?pC?lA?rAA`D?P?vA@v@?x@?`A?n@?rA?x@@lA?`B?tE?xE?~A?j@?p@?pA?V?jB?\\?dB?bC?j@?l@?rC?dA?lG?zK?lB?~F?J?D?nD?R?n@?`@?pA?xB?dA?V?X?vAAz@?R?D?|@Az@AvA?X?F?f@AP?\\?x@ElEApEArC?t@?b@AdB?p@AvG?~A@zAAzB?tF?\\?`@@zA?fAB|A?t@@B?p@@f@D`D@^@tABzA@zAH~EB`C@j@BdC@d@D|A@n@?X@T@\\FvDH~FBtA@l@@nA?r@?j@?`AAjA?lA?p@AnD?hA?d@AxC?hAAlA?N?~BAn@?l@?`C?fA?N?xA?fD?lF?jD?`@?H?`B?hI?X?rF?H?jA?D?|M@lB?zA?hC?vA?fC?B?h@?xA?rA?`D?~F?h@?B?nF?dD?@@rG?pD?h@?@?tD@J?^?@?dB?lA?j@?@@bJ@`I?B?j@?`A@fO?@?@?h@?B@~F?fB?h@?n@?r@@`C?dA?V?fD?dB?j@?L?d@@N?t@@f@@t@?@?D?b@?j@?bC@vA?dA?|@?zE@tC?|C@|E?|A@rD?lA?pA?xA?^?P?n@?n@?t@@bA?X?X?X?Z?t@?`@?HAb@?jA?PCrACzAAx@Ar@Cz@Ap@An@A\\A`@An@A^Ar@CnAAv@CrAE~AAj@EbBAjACvACjA?|@A`B?V?|@AlC?bE?zB?F?@A|B?b@?x@?rB?`@?x@?F?lB?p@?hA?zD?@?j@AdC?f@?zA?j@?VAtC?@?j@?j@?xA?rA?@?j@?xA?N?\\?bCAfA?bB?bC?F?nB@v@?XA`BAlA?RAvACr@AXElA?@Ev@C`@Er@Gr@Er@Gl@Eh@AJC^Cd@En@AXGz@?@AJMtBCPG`AEh@Gn@Ef@Gx@Gz@IdAC\\Cf@Gp@IhAEp@Er@CXCXCZCZAXCXCXCZCXAXCX?DCRCXAXCXCXC\\CXAXCZCXCXCXAZGr@Et@Gr@CXC^?HCNEt@CRC`@CZAXCXCT?BCXAZCXCZAHANAXCXCZCXAZCXCXCXAXCXAZEl@A`@CZAX?XAXAXA\\?RAX?X?`@?Z?X?Z?X?Z@r@?@@t@@P?Z@X@Z@Z@XBX@ZBX@XBb@BXBXBX@RBXBL?JDXBVDZBXDZDVDXBXDX@DDRDVDXFXBR@DFVDXFXFV@BDRFXDVFXBHBNFVFVFXFVFVDXFXFV?@FTFZFVFVFXFVDXFVH^Lh@FZHZDRFVDVH`@H^Jb@FVFXFVFZDVLj@Pt@H^Jh@Np@Np@FXFVDVFXH`@@BDRFVFXDVHXDVFVFVBLBJFVDXFVFXFXFVFXFVFVFZFXDVFVPr@FXDVFVFZ@@DTDR@BFVBJ@JH\\FVFXLj@FZFVDP@DFXDVDL@JFVFXFVFX@FDPFVFVFXFXFX?BFRFZFVFXDTDP@FFXDR@FFRDXFVFVNp@Ln@FZFVFXFXLl@@@FXFXDVFXFXFVFVFVFZFVDVHZFXDTFXFXNp@FVDVFTFZFVFXFVFXFVDXLf@@HFXFVFXFVFVDXFVFXFXFVFXFXFVFXDXFVFXFVFXFXFVFXDVNp@FXHXLn@FVFXFVBJBLDVFXFVFXFVFXFXDVFVFXFVFVFVDXNp@Nn@FZFTFXFXDVNp@FT@FDPBNJ`@DVDN@HFVFXFT?BFVFVFX?BHXFXFX?BFTLp@BJBJFXFVDR@DFXDNLp@FVFXNp@Nn@?@Np@Np@F^FXDPFZDVLp@DXLr@DVDXDXDZDXBV?@Hr@F`@BXBVBZFl@BXBXFr@Dr@B`@@R@T?DBZ@V@`@@T@TBZBt@@X@X@X@XB\\@V@V?H@XBX@V@V@X@X@Z@XBX@X@PB|@BZ@XB~@@VDl@@Z@\\B\\@TBr@B^@T@Z@V@XBZ@X@X@R?DBX?J@P@^Bl@B`@@X@X@T@V@T@\\@XBZ@Z@Z@V@X@Z@XBX@\\@V@Z@Z@V@X@XBX@Z@^@Z@XBX@X@ZF`BB`@@X@XBl@@^BX@\\Bn@@Z@ZBXBp@?J@L@Z@V@X@Z@XB\\@XBr@@FBl@Bt@Br@Dv@Br@?@Bp@BX@X@X@Z@X@XBX@X@Z@ZB\\@V@Z@Z@J@d@@XBX@X@X@Z@X@XBX?NBd@?D@T@R?DBf@JpC@PJ~BJfCBd@@V@XBl@@X?D@ZBZBt@Br@Dt@@X@X@Z@XBZ@V@Z@X@ZDr@@\\@XBr@Dr@?BBp@Br@Dt@@R@^Bv@Dp@Bp@@V?D@Z@VBZ@Z@XBb@@RBp@@Z@X@X@XBXBt@Bt@BX?P@F@Z@XBr@Bh@Bd@@X@ZDr@Bt@@^Bl@@D@T@T?BBd@@f@Dr@Bv@Bb@?PDt@Br@@X@XDt@@Z@X?F@P@XBX@X@^@T@ZBZ@X@X@Z@V@ZBV@Z@Z@X@Z@T?@BZ@Z@V@Z@ZBX@X@Z@X@XBX@X@Z@X@ZBX@X@Z@X@V@ZBX@Z@Z@X@XBX@X@X@Z@Z@XBXDnA@X@X@J?LBZ@X@X@V@\\@XBt@?X@X?Z?X?X?X?Z?\\?XARA^?ZA\\ATAZAZCZAVCXAZCXCX?@CXCXCXCXEXCXEZEVEXEZEVEXEXEXEVGd@CNEVEXEXEXEVEZEXEXGZCTEXEXCNAHEVEXEXEXEXEVEXET?BEXEXEXEVEXEXEXEXEXCR?FEXCVCXE^APABCXAXCZCXAR?HCVAXAXAZAXAXAX?ZAX?Z?J?LAX?Z?t@?X?X?@?X?X?X?H?P?X?Z?V?b@@F?P?Z?N?H?X?Z?X?X?@?X?X?X?F?b@A^?T?Z?L?R?X?X?l@?z@?@?T?X?\\?X?X?V?\\?\\?X?V?V?\\?T?Z?\\?V?V?D?t@?p@?X?J@N?p@A\\?p@?b@?N?H@l@?Z@X?F?R@X@X@^@T@X@TBb@@TBZ@XBVB\\BVBVBXJz@DZBPDXBVFXF^BPDXDXHh@F`@DZDVDX?@DVBN@HF^Hl@DXDXFXDVBXLr@DVDXDXDXDXDXDXBN@HDVDXFXDVDXDX@DBRDXDVDXDXDXDXDVBL@JDXDXDXDXDVDXDXDXDXDXDXDXDVDb@DVBPBXD\\BVBXBXHr@Dr@Ft@Dt@Dr@@HBh@Dt@Br@Bt@@r@@t@?X@Z?f@?f@?^?X?r@?ZAr@Av@Al@AT?HAZAXAXAXAZCXAVAZCVCZARCXANEh@CVCZCXCTC\\EXCTGr@Ip@EXEZEXCXEVEZETEXAJCHEXEVEXEXGVEXEVGXEVEVG`@EVGXEXKj@E\\GXEXCNCFEXEXEVGXEXEVGXEVEXGVEXADCRGXEVERG^EVEXGXEVEXEV?@EXEXCXEXCXCX?@CVCZAXCX?FAPAZAXAXAZAR?^AZ?V?Z?Z?N@H?X?Z@X@X@X@Z@X@P@F@XBZBVBX@LBV@NDXBV@@BXDXDVDTF\\BPFXFVDXFVHXFVHXFTHVFVHVDLBHJV@BFPJ\\JTJTJV@DHNJTJT@BJPJRJTFHDFHPLTPXLRNRLRNRLPNRBDHJNP\\`@RRLNPP?@PNPPNNLLRPNLRRNNLJPNRRLJNPPNPNNNNNPPPNNNPNNNPPNNPNPPPNNNNNPP@?PPLLNNPNNPPNNPNPPNNPNPNPHJDDNPNPNPJNBBLPNPNRLRNRNRLPLRLPNRLRLRLRLTPXLRJPNVLRDFDHJRLRJTLTJTLRJTLTLXHRLVJTJTJTJVHTJTHVJTHTHTJVHRHVRj@Pf@@FJXNd@BDHXHVHVRj@J\\Ph@HTHVHVJ\\FPRl@DLDNHVFPJ\\HTFPHVHVHVBJDJHVFTHVJ\\HVHVTn@@BFRHVRn@Nf@JXHVHVHVDLFLLd@Nb@Nb@FRDNPd@HV?B@BRj@Zz@LX\\~@BDJTHVBBHPHTNX?@Td@JTJRLVJRLTJTLRBFFLLTLRJRLTLRLRLRLRLTNRLP@BJNNRLRNPLRNP?@NPLPNRNPLPNRHJBDNPNRLPNPLP|@jANPBDJLLN?@NPFJFFPTJLNRJNB@LPFJFFNPLRNPLP@@NPLPNRNRLNn@x@NRNRLPNPNRNPNRLNNRNTNPFHDD^f@^f@NPJLDDHLNPNRNPLRNPNPNRZb@b@h@VZPVRVFHRTNTLNPTNPLPLNNRLPPTPTf@n@@@NRLPNPRVZ`@FHX^\\b@NRZ`@NPNRHLBBNR^d@\\b@NPLPNRNPLRNPNRZd@NR\\f@h@x@v@rAf@|@f@`Ab@|@d@bAb@`AVn@Vj@Tf@Vp@Vl@l@rAHRd@jAJRHRJTJVJTJTHTJTJTLZTh@JXN\\P^JVJVHPJTJVJVXn@N`@P^Vl@Tj@Rf@LVJVJVJRJXHPJVLZTf@LXFPRd@N\\JTJTLZTj@Th@Rd@N\\LZRd@JVHPLXJVJTJVJVLVTh@Tj@b@dAd@dARf@Xp@l@xATf@Tj@NZ\\x@JVP`@`@bALXTj@N\\Pd@^dAb@nARp@Tr@Ld@Rp@Pp@VdAXlAVnALl@Jl@Lv@H`@Ff@Lt@Fd@Fb@Hr@Hv@NxALxALjBFpAFlADnA@p@@d@@Z@|A@lA?v@A`AAbAA`AC`ACt@Cd@Cj@AREr@QhCARKlAIx@Il@Ir@YtCMlAKx@Ir@It@MpAIr@MjAIt@W~BKdAE^Ip@MjAQbBIv@WfCIj@MnAMjAIx@MlAMdAIt@Ix@MhAK~@Ir@Gj@Gn@CXIt@E`@El@Gl@InAE^En@El@Gr@C\\CZCXIlAI`AK|AEb@Cf@KrAIfAGv@Gp@CXm@pIw@nKEd@IdAGbAKtAGt@Gz@Eb@G~@Ef@Cb@Gv@Eh@Ef@AVALCb@CXAXAXC\\AVAXCt@Af@Af@AZAr@?f@AbA?t@?t@?n@@bA@d@@b@Bj@@h@@d@Dr@@^Dr@Dp@B^Dn@B\\Dp@Ff@B^Fj@Ff@Ff@Fh@NjAF`@Hf@DVLr@F^RbADXFXFXPt@Lj@Pt@Nl@Nj@f@lBf@pBz@hDd@fB\\rATz@f@pBd@hB`@|AVfAXhAb@`BLn@Nl@^fBJf@H`@TpAL|@L~@NdAR`BJ|@NfBDr@HjAHnABt@Bv@Br@Br@@pABlA?\\?j@?\\?^AbA?vA?v@AnEAnF?V?hCApA?t@?dBA~@Al@At@EfBKbCE|@WvDUxBGl@k@nEGZKl@UtAYvASz@cBbIoAbGm@nCs@dDWjAIZOn@Mp@On@Ot@Mn@GXGZMl@GZGb@Ih@Kl@Kx@Gb@Gb@E\\Gd@Ed@CXCTE\\CVAXE\\C^AFC^?BEj@Ez@Ev@Cv@C~@C`AAp@Ab@Ab@?f@?`@?Z?dA?jA?pAAnA?r@?|E?nB?bG?lB?pA?dA?pC?L?tC?jD?`A?f@?xC?nD?xK?|J?tE?vE?hC?\\?R?tA@`C@hBAdCA`E?dBA`A@bDD`D@zDAh@ArDAdB?lAAvFAbB@tX?rL?lG?vA?|C?jD?dB?tE?nA?zD?jD?`E?zC?jC?nD?tD?dC?nA?pK?bA?dC?zE?fG?xE?fA?lA?nA?rA?hA?nA?nB?vB?xA?hB?fD?|A?vA?dB?~B?lA?d@?X@x@?p@@r@@r@@x@@d@D~@Bv@DhADp@Dz@B\\Fr@HdAHx@JnAFr@Fr@BZFv@Fn@D\\Fr@LtAH`AJrAH|@Hx@?BBRb@`FH|@PrBFv@LrAJnAJfAR|BLnBFz@DdADz@BbABr@?H@l@@~@?h@?^?|@?t@Ar@?TAp@An@Ch@Ab@Cl@?LI`BEfAIdBEr@EjAOdDEv@E|@KvBIdBC|@GlAIbB?JGjAGvAEx@APKjCAPGhAGtAK|B?HCj@IbBIbBC\\GfBI~A?JGhACt@GlAKnB?BUhFIvBI`BIvBAJUhFIrBIvAG`BWdGE|@E~@IfBGlAAZE|@GhAG|@Cj@Eb@Gt@Eb@U|BEd@Ir@Gb@c@jEMfA_@rDe@pEWbCYhC?D[rCQbBGb@Iv@E\\MrAALG`@MrAE`@CNUzBm@bG_@tDCVCRGl@E`@ObBK~@CXEXEf@AHIr@MrAAHK`ACRMbAMdAKp@K~@A@QbBK`AE^MlAAJE^ALK|@Ix@a@xDAHIz@Gj@OvAAFOxAAJK`AE`@CRE`@Iv@K|@ANOxAMdAIv@C\\A@Gl@AFGr@Gh@Gh@?@MpAK~@Gj@OxAc@hEQbBWdCWdCCNKfAMfAEf@OrAE^U~BMlAMnAQfBCPK|@Gh@Gl@It@Iz@ADK`AMhA?Bc@|DEh@UrBMdACTEd@UxBIn@CXE\\Gn@A@OvAIz@YhCCVMnAWtBI|@Gh@[|CAL]`DYjCE\\SlBKdAOvAMrAWbCGj@Q~AKhAWdCE\\CRIx@_@lDK~@K`AK`AMpA?@Il@QbB?BMhA[xCMjAIx@Q~AEb@MhA_@jDGt@SdBQfBE^OtAIr@K`AALAJGd@Gl@Gl@?@Gj@Gj@ADE^CXE\\CV?@CVEZCZCRCVCVGh@Gd@Gl@?@CPEf@E^E`@AFEZCZE`@E\\AJGn@E\\EVIt@E\\Kn@EXAJKj@G\\G`@?@Ov@Ml@Kf@GZI^IXERETENIVMf@GVWz@Md@ADGNEPM`@ELM\\Od@MZABKXIRSh@Ul@Wn@KRKXKRIREHS`@MXGLMVOXGLYf@Q\\KRGJ_@n@GH_@l@SZYb@EF_@h@?@W^A?MRIJUX[b@a@f@IJUXEDSVSVEDuAdBKLWZw@bAUVY^GFIL[`@_@b@g@n@c@j@IHe@l@u@~@QT]`@A@w@`AQTk@r@QR[`@i@p@ORc@h@GHY\\w@bASXMNEFGHMP_@h@SVILORYb@CBMR]d@CDOTSZKN[d@CFU\\EF[h@IJWb@s@lACFWb@c@v@GJ_@r@]p@CB]p@Yh@s@zAq@rAWh@y@dB]t@Wf@[p@Wh@c@|@OXOZCFSb@CFOZUb@Uh@KRGJc@~@O\\IN_@x@GLc@|@CFk@jAA@Uf@Yj@CHGLMVKPMXMXGLMVKRKV?@KRSf@Q`@EJM\\Sh@KXITENKZ[~@IZKZMh@IZMd@Ol@AHK`@ETI\\Kl@I`@Kl@M|@A?Kt@E\\E\\ADIn@E^ALEb@IdAANCRG|@C`@Ct@Cp@Cd@Cv@?VA^?JAV?R?b@AP?P?H?^?F?j@@f@?X@Z?R@N@f@Bt@?LB^Bn@BZ@LFdA@HBb@BZBVHz@NtADb@J|@DVHx@LhADVDb@NtALhANlAB\\NnALhA@NJ|@DVDd@DZXlCFb@Fj@XhCh@`FLlATpBJ|@ZtCNtALjAHr@VbCHl@Db@^jDBJP~ABX@LBJ?FDZDd@ZnCTvBRhBD\\RdBDb@F`@@P@FHr@BND^Hz@Ht@NpAFj@Fh@Fj@DZ@LDZ@PFb@?D@JL`A@FBZD^J~@Jx@DXD^Fl@D`@DZHx@Jx@Fh@LlA\\`DNpATpB?FJ`AJt@X`CRbBFd@JfAZ~C?@PbCFz@Dn@@PBr@@TD|AB`@DhA?LFjADjA@`@B^DvA@t@B|ADjB@~@?`@?x@@j@?\\?j@?p@?J?B?B?\\?d@?J?F?B?f@?\\?b@?D?~A?\\?r@?X?\\?X?r@?h@?hA?n@?^?\\?dA?hA?jA?fA?dD?\\?d@?^?\\?p@?lA?Z?\\?l@?b@Ap@@v@Ap@@t@A~A?dA?T?f@?h@?zA?l@?\\?dC?lA?xA?v@?~@?p@AjD?`D?vA?l@?dB?hA?z@?v@?jA?nA?fA?fD?tBA|I?T?vA?fB?h@?rH?xE?jB?zB?tD?pB?~C?nAAfC?rA?dC?jB?p@?r@?hC?fB?t@?T?B?dG?x@?hA?fDA~D?tB?vC?jG?hE?z@?lH?vB?pC?n@?bE?T?nA?FAjE?z@?bF?zA?rA?nA?xC?bB?r@?J?jBAzM?dE?jE?b@?rBAbG?vF?p@?vB?`BAhB?r@?v@?p@AT?\\A`@?TAXAXAZAt@Et@Cr@Ch@KlBA`@Cn@C^?ZAXAXAt@Ah@Ab@?ZAt@?t@?t@?t@?t@@X?Z@X?X@Z?X@X@Z@X@X@Z@X@X@Z@XBX@X@ZDr@B\\@V@X@X@Z@X?Z@X@t@@bA@dA?n@?r@?x@?zIAtE?nD?zC?p@?`@?nC?F?hC?tB?dC?J?dA?j@?dC?l@?fBAtC?dA?@?jB?nA?t@?r@?dA?Z?h@?bA?p@?xA?`A?nE?zC?pD?j@?`@AnH?fB?fDBzJ?p@@dDAjBAv@Av@?BAdB?tB?~A@rAAX?xC?~D?tI?n[Ab^Ah~@?nGAjl@A|q@Adl@?`k@Ad~@?va@?n[?|M?z@?nD?j@?j@?hEAz@?v@?vB?zC?^?`A?R?d@?Z?~B?b@?|C?nA?V?n@?x@?|A?j@?\\?rD?bC?x@?`J?z@?xA?V?`B?dD?zA?f@?\\?L?@?h@?zD?rE?nA?nA?X?r@?`A?P?Z?pA?jA?Z?tI?tE?~H?D?fA?hH?lAAlB@TAZ?\\?Z?V?ZCpA?\\?DAP?VA^ATAZAXAXAXCVAXCZEp@AZCT?BCXCZCVCXCXCTCVCZIr@EXIp@EX?@EVCVEVG\\Il@GZETEVGVEZGTGXEVIZGVEVGVGVQp@CHCLGTIVCLCJGRCFEPIV[bACHOf@Oj@IVCFi@jBa@nACJSp@e@|ASr@[bAm@tBgB`GIVc@|ASl@Ql@IViAzDe@zA{BtHGTKZQl@YbAe@~A]dAYbAIXGTKX[fAQn@}CjKOb@Oh@k@nB}AjF]hAK\\o@tBW~@[`AQn@K\\c@xAq@zBs@`CgAtDq@zBq@zBo@zBA?a@vAQn@Sp@{@pC?BM^IZM^a@rAc@|ASn@Ql@Od@K\\K\\ENIVOh@ABI\\GTOh@?@IZIVGXGVMh@I^ETMl@G\\GXEVG^ERETETEZEVKr@EXCRCPE`@E\\EZE^Gj@ANC`@CVCTCZCXCd@ALCV?JEh@E~@Cp@ANATAj@C|@CtA?RAh@?nB?n@?r@AdA?hA?FAZ?dA?f@?V?\\?Z?r@?\\?^@p@?\\?V?Z@Z?r@?Z@|A?`B?Z@xB?|@?v@?X?Z?r@?Z?X?Z?\\?T?Z?X?x@@p@?\\?V?t@?Z?p@?\\?`@?fA?Z?p@?Z?Z?t@?X?~@@D?l@?J?~@?Z?bC?hC?N?fB@rD?t@?zG?t@?rB?xA@jA?@AV?@@zC?rD@~B?zC?zC?|C@pD?bG?tH?zC@nA?L?|@?rA?dA?bG@hF?~C?j@?vD@vB?f@?dK@tE?pC?|A?X?nB?|@?fB?x@?hA@rA?v@?V?\\?dA@xA?R?jA?t@?x@?p@?J?^?`C?~B@lD?r@?pA@~S@fJ?pA?jA?vD?fB@nA?t@?T?pA?bC?bB?X?r@?N@hC?hB?pA?zC?n@?`@?tD@rE?nF@~A?|@?l@?bD?jB?vF?tA@|@?\\?jC?hF@jC?`A?dD?|@@v@?r@?pA?j@?j@?bA?l@?lB?f@?f@@lA@hC?F@tC?v@?r@@r@?pA?lA?n@AxG?T?L?@?dB?bD?zB?|@?bC?nA?vA?bB?nB?Z?r@?p@?hB?fC?r@?nC@dBAzC?\\?dD?hA?pA?jB?nA?X?L?L?p@@v@?v@?V?T?v@?B?r@?Z?V?\\?X?r@?bF?vC?jA?nA?p@?\\@lB@jA?z@@~B?rA@rA?j@?R@dB?h@@`C?N?|@@tA?h@?`@?L?rA@v@@pCBpG@`D@dE@fB@`C@tH@jC@jB@xE@nB@bCBfH@hB?pATjw@Pxh@HzVBdJ@hC@pD@hB@lG?`B@zE?pE@~K@fG@pBAD?x@?HFb\\?rD?P?nB?xB@dD?jA?j@@bC?bC@nD@|I?@?zA@~E?@@pK?fE@nC?nB@fI?bABnOBbZ@lA?xB?l@?nA?N?nA@n@?zA?`CAbFAbB?l@?XCpJ?H?fBAlFAJ?j@AjEA|GA~C?v@EvSAjECzF?v@?vAAlB?`BAbB?lAA`B?pAA|A@dCBjBFhAF`AHz@Df@Hr@L~@TlAX|A\\rA^lAX|@Nb@b@dAN^x@~AR^Zh@f@v@b@n@Xb@V^\\f@zA|BlEpGlAhBV^DFPVn@~@x@hA`@t@fA`BxAvBx@jAr@fAj@x@Xb@X`@l@~@NRf@r@b@n@|CvEf@t@bAxAp@bAZf@X^\\f@r@fApAlBvAtB`AzAr@bA^j@^h@p@dAj@bAf@fA^z@Tj@\\bAX|@ZlAVdAX|AXfBPnBJlAFrABrA@z@?X@V?Z?V?^?dFAhF?nB?hF?zK?fHAfG?pE?dH?pC?dK?vD?tDAvD?zC?fB?pE?nA?zD?pC?hFAnA?t@?`C?tEAtB?bC?vAA~I?xE?x@?@Az@?dF?t@?v@?nA@`BBvAFvB@b@Dr@@V@LBh@NpB@TNjBDb@Db@@LDh@X|C?F@RBh@JtAFl@HtAD`@ZhEVvDZlEHnANrBV`DB^Fx@@P@FF|@Fz@@HHjADj@Db@RhCDj@Bd@P|BL|AJzARlCP`CTrCZfEF~@LhBLdBLvANvBLrADb@Hh@DZPhALl@P~@FPDTHZPl@Nj@Rl@@@Pd@HXJVJTZt@Zn@d@|@b@v@j@|@b@l@b@h@VZTZx@bAv@`An@x@b@j@~ApBz@bAlA~Av@bAxAhBjAxAJNLNLNJLRVlAzAtBjCh@r@JJPTTXVZZ`@?@JJJP@?Z`@hAtAvAjBLNHHLRPTTZNT\\j@RZJTf@~@@?HP\\t@Rd@DJVr@Tp@JZL^l@zB^nBLx@PrALlAFl@Dp@FrABbA@p@?`@@x@BrB?hA@nA?t@A^?TB`BAdCCdE?jA@~D@|@?L?R?`A?d@?jA?d@?rB?b@?T?N?|D?Z?\\?@?x@?nC?rA?B?j@?j@?bC?h@?l@ArAAzA?DC|CCrAEbFAv@A|AAxA?nA?xE?z@?hA?r@?z@?r@?x@?fAAjAB~C?bA?~@?j@?j@?h@?l@?T?|@?B?X?N?d@?r@@lB?pB?j@?zP?rD?pB@|A?zC@p@?fA?zB?vG@`B?zBAbD?^@tD?zB?|G@nD?j@?n@?hD?D?bC?d@?vA@fG?tAAj@?j@?j@?j@?jB?b@?p@@dB?zC?j@?D?|B?`B@nB?|@@tC?tA?`D?dD?h@?l@@bD?hEArI?|B?R?j@?j@?x@?rB?lC?hA?`@?b@?b@?b@?P@xABpC?b@@`@?bC?@?@?h@?zA?dC?`E?x@?\\?R?B?~A?b@?pB?d@AdD?rBB`CAjD?h@?p@?zI?xB?f@?xB@lL?N?lA@bCAb@?D?tA?R?T?x@?|@?X?D?@?b@@x@Ab@?V@dD@n@?h@BxA@zA@zABbD?Z@lB?Z?@?l@?b@?n@?rB@z@?|B?`AAZ?R@rC?bC?nD?pB?fB?N?vA?zF?j@?R?X?dA?~ACxEAdBEhAE\\Gv@K~Aa@dGEd@QbCATATALC\\Gv@O`CEl@ANAXALA\\AHAl@A`@AhA?d@?r@AdD?|@?hF?\\?h@@r@?dC?p@?N?h@?^?\\?Z?L?`C?l@?`@?nA?t@?dA@Z?p@?^?D?H?L@rAAbE?Z@p@?P?H?J@N?\\?BBlA?RDxBB|@@h@ZjKBn@@PRzGZxIB|@@h@@Z@\\B|@Bn@@h@NtEB~@LbDB~@BhB@x@@v@Bb@@hB?L@jC?X?^?|B?V?j@@X?pB?D?tB?`A?b@?R?h@?^?`@?~D?`@?Z?JAp@@L?dD?dC?j@?hC?d@?Z?L?j@?pB?P?R?R?B?L?zC?p@?x@?N?`@?t@Al@AR?PALAP?NAFCb@AJQdCEf@CVI~@k@vHE\\ALAJC`@Ef@c@nFEl@Gr@Gr@Ef@C\\I`AUlCATCTAJC`@YdDEj@?@AVAL?@?@Gp@Ev@IjAIrA?@ARCVItA]jFCn@AD?@ANC^GdAMrBG|@Ep@?BCXEh@?FK`BAPEl@Ej@ATAVE`@Et@O|B?HALIjAEt@CPC^M`BCZK~AAREn@KrAGfAGlACtACf@Av@AZ?F?NAl@?TAV?l@?|@AtF?nA?pA@bIAzA?rA?B?L?pC?V?`F?~B?j@?h@?vA?\\?`@?h@@xB?nA?r@?jA@zA@j@?@?J@D@d@Bb@Bl@Dh@@P@BBVBZDb@BJHp@BNb@vB?@Jb@Pl@Tr@DJDNJVN^Rh@Vf@d@bADFZp@p@rA\\n@LVLXn@nATd@Td@bApBJVFLJTL\\HVJVJXPn@Rt@VnAF\\Jp@JbAB`@Fp@Bl@BnA?v@@j@?f@?b@A\\?j@?DAvA?~@@~AAZ?rB?xA?T?V?l@?RAzB?pA?fC?tA?vAAbC?hA?L?z@Ad@?N?B?V?^?^?F?V?j@?v@?r@Ad@?B?V?L?L?l@@`A?@?^?f@?T?P?hA?tA@|@@|@DnA@b@Dx@@PFfBL~CBj@@LHrB@j@FbA?@?FDt@@d@@B?NHhBHrBBv@Dr@?PDt@FfB@RBr@Bj@Bl@F|A@J?BHlB?L@H@b@Dn@DpA@L@\\@LN|D?NFjA?H?B?@HpADpA@PBd@@l@@F@VF|@F~@?FD`@Df@D`@H`AFb@@J@FFl@Fb@BN@FBZN`AFb@@DNz@FZHb@FXDVLj@H`@Jd@^`B^xA@HNh@b@dBNj@@Dd@hBJb@Pn@d@hBRz@`@xADRTbADPVfA@HP|@BFX|ADZRpAN~@BTDZHj@@HD^BRJbADf@@FDf@Fv@B\\Dh@?LB\\@V@H?FFjABn@@X?VBz@@|@@l@?p@@n@?tAAl@?`@AtAAhBAb@?f@?BA^AzAA`BCbBAjBAJ?h@A`A?VCzCAtAA`AC|D?BCxBCfC?HA\\?VAn@CtA?JE`B?j@AnBApAAdAANAhB?d@?f@AhDCrAAR?^?z@?|@?BAh@Ah@Ap@?t@?DAl@ALC|CAvBAvACnBA|@EfGAz@?v@CtB?FCnDAxBA`AArAATMjQClFE~D?h@CnDAj@?@CtAGrH?LA~A?@?TAd@A`A?@?ZAzBCzB?L?B?@Ab@AlCAbAAtA?@AxAChB?z@AB?DElH?\\?TAnAAPAxAA|AChB?\\?XAh@Av@?L?t@A`B?`A?t@?b@?F?B@~@@tA?N@z@@RBx@Bf@@PBt@Dt@@T@Z@`@H~AJlCLnCHdBFpAFfBLvCBl@?R@Z@Z?X@Z?r@?v@Ar@ADAj@AZA\\CRARCf@ARC\\CVE`@Ij@E\\Gf@GX?DGXEXGVEVOn@CJCLGVIZIVGVIRSl@_@lAMZADQd@Sl@Oj@q@lCO~@I`@_@xBK`@SpCEn@AXCj@AFAt@AXAZ?V?ZAZ?X?X?ZAX?X?X?\\A^?X?X?XAv@?XAXApA?X?ZAp@AlBErEAnAQbXAX?t@CjBAnA?XAnAEjG?TEzEAl@EvFAnACzDAhBApAGhG?t@EnEGpH?t@Af@?z@Az@Al@?p@AXAdBAxBEdD?ZEzEAdBA\\EzECdCAvACzE?^?TAXApA?X?XAp@?B?ZAz@?d@ARCtC?r@C`DAjA?H?`@Ah@?|@AdAAdA?x@CdDAX?ZAr@AnA?n@EjD?n@AZ?J?n@Al@Av@?r@AX?t@AX?Z?NA`AAr@?\\Ah@?b@?TA\\?P?b@?XAX?Z?Z?XAX?X?ZAr@?ZAx@?Z?X?ZAZ?X?XAZ?X?ZAX?X?Z?XAZ?X?ZAX?X?ZAX?X?XAZ?Z?XAX?Z?XAZ?X?XAX?Z?ZAX?X?XAZ?X?Z?XAV?\\?XAZ?X?VA\\?X?ZAX?Z?XAZ?ZAV?X?X?VAZ?Z?Z?XAX?T?\\At@?ZAX?V?\\AV?Z?T?\\AT?`@AV?Z?TAt@AfCClB?t@AXEhG?XEpFAr@?nAAt@K~MCzDAR?^AjA?r@ExD?^AbBA\\?n@Av@EtF?X?ZAhBCjBExHAtAG`IAnAEpE?\\?PAt@?F?b@At@Av@?t@C|A?d@?f@AB?p@?TCvB?v@A^AvAAv@AlB?H?j@Av@Ar@AnBAp@?\\?^AH?B?^Ab@E|GCvD?R?HAlAA`BAz@?`@?RAvAEtD?jACbCEzF?HGvJAp@A|CAhAAD?lAAZ?\\AxAAzAA\\?|@CnBAxCAt@AzAAbA?f@A`AAfBAt@?v@AbAAbAAjA?v@Av@ARAjCAt@An@Av@?t@CjBAfBAhB?fAAlA?FAj@?f@A`@?fAAt@Ax@?x@?X?@Aj@At@?r@Ar@At@AnA?pAAdAAz@KjO?RA`@AbBAtCAf@?@An@@DA~@At@?j@A\\?LA~@AbAAj@AJAh@Cl@GvAEh@Cd@Er@CXEd@Gl@MfAIt@In@ADCRCRIb@Kp@Mr@WlAERMp@Qr@Op@Or@_@~ASz@CJOr@EVGVCNCJETGZQbAeAzGCNObAu@bFERAF]|Bc@tCMx@SnA_@fCG\\_AlGg@bD{@vFi@hDy@vFGZ{AxJi@pDG^SrAIf@m@xDWdBIh@AFe@~Ck@rDi@nDSlAQdAQjA[vBIn@M~@Mr@EZi@|CIh@Mx@]tB[pBq@rEOfAW`BKp@M|@SpACTQlAWdBYfBO~@O|@_@`Cc@rC_@bC]|BoBhMStA{BdO{A|JYhBgDxT]zBYfBeA|G_@bCq@jE_@`C_Ldu@a@hCe@vCU|AM~@Kr@Kl@CXEZG`@CZKbAMnAGv@Gv@G`AG`ACj@Cb@EjAA^An@CvAAzCA|@EfHA`BAn@?BCjC?l@At@CvCArAAdCCbC?l@Al@C`C?@?p@CtCA~@AnAE~F?b@MlQAbCAtBCtB?XChCAfCA`@?RC`FGrH?Z?RAD?d@?J?T?z@?n@?R?f@BnA@t@@l@?DHdCDfBB~@?LBt@@Z@V?V@l@@h@?^?B@j@?d@?h@AnA?n@?FAlAAlAArAAjACvEAfBAlA?RCxB?t@AdAAfAAhCC|BAzAAnA?`AAt@?NAfAAj@A|BA`A?HC`DExGClDAbCAr@?t@ChBAbCA`AAdAAn@C|@?PEz@Cp@Cr@Ch@Cb@?@KfBCt@C\\Cl@Cv@ClAClAEtEEbFApCChBAvA?p@?v@AdCAtAAlA?bAA^Az@ChAAzACrBAvAEbFAjBAtAAlAArAC~CCxD?|@AfACdCAfA?r@ArAAt@AvAAx@AtCCdDElFC~FAx@E|FCfFGjIClEAhB?p@CjFElEAhAEdBSzEMtBKnAKtAMlA[nCIp@UnBK|@QhBWvBa@|Dc@vDCXCN?D{@rH}@hIW~B_@jDoBxQ{AjNmCnVcBvOkAvKoAzKc@zDOtAYdCGl@wCfXgA`KGh@mC`W{@zHE`@aEb_@Gj@Q~AwBxRGh@_AvIWvBe@nEa@tDg@pEa@tDW`CShBW`CYbCW`CW`COnAMlASdBSjBMlAMjAOnAW`CMlAIr@It@It@g@lEMnAIr@MhA]`DOlAW`CW`CWbCOlAMjAMnAY`Co@dGSfBGf@W~BANIp@SdBGh@w@jHCNALo@fGe@bEAJQbBShBEZ]xCSnBe@dEAPAB]dDMjAg@pEM`A?JShBgB`PuC~WGh@yCxXyClXwBbSaFpd@Gh@_BbOo@xFMdAMpAuBtRIj@e@rEIj@CV{Hrs@ePpzAi@zEg@jEGt@CROjAc@dESfBE^QbBE`@Gj@EVK`AMbBInAGlAABEjACVAp@EhAAdAAv@AdA?pA?rA@dABdAB~@Bv@Br@Dv@FnAHlALxAPtBJrADZ\\jE\\xDJfA`AzK`@rE\\|D~@|K@PN`Bh@fGRtBNlBVvCJhANlCHnAD`ABx@Bx@@b@?RBhC@fA?j@?HAj@?\\Az@Ar@A`AEbAAl@A?Al@Ch@CXIrAC`@El@CXC`@AHEf@Gf@Gp@Gh@Kx@MbAId@?DADEXKp@QfAKd@Mt@S|@ERERYlAWdAWbAIVSr@?@KXMd@ITIVSl@Qf@Qf@w@tBe@fA]x@e@dAk@nAmApCABuBxEq@|Ao@xAg@hASb@O\\c@`AeDrH]v@KRCHs@~A_AtB_@z@_AtBYn@IPe@dAq@zAMZc@`AaArBo@tAcA|Bg@fAKT_@|@mAtC_A|Bi@jAu@bB[t@Uf@_@z@e@fA]x@Yx@Wr@Ul@CHIVM\\Sp@Of@Mb@W`A[lAUbAWfAOx@Mr@Mp@Mr@Ib@M|@OfAQvAIt@CZEZQ`BK|@YdCK~@W`C_@hDUpBCPe@jEAPMhAc@|D]~COrAc@|DYfC_ArIy@lHE^UzBOnAEZCTALCNANy@jHcAjJ_@pDm@jFa@tD_ArIQ~AwAlMK`AShBoAdLCXIx@S~A]dDUpBKbAM`AIz@MjA]zCk@hFShB_@hDCXGd@Gt@Eh@M~AIfACTAL?HOdBEj@WbDQvBQ|BOdBMbBOlBKvAM|AKrAMrAGr@KbAMfAGd@EZIh@M~@EV[dBQ`Au@bES`AIf@Ox@Mn@Ij@SnAM|@It@MlASfBa@rDIh@Eb@CXE`@Ir@Il@_@hDa@xDo@`GiA`KyEdc@UtBmBdQCPOnAI|@OrAIr@EZCZa@pDEVGr@UjBk@fFEb@_@lD]xCW|BIr@Ef@M`ACXEVIt@CXCXEXAF?FAHEXMnAEVCZE\\CVOlAIp@C\\EVIr@CXCXEZIr@Ir@MlAE\\In@ARGb@Ir@QfBOjAE\\?@CVIt@W~BOlAIt@CXCXEXIt@CXIp@EZCVm@nFCXMjAg@pEOlACZCVEZK`ACLIt@Ir@CXIt@Kx@APEXCTE\\It@K~@{@zHE`@YhCCZIp@?@E^MdAGd@OtAOvAEXGr@CLGf@Gp@K~@Gh@Gj@AHEXCXK`AEVALC\\CTE^Ej@Ev@C\\CZAVGz@APAZAZCh@?RGzBA\\AXAd@Cl@AVCt@CZAVAXCZGn@Gr@C^CZANGh@APGf@Ef@In@Kt@EZKp@EZEXGXEVEXEPIh@EPGXEVGXGVOp@IZOp@Or@Mj@Or@ADETGZGTE\\GZQdAIh@M~@EVAJAJKt@E\\CVEZANUrBCVAFCPCVEZGn@CPQ|AIr@K~@ALShBIr@It@WbCKp@MnAWbCIr@EZQbBKx@g@pEEh@G`@CXIr@E\\SfBIr@CXIr@Ir@EZARE\\It@q@bGWbCOlAEf@Gh@CZOvAG|@I|@MxAG`ACZCj@Et@InAGtAC\\Ct@Cr@A^Cl@Cz@CdACd@At@AVAr@Av@?VAZ?Z?v@AX?Z?X?t@?t@?v@?p@@v@?|@@l@@lA@v@@tA@n@BfCDrEBlD@j@@t@?XFnGDnF@x@BlB?T?TBtA?t@HvH?BF`G?f@FrG@X?Z@r@B`DBhCD~D?V@XDtFDxDDpF@j@BtB@hB@ZBfCFfHDfFFdF@hBFnF@jBDxD?^BhBJnL@nABlBBbCBjB@lCBjBBjB@jBl@np@BfC@v@?t@BlBJfL@^?VBnA?~@NvN?r@BpA?t@FlE?b@?v@DhD?TBx@?fABnA@n@@^Bx@@ZB\\Bp@JfBDv@Fr@Ft@H|@P~AHr@Jt@NhARpANx@X~A`@|BTvALv@L|@TzANzALrANdBN|BDt@FdBDjA?ZBdA@r@?PBhBB`E@b@@r@?l@?L@R?^@f@@z@?`@@t@@lA@v@@nA@tABfB@x@@|ABrC@l@@pBBhB@hA@f@@pA?V@ZFbG?RBhC@~A?X@Z?X@X?\\@r@?Z@X?Z?X@Z?X@X?Z?Z@X?Z@t@?X@Z?X@pA@X?Z@X?Z?X@Z?X@Z?X?Z@X?Z@T?^?Z@nA?X@Z?X?Z?Z?XAX?Z?XAZ?XAZ?XAZAXAZAXAXAZAXAZCXAXCZAXCXCZCXAXCZCXCXEXCZCXEXCXEXCXEXEZEXCXEXEXCXEXEXCXEZEXCXEXCXCZEXCXCXCZCXCXAXCZCXCZAXAXCZAXAXAZAZAXAXAZ?XAZAZ?XAX?pA?Z?X?Z?X?Z?X@Z?X@Z?X?^@V@fBBfB@hBHlHBtC?J?X@Z?X@Z?Z?V@\\?X?X@X?\\@Z?X?X@X?Z@Z?X?Z@X?X@Z?Z?X@Z?X@Z?Z?V@Z?X?XBjB?Z@X?Z@Z?X?Z@X?X?Z@X?Z@X?P?H?X@Z?X@b@?R?V@Z?\\@V?Z?Z@X?Z?X@X@t@?X?Z@X?Z@X?Z?X@Z?Z@X?V?\\@Z?X?Z@X?Z@X?Z?X@X?Z@X?Z?X@Z?X@Z?Z?X@Z?X@t@?X@Z?X?Z@X?Z@X?Z?Z@X?Z?X@X?Z@X?Z?X@Z?X@Z?Z?X@Z?X@X?Z?Z@Z?V@b@?R?X@X?Z?X@Z?X@Z?X?Z@X?Z@X?Z?X@Z?X@\\?V?Z@X?Z?X@Z?Z@^?R?X@Z?^@X?V?X@X?Z?Z@Z?Z@j@RhT@jB@nA@Z?X@Z?X?Z@X?Z?X@Z?X@Z?t@@X?Z?X@Z?X@Z?X?Z@Z?X@X?Z@T?\\@Z@X?Z@X@Z@X@Z@X@Z@X@Z@X@Z@X@XBZ@X@ZBX@Z@XBX@XBZ@ZDp@Dj@?@@NBXBZBXFt@BZBVBZBXBXBXBZDXBZBVBXDZBXDXDZBXBXDXDXBXDXDXDVBP@HBXDXDXDXDXFXDXDZDVDXFXJt@DVFVDXFXBRFXFVDXFXFXDXFVFVFZFVFXFXFVDTFXHZFVDP@FFVHXFVFXHVFXFVHXDRJZFX?@FTHXFVFVHXFVHXFVFVHXDPBJLf@HZ~AlG@B\\tAVfAf@pBLf@V~@BLXfADLT~@Nj@Jb@FVXfAZnAHZNn@nA`FPp@Lf@Lf@Lh@Tx@H\\FVFPFV@DfAjEj@|Bb@hBZlA~AlGFTLf@Ld@Lf@Rt@FZ\\nAXlA\\rAp@lC\\pAFXHZNl@x@`D\\tAXhAXhAZjAFVPp@XfAXjABFBNHXFX^vADPT~@z@dDFTDRHXBHBHDPHZHZFVFXHVFVHXFVHVHXHVHVHVHVHVHVJVHTHVJVHVHVJVHVHTHVJVHVHTJVHVHVJVHVHTJXHTHVJVHVHVJTHVHVJVHVHVJTHVHVJVHVHVFLBJJVHVHTHVHTVr@HVJVHTHVJVHVHTHVJVHVHVJTHVHVJVHVHTHVJVHTHVJVHVHTJVHTHVJXHTHVHTHTJXHVHTJVHTHVFR@BJVHVHTJVHVHVHVHVHTFPJ^HVHVHVFVHVFTFVHXFXHXFVFVFXFVFX?@FTDXFVFXDXDTFXFZDXDV?@DVDXFZBVDZDVDXDZBVBT?DDXBXDXBXBXBXBXBZBX@N@HBXBX@VBVB\\BXBZBVFt@BZ?@@VBXBX@XBZBX@ZBX@XBX@X@XBZ@Z@XBX@Z@X@X@Z@Z@X@Z@X@X@Z@X@X@X@ZB\\Dp@@RB`@BXBZBXBXDXBXDXBXDXDVBV@@DXDXDVDTFXDTNv@DVFXFVBPH`@DVFXDVFZDVBHBNDRH^Lp@DXH`@Jj@H\\P~@H`@DXBHP`AFXBRNv@FXFXDXFVDVFXFXDVFXDVFXDVFXFXDXFVFXDXFV?BDTFXFVDXFZDTFVFXDZFXDTFXFVDXFXDRNv@F\\DTDTFZFVDXFVLr@FXDVBNBHDXFVFXDX@BDRFXDXFXDVFVFXDVFXDXFVRhAFZRnADXDXDXBXBXDVBXBZDr@BZ@X@XHhB@Z@X@Z@XBX@Z@X@X@X@\\BV@Z@X@X@Z@X@X@XBZ@X@X@Z@\\@TB`@HzBL`DPpEHjBDnAHjBBr@Bt@Dv@Bp@Bt@Dv@DlABr@Dr@B~@Bj@FnADnAFpADnABr@BZ@X@Z@V?@BX@XBXBZBXBX@N@JDXBXDXDXDXDXFXBP@DFXDVFXFXFVFXHVFVHVFXFVHVFVHXFVFXHTFXHVFXHVFVFVHXFVHVFXHVFXHVFT?@HXBJ@DFXJ\\FVHVFVHVFXDPBDFVFXHVFVFVHVFXFVHVDN@FHXFVHVH\\Pp@Jb@J\\HZNl@DPJ\\Pr@Pn@FVPp@Nn@HZPl@Pr@XhAXfAb@`BPp@XfAHXNn@Pl@Pt@Pn@H\\@HT~@V`AHXPr@XjAPn@DLDHNl@ZhAvArFPr@Pn@DNRv@Np@Pn@FTPr@Pn@XhAZhAXhAPp@Nl@Pp@Pp@Pn@DPJ^Pp@Nn@Rp@XhAb@`BXhAXfAj@zBNj@J^Nl@b@bBXfAZjA`@~Ab@bBb@~AXjAb@`BXfAXjAXfAXhAZfAb@bBXfAXhAb@bBPn@Nn@Pp@Pp@FVPn@ZhAFVPp@Pp@Pp@Nn@DLz@hDjFnS`@|Ar@pCb@`Bz@hDj@xBt@pCDRfAfEr@pCt@pCJ`@ZnARv@Pp@Pn@Pn@Pp@Nn@HVNp@Pn@Pp@Pn@FRHZNn@Pp@Pn@Pp@FVNn@Pp@Np@Nn@Lr@Ln@Lp@Lr@PhALr@Jp@FXBPF`@VdBRhA?@d@vCBLJr@ZpBLt@Jn@b@pCD\\^|BDRFb@DRZtB`@hCVzAZrB`@fCt@|Ef@|Cb@rC`AhGrAlIt@vEh@lD~@bGRjA|AzJ^dCp@hEV|AZrBBJxAlJhAhHrBlMBV@BBTFVDXDXDXDXDVFXDXDXDV@JBNFXDVBN@FDXDXDVDXFZDVDZDTDXDXFXDVDXDXDXDXFVDXDXDVDXDXFXDVDXDXDXDVFZDVDXDXDVDXFXDVDXDXDXDVDXFXDXDXDXDVFXDXDVDXDXDXDXFVDXJp@DXDXFXDVDXDXFXDVFXFVFVFXFVFVHVHVFVHVHTJVHVHTJVHVHVHTJVHVHTHVJVHTHVHVJTHVHVJVHTHVHTHVJVHVHTJVHVHTJVHVHTRl@JVHVHTJVHVHVHTJVHTHVJVHVHTJVHTHVHVJTHVHVHTJVHVHTHVJVHTHVJVHTHVHVJVHTHVJVHTHVHVJVHTHVJTHVHVHTFNBFHVHTHVJTDLL`@JVHTHVJVHVHTHVJTHVHVHTFLVt@JV^dAHVRl@Tn@HTJVRn@HTHT`@fADLXv@Rl@Tn@Tn@HVL^Rj@Z|@^bA\\dALX\\bADLL^HTJXRl@\\~@`@jAHTHVJVTn@FRTn@Tl@h@|ARl@Tn@\\bAJXh@xATn@Rj@JXh@zARn@HVJTHTHVJVRl@Tl@HVRl@JVHVTl@HV^dAHTRn@JVHVJVHTHTHVTl@HV^dARl@JXHTRl@Tn@h@zARh@DNHTj@|AHVHVHT^dAJVRl@HVJV^dA\\dAJTRl@HVJVf@|AHVHVHVHXPn@HVFVPn@Np@b@bBPp@FTHZFXHVFVFVHVFXFVFVHVFXHVFXFVHVFVXjAFTHXFXHVFXHVFXHXFVHZFVHVFXFXHVHXFXHXFVHXFVFVFXHVFVHVFXFVHVFVFVFVHXFTFXHVFVFVHXFVFXHVFVFVHVFXFVHXFTFXHVFVFXHVFXFVHTFXFVHVFXFVHVFXHXFTFXHVFVFVHXFVFVHVFXFVHXFTFXHVFVFXHTFXHXFVFXHVFXHVFXFTHXFXHXFVHXFVFVHXFVFVHXFVHXFXHXFVHVFXFVHVFXHXFVDPBFDT@@FVHXFVFVHXFVFVHXFVHXFVFVHXFVHXFVHXFVFVHVFXFVHVFVFXHVFVFVFVHVFXFVHVFXFVHVFVFVHXFVHXFVFVHVFVFVHXFVFXHVFVHXFVFVFVHVFXHVFXFVFVHVFV?@HXFTFVHXFVFVHXFVFVHVFXHVFVFXHVFXFVHVFVFVHVFXFVHVFXFVHVFVFTFXHVFXFVHVFXFVHVFXFVHVFVHXFVFVHVFXFVHXFTFXHVFVFXHVFVFVHXFVFVHXFVFVHVFXFVHVFVFXHVFVHVFXFVHVFXFVHVFVFXHVFVFVHXFVFVHVFXHVFVFXHVFVFVHXFVFVHVFXFVHVFVFVHVFVFXHVFVFXHVFVFVHVFXHVFVFXFVHVFVFXFVFVHXFVFXFVDXFXFVFXDXFVDXFVDXFXDVDZDVFXDXDVBXDXDXDXDXDVBXDXBXDXBXDXBXBXBXBZDXBXBX@XFt@BXBZ@XBX@ZBX@XBX@ZBX?DDp@Bn@Fx@FjAHpABXDv@@N@^Dl@HxAFt@FnAHnA?HRlDf@vIR|CLvBRjDLdCR|CJhBJrBJ|AHrALbCj@nJ@PNlCFt@HzAHtABZFpADt@Ft@XjFLhBFlA@NLtB`@`HJbBDr@@R@L@VBZ@XBX@ZBXBX@XBZ@XBX@XBX@ZBZ@XBX@XBX@XBX@ZBXBX@XBZ@XBX@XBZ@XBXBZ@XBX@XBX?J@NBX@ZBV@ZBX@XBXBZ@VBZ@V?@BX@XBX@ZBX@XBX@ZBX@J?LBX@ZBXBX@ZBX@XBX@XBZ@XBX@ZBXBX@XBZ@P?FBX@XBZ@V@ZBX@Z@X@Z@V@Z@X?Z@X@X?Z?X@T?D?V?Z?Z?X?X?X?Z?XAX?N?JAX?XA\\AX?XCr@AXCZAXAZAXCXAZCXCZAXCR?FCXCXCZCZATCXCZAXCXCZCXCXAXCXCXCVC\\AXCVCXCZCZCXAP?FCXC\\CTAXCZCVCZCXCXAXCZCXCVEt@CXCXCXAZCXCXCXCXAXCZCXCXAXCZCVCZCXCVA\\CVCZCXCXAXCXCXAXCZCXA\\AVCZAXAXAXAZ?XAXAVAZ?XAZAX?DExDAT?ZAZ?ZAV?ZAX?ZAR?F?XAX?ZAX?LAJ?XAZ?XAZ?XAX?XA\\?XAX?VAZ?ZAVAX?ZAZ?XAX?ZAX?ZAX?XAZ?ZAJ?L?ZAX?XAX?ZAXAZ?XAZ?XAX?XAZ?XAX?ZAX?ZAX?XAZ?XAX?XAX?ZAXAZ?XAZ?ZAX?ZAXAZ?XAX?XAZ?XAZ?XAZ?XAZAX?X?XAZ?XAZ?XAN?d@AZAT?B?XAZ?\\AV?XAX?XAZ?ZAXAX?L?LAX?XAX?ZAX?XAZ?XAZAX?H?NAZ?XAX?ZAZAt@?XAX?XAZAX?PA`@?t@Ct@At@?^Av@ALAt@AbBAhAAnA?\\AdA?v@?X?L@nA?Z?N?j@@p@@n@@x@@\\@p@BpABx@DfA@b@DpADx@Bj@P~CJfBJ`BJrAB^BXLnAJlADb@Fh@Ff@Dd@NlALhAPrANdAFf@Hd@h@pD^vBVrA?BHd@Jh@FTDPNt@BJDRFXFXFVFXDVFXFVHXDVFR?DHVFVFXFVFXFV@HDNFVFXFVFVFVFXFV@FDPFVFXFXFVFXFVBFBPFVHXFVDVFXHVFXFVFX?BFRFXFVFXFVFVFXFVFXFXFVFXFVFXFVFVFXFVFXFVFVFXFVFVHXFVFXFXDVHXFXFVDVHXFVFVFXFVFXFV@@DVFVFVFXFVDR@BFXFVFXFVFXFVFXHXFVFXDTHXFXFVDXHXFVFVDXFXFVHVFXFVDVHXFVNp@FXFXFVFVFVFXFVFVFVFZFVFXHVDXFXHVFVFVFXFXDR@DFVFVFVFVFZFTBJBLFXFXFVFVFXFXFVFVHXFVDVFXXhADXHXFVFV?@FVFXFVFVFVFXFXFVFVFV@DDRFXFVFXFXFXFTFXFTFXFXFVFVHXFVFZDVFVHXDVFZFVFVFVHVBPBHDVFVFVFXDR@FFVFVFXDVFXFXDVFVTjAFXDXFVFZBN@FDVFTDXFZDXFXDTFZDZFXDVDTFVDZDXFVDZFTDZDXDXFXDXBL@HFXDXFXDVDTDXF\\DXDVFVDXDXDT@BDXFVDXDXDXFZDVDVFVDVF\\DXDVDVFZDXDVFXDXFVDZDTFX@JBLDZFVDXDXFXDXDVFVDXDXFXDXDXFXDVDXFXDXDTFZDVDZFVDXDXFXDVDXFXDVDZFXDVDXFXDXDVFXDX@BBRFXDXDXFXDXFXDVFXDZDTDXFTD\\FVDXFXDXDVFXDXFXDXFVFXDVFXFVDXFXFXDXFVFXFXDVFVFVFXFXFVDXHXFVFXFVDVHXDVFXFVHXFVFXFVFVFXFVFVHXFVFXHXFVFVFXFVHVFVFXFVHXFVFXFVHXFTDP@FFVHXFVFXFVHVFXFTFXDPBDFVFVH\\DTHXFVLd@H`@Nl@HXFZXfAFXFTHXH`@Rx@J`@FXPn@FVJb@BJLh@J`@HZDTPn@Np@FXHVNp@HXFTFZFTPn@Np@HZDTJ\\Nl@Lf@@DPr@Nn@Np@Pr@T~@DRLd@Pr@FXFTFXFTHZFTNp@Nl@@DNn@J\\Lf@Pt@FXHXJd@Jb@`@~APr@Np@Pn@FZFRXjARx@ZpATbADLPr@Nn@Np@Pn@Np@Pp@Nn@H\\DPHZDTJ\\DRJ^DPFXPp@?@Nl@Pp@Np@Pp@Nn@Np@Pp@Nl@Pt@Pn@Nr@Nl@Pn@HZDTPr@Pp@Ll@Rr@Nn@Pr@XjAXjANl@Pt@FVNp@Pp@Nn@Pp@Pp@Np@Pp@Nr@Pn@FVFXNn@Pr@FTHXDRH^Pp@Np@Pn@FZFTPp@XdANn@FZHVNl@?@Np@HZNn@HXFTFVFXHVFVFXPp@Np@Np@FTHXPp@Np@Pr@Nn@Nn@HVFXNp@Pp@XjAFZFRPr@Nn@HVNn@Np@Pr@Np@HXFVFVPp@FTPp@@DDRFTPt@Nl@Nr@T|@Ld@FVNn@HXFVFZHVNn@FZFTPp@FVFXPn@Np@Np@Rr@Nn@FVFVPp@VhAPn@Np@Pp@?@Nn@Pp@Np@Pp@Np@Pn@FX@@FVFVFTHZDVHXFXNn@@BNl@Rx@Ld@FXPn@Nr@FXPl@FZFVHXFRFXFXPp@FXPr@FVHVBNT~@^zAH^Pn@Pt@^zA^~AZpAFVDNJ^FZNn@Nl@J^VfAHVFZZlADRH\\DRHXHZDPH\\XfAZtAv@~CNp@HVDTXfAH^Lh@Rv@H^FRPv@h@vBNn@FXPl@VhAFXJ^Lf@H\\FTNn@HZNp@Tz@T~@`@`BFVDTH\\`@`BNp@HVFZh@xBFVXdAH\\BJLd@Nn@FXNp@HVjA~EPn@Np@DPZnA?@Rv@FZLf@Rx@DNLj@J\\FXFXNn@J^?@ZnAJ`@FXPn@Np@HXFVFXFVHXNn@J^DPFTPr@FVNr@`@`BFVL`@Lf@Jh@Lf@Lh@Lh@Tx@FTNr@Pp@FXJ^H^Pp@BHFV\\vAJb@Pp@Nr@HXNl@H^FRFVFVHXHZDRDTPr@HXFXXhAFVFZHVXjALl@Pr@HVDVHVNn@b@dBDTH\\Nn@Pp@XhAFZLd@Pv@HZHXFTHZNn@FXHXFVFVFXPn@FXBLJ^HXDTPt@HVFXFTFXFVHXFVHZFTFXHXFXFVHZFRFVNp@H\\Nn@XdAFXFXJ\\DPFVFXHXFXXhAFXFTFVXhAFVJ`@?@BFRx@Jh@Pl@Jf@FXHVFVFXPn@Pr@Pr@d@pBNl@XnANl@Rv@T~@Lf@VbADPHXJ`@Tz@Rx@Pl@`@~AZjAp@zBp@~Bf@dBt@bCh@bBj@bB^hARl@`@hA`@lA`@hAd@pAXv@Xx@jAbDtAzDp@jBr@rB~@lCjAbDf@tAN`@Ph@b@pAFLbA~CJXb@vATp@HVNf@b@xAj@lBZfAHXVz@j@rBDP@DDNPn@J^^vAJ^Nj@DPb@dB^|A\\zARv@ZrA\\`BR|@DTDPH\\BJJf@XtAH^Z|AXzAJh@H^Lr@Jf@BNFXJh@Jh@@FH^VrA@FNp@h@tCP~@Nv@@BJh@Lp@Lr@DTJh@BL^lBJh@Jh@ThALl@`@tBDTRfA@Bh@tCZ~A?BNt@j@tCLn@l@|C`@xBDVPz@Jh@TlAv@~DNx@\\fBVjAP`ABJZ~AP~@h@pC@HPx@Lt@FVFZDRF\\DVNr@DXHb@Lj@Jn@Lj@Pv@Jl@Nt@Z~AZfBd@|BLp@TlAF\\\\`BDVFXDX\\dBDVNt@P|@XvALt@FXNr@DRF\\FZDVLn@Jj@Ln@Jb@DXFVPz@Jj@DXFXDVDVF\\Jr@Lp@DXDXJt@PhADZDZNlADZD\\Hl@Hp@JbA@JFr@DXPfBBZBZFr@BZJpADt@Dn@HpADr@@XJhBDtAFlABt@DpABnA@Z@lABrA@nA?V@Z?X?x@@V?bA?L@p@?\\@xC@jC@z@?dA@nB?v@@t@@bB?|@?Z@X@`D?Z?x@?T@rA?X@P?F?V?\\?R?F?V@Z?d@?L?\\?Z@r@?Z?X?P@b@?v@?r@@b@?J?z@@hB?X?^@X@zD?x@?V@lA?Z@pA@fC@p@?v@?t@@X?\\?X?X?T?^@Z?X?t@@Z?r@?Z?@@\\?jA?Z@t@?X?X?t@@X?X?z@?R@\\?\\?f@?TBzB?fCBfB?rB@l@@pB?~BD`H@xB?f@?^BfE@jB?t@FvN@tD@xA?l@@zABnG?lABvF@v@?r@@d@?j@?t@@Z?p@@fCBxE?t@@bC@zB?F?b@@j@@bE@h@?j@?j@?@@xA?n@@tA?h@BrD?x@@bC?|@?f@?n@?P@\\@T@tB?~@@j@?lA?Z@|A?N?Z@N?f@@jA?dA@|@?xB?R@rA?T@d@@hB?j@?~@@h@?Z@bA?`B@t@?nA@Z?v@?p@?r@B~B?zA@bC@bDDpF?pA@jB?V@hC@r@?t@@pA@hC?lA?Z?n@ApACpAA\\At@Cl@AZCZAXAXCZA\\Ep@C\\OfBGt@In@Ix@In@E\\CTEVEXEZEVGZEZMx@GTEVMl@EXCJENERIZG\\ERIVGVGTAFGTGVKZIVOh@I\\IRIVIXGTIXITIXCHEJIVGVMZEPKVGXIVGPITAFIVIXITIVIVIXITGVGLAFIRIZIVIVIXITIVIVM`@Od@IVIV?BGRIVIVIVIVIVIXADGNIVGVKVK^ENIXITIXITIXITIVGRABIXITGVIVIVIVIVIVIXIVADGPITIVGVKZIXIVITK\\Of@KZIVSp@GVIVCHELITIVQh@KZGVADGPIVIVGRKXMb@CJKXGTITIVGVKXGTIXIVGN?BKXIXIVGRKXGVIVITIXADGPITIVGVIVITIZITIVIVIVGVITIX]fAADGPIVGRIX]fAIVIXITGTKVGXIVIVIVIVITCHEPIVIVIVIVIVIVIXIVITIXIVIVIVIVIVIVGXITIXIVGNq@vBaAdD_AzCELeAjDq@tBq@|BGRkBdGmA|Dq@|BCHEJIXIVIVIVITIXGPIZKZGRIVIV?@ITIVIVGVIVIVIVGPK\\IVIVIVGTIVABGRGRKZIVIVGVIVITIVIVIVGRELELIV[fAIVIVCJEJGRKZGTIVIVIVIVIVIVIVCJEJEPK\\ITIVIVIVIVGVIVIVIVIVABGPIXIVIVGTIXITIXITIVIXITGVIR?BIVIVIVITIXCHELIVIVGTIVIVIVITIXIVIXABEPIVIVKZGRIVIVABEPKXGVIVIVITIXABGPGTKXGVIVIVIVIVA@GTIVGTIVIXIVITIVIXITCFENIVIVGVIVIVIVIVIVIVIVGTIVIVIXITIVIVGVIVIVIVCHEJIV]fAIVQn@IVIVIVIVIT?DIRGVIVIVITIVIVIVIVGVCFEJIZIVIVGRKZGRIXIVITIXIVIVCFCLKXGVITIXITIVIVIVGTIXIVIVIVIVITGVKXENADIVIVIVIVIVGTIXITIVIVIVIVIVIVGVIVIVIVITIXITIXIVGTEJCJIVIVIVIVIVGVIVIVIVADGNIVIVIVGVIVIVIVIVENCHITIVIVGVIVIVITIVIVIVIVGTIXIVIVIVIVIVIVGTKXGVIVITIXIVIT?@ITIVGVIVIVIVIVIVIVGVIVIVIVITGRABIVGTIXIVIVIVIVIVIVITGVIVIVIVIVIVIVIVITGTIZGREJELGRKZIVIVGTIXITK^ENKXITGVIVIVIVGRABIXITIVGVIVIVIVIVIVIVIVIVIZGRIVITIXITIVIVGVIVIVIVGPADIVITIXIVGVIVELCFIVIVIVGVKVGVITIVIVIVIXITADEPIVIVIVIVIVIVGVITIVIVIXIVITIVIVGVIVIVIVK\\GPIVIXIVGTIVKXGRIVIVGVKVGVIVIVIVIVIVIVIVGVIVITIXITELCHIXITIXITIVIVITIVKVITITKVKVITKVKTKTKTKVKTKTKTKTKTMTKRMTIPABMTMRKTMRMTMRMRMRMTMRMRORGHEFMTOPMRORMPOROPORMPGFGHOROPOPOPEBILOPOPONQPMNQROPOPOPOPOPONQROPOPONORONOPOPONA@OPOPOPOPOPMLABQPMNQROPONORONQRONMPONA@ORONOPQPOPOPOPMNEDKLQPMPOPQPOPONORONOPOPOPOPOPMLSTOPOPOPQPMNOPOPQPA@MNOPMNQROPONQROPMNMNSTONORONOPOPOPA?MPQPOPOPOPQPMPQPONOPOPGHEDQROPOPQPOPOPOPOPOPOPOPQPCBKLONOPOPOPOPQPOPOPOPMLQTOPOPMNSTMN?@MLQTORKNQTORMRKL[d@]h@[d@QXGHS^KN[j@KPOXKRKPADYh@KTWh@Wf@MZKTKTUj@KVWn@Sl@Ul@KVIVIVKTSl@IVITKVITIRi@|AWr@Qf@M\\Sl@KVIVKX[z@_@dAYt@Sl@ITKVIVITKVIVKVIVITKVIVITKVGTKVO`@Ob@IVKVITITKXQd@Up@GLCJa@hAMZCJQd@KZCFM\\GNIVUn@ITKXEJADEJQd@GPGRM\\IRKZUl@Un@Sl@IRKZQf@ITKXGPM\\Sj@GLOf@MXy@~BGPM^KXITGNUr@]~@CD]`AUp@i@|AEHc@nAKVWt@GNITM`@Qd@ABQf@Wp@K\\KTSl@IV[|@M\\ABe@pAO`@Qd@Sl@]bAUr@Y|@ABQn@Qn@Qp@St@U`ACPK`@Mn@GXMr@Mp@Mt@EXEVMt@Kr@In@E\\CTE^Gr@Ir@I~@G~@IdACt@GnACl@Ex@At@CnA?b@Av@?r@?r@?zB?b@?vC@vE?fA?j@?|B@dJ?zB?~A@|F?|@?pG?`A@tE?xB?nG@lF?pF@xH?`A?x@@dJ?h@?pH@nE?dB?T?v@?zD@lA?|C?rD?d@?zA?~@@jB?vA?rC?`A?`A@`E?xE?\\?`B?`B?B?`@@N?|C?h@?vA?vA?x@?Z?@?jB@|@?pB?hF?F?rC@nAAF@pB?vF?|C@xB?V?B?xB?b@?|@?r@@rC?z@?B?tA?|B?dC?~@@zB?jA?n@?nD?pC?~B?rCA~B?z@?xAAjA?v@?|@Al@?FA~DAz@AfB?~@A~AAdACtD?z@AbCAnAEtFA~CCfC?pAAnAAnAAnAApA?hA?^AJ?l@Ar@?X?\\?VAp@?v@?v@At@?t@?t@?p@?x@?D?j@?D?n@?nA?pA@pA?r@@pA?v@@r@?lA@v@@v@@lA@nA@rABlA@tAB~A@`ABlAF|CDlBBbBBn@?^Bv@DlBDfC@t@Br@@v@@r@DnB?HB`A@t@@J@h@?@?\\Bl@?^@V@j@?N@TDvB@V?d@@NBhA@lADxABhABfBBnA@v@@N@d@@pABlA@zA@fA@p@?T@\\@xCBhD?rA@v@?^?`B?v@?pA?fB?rA@jB?nA?pA?jA?tA@zC?xF@zC?zKBjR?T?lB?j@?nD@xA?zA?nG@~B?rC@xG?L?bD?F?vA?zA@pD?bC?bE@vB?pA?rG?vB?N@dA?lA?dD?`D@vC?R?bA?`B@`D?rD@|H?n@?x@?dA?V?vA?lA?fB?Z@X?Z?rB?v@?r@?h@?^?N?d@?Z?B?j@@lA?p@?X?v@?H?|@?nA?nA@R?v@?`F?bF@xE?nA?vA?|A@x@?X?t@?F?bB?hD?B?b@?B?B@^?J?f@?B?V?H?D?B?P?L?`@?V@xG?pH@l@?`B?`@?V?tD@fF?@?n@?p@?|B?nA?tA@V?xC?j@?xA?D?rA?lA@~C?xC?nB@`A?pC?fA?j@?j@?hA?L@zB?pD?|@?jA@jB?~A?xF?hA@dC?t@?rC?d@@lB?r@?dC?nA@jF?lB?lA@~D?P?bA?`B?hC@t@?jB?p@?bA?dB?j@@r@?dD?j@?l@?l@@lG?b@?T?bB?^@jA?l@?vA?l@?z@@lA?b@@nABdB@t@Br@@\\@X@VDr@Bh@Dj@@PDl@Fx@B\\LlAB\\Hp@Hr@DXDVBZDXFZL|@Lr@Hb@Hh@DNBJJn@Lj@Nn@Nn@XhAV~@BJL`@Pn@Tn@HXJZRl@Xt@Rh@HRHTRf@DLNZTh@Rb@Xp@Vd@Rd@PZZh@Xh@dAhBVb@v@rAT`@PXT\\DJj@~@PZf@z@x@rAR\\?@V`@@@R^@@T^T`@dAdBJPDHHLr@lAFHZh@FL`A`BZf@\\l@j@`AV`@@BR\\DHd@~@DDZr@P\\HNZr@Vh@FNb@hAVn@FPDHPd@t@rBPd@`@jA@@r@pBt@pBPd@L\\h@xA`@hATl@JZFN^dAXv@JTJXJZTn@BDp@lBXr@HVPd@@DXv@Zx@p@lBn@dBf@tAL^JX\\~@h@vAPf@Vt@@@f@tAJVJZ@B@DBDBJXv@Xv@L\\n@bBp@jBnAjD\\`AN`@Xv@@@?@FNFR@?FPXx@Zx@Tn@LZb@jAFPb@nAFNHR`@jATl@L\\Zx@Xx@|AfEdAxCt@pB~@lCd@tAVx@\\bAHVNd@T|@J`@FTDRLh@FVH\\Hf@Lp@Jh@DRDXHd@DVDPHh@Fh@Hh@Ff@@JFd@BLBXBRD^D`@Dl@Df@Dh@BT@XBZ@VB^@VBX@X@Z@X@Z@X@X@r@@t@@P?j@?B@T?J?B?x@?Z?t@?b@?`@?J?r@?t@?l@Aj@?V?tDAhD?`@?fA?r@?h@An@?f@?pA?L?@?`@?j@?X?PAj@?j@?j@?H?`@?x@?N?fAA~D?R?bC?x@AX?nA?t@?t@?t@?t@AT?l@?`@?F?fBAjE?N?jA?V?D?VAvE?xAAvC?jA?V?l@?NAl@?J?r@?r@?X?~@ApA?j@?Z?X?X?r@?j@?j@?TA`D?nA?t@?t@AX?^?T?X?Z?n@?n@?J?X?f@At@?b@AxA?@AP?ZAN?J?NAH?ZCp@A\\CZAX?BCj@ATCb@CXEf@ALAPARE^?DE`@AHEh@AH?DAJCNCRCTCZKr@ALCPGb@EVEZER?DGVEXEXGXEVGXGXEVIZMp@GXGVGXGVERI\\AHMh@EVOl@GVEVGXEPI\\K`@CPGVGXy@zDIXMn@I`@CH}@dEe@vBCJERWlAGVETKb@Mn@GVI\\ERMn@Qt@On@Kh@Qx@CJENa@lBAFA@CLEPGXGZGTEVGVI\\UfAEPADMp@GRADGZGXEPEXIZEVGZEVCNCPERCTEZCPAFAFAPCTAHAJAJAVCXCZAXC\\AX?DATAT?LAN?VAP?F?Z?X?Z?^?V?H?H@D?N?J@^@V@X@X@P@J@T@L@L@P@RBPBXBVBT?@DT@NBTFZBRDXDTDVDT@DH\\FXFV?B^tADNDNHTFRBFPj@Tn@JVBFFLHTb@dAJVJTVl@JT`@bAJTJVb@fAHPVn@Rd@HP\\x@pA`D~@zBN^P`@\\x@JV\\v@N`@Vn@JTJTJVVl@JTHTHRn@|AJTJTVn@DLfAhCN^JTJVHRJVJVJVFTVp@Z|@d@xAV|@Tx@VbANn@FTFTNv@Nn@P|@@HJl@BHBNF\\F`@BN@FDVBP@FDb@Hb@D^BZF`@Db@Db@D^?D@LH`AFr@Df@@NDt@@JBZF|@Bh@@@LpBBj@@@N`CBd@\\nFDt@FbAF~@RrCBn@Dj@Df@TpDJ|ABb@NxB?FJvA\\lFF|@Bj@@B?@Bb@b@fHLbB@PN~B@TDj@B`@B^Dp@J~A@DDh@Df@?BFl@BXBXBX@@Fp@Jv@L~@@FD\\BNF^D\\Ln@\\xBTnAPfAZjBLp@VbBZfBHf@b@fCJj@z@fFRnAFVHl@ZfBLr@Jp@FXDXJp@FXBLBNDXP`AF^FZBNHf@Hb@Jp@Lr@RjARnAJh@DZTpAJl@TnABNRpAFZTtAPbABLNz@~@xFJj@F\\RlAPhAFXJp@Lr@Lp@Jp@Lr@Hd@N|@Lp@Jr@DTDTLv@FXF\\Hl@FXDVHf@BHFb@P`ADP`@dCBNDPDTDRDXFVDNBNDNNp@FVFV@HDLFXHVFVHVBJBJDLBHHX@D@BDJBHDLBLDHBJDLDJBHBJFLFT`@dAXt@Rh@Tf@Th@\\t@Rd@Vh@N\\nApC?@f@fAdA~BjAfCt@dBh@jA~@tBbBtDRb@nArChAbCXp@jB`En@vAn@xAhAdC\\t@P`@Vh@Pb@j@lAl@tA|@nBlBdElApCLVXn@Rb@Rb@Rb@nArCRb@Rb@NZBHf@fAf@fARd@j@lAJPb@~@JVRd@Rb@^x@JRDJFNl@rAb@`A`@|@JTLV@@BHBFLTLZHPLXTf@@@JRJTLZHPJRJTBHDJLTJVLVFLBDJTHPNZJTJT@BFNLXZn@HRJRLVHRLVHPLZJTLVJR@BHRJRFLDJJTJRJVJRHRLXJTBFFLFLN\\FLBFJTLXHNLXLZHPJTJTJTZn@HRHPRd@BDf@fALVHRLXHPn@vALVJV^v@Tf@Vj@`@z@JVJTJRJTJVBDVh@@DTd@`@~@JVHPDHTd@DLDHJVJTLVHPJVDJFJx@hBZp@HRBFJRHRBFFJHRNZRd@N\\JRJTJRHRNZLVN\\FLBHP^JTJTLVJTHTRb@BBLZJRRf@NZJVR`@DHLVHPJVJTJTJVHRLVHNJV@?BJLTHPP^FLLZRb@LXVn@DHL\\BFL\\FLFRHVJXHVHTFPBLBH@DBLDLFXT|@HZFZFZFVDVNr@DVDXJp@DXDXBXDXBX@BBVBX?@@H@NBX@L@J@XBXBX?N@J@T?H@R@X@Z@X@Z?@?@?V@P?H?X?X?X?Z?N?F?Z?F?RAV?B?XAL?JAX?DATAXAXAL?JCXAXATA??BCZAXCXCZCVCZAHANCXCZAVCZCXCV?@CVC\\Gr@UvCq@vIc@`GGj@Q`CYlD]vE_@vE[zDo@vIQtBC^y@rKOhBAD?FCXCXCXAJC\\Eh@SlCYtDEj@ADo@pISdCKnACZC`@CRAHw@bKEj@UxCAHARYrDCTCXCXCXCZCXCZCVCZCX[xDEj@Ed@AXCXCXCXCXCZAXE\\IlAEp@CXGt@CXMhBGp@AXCZCXCXCXCZCXCVCXCZCXCXCXCXCZAVCXCZCXCZCXCXCZCXCXCXCZC\\ATCZCVCZC\\CTATE^M`BC`@CXGt@CVGt@CZEn@E^AZCVCXCZCVAZCPEn@OvBCVCZCXAJAJ?@CZCVGt@CXS`CCVC\\?JCLAVADATCR?BC\\CZCXAJAH?@CZCZCVCXCZCZAZCXCN?FCZCXARADCXAN?DE\\CZAT?BEd@Eh@Gr@AFAPC\\CTCZCZAXE\\AP?DCXAJALCXCZCXARE^CZCXEt@Gr@CXCZGr@?HCPQbCCXGp@CZCXCXCZCXMhBALAJCZAHANCXCZCXCVCZCZEl@C\\?BCXCXCXCZEl@E\\AVE`@ATADAVCXCXCVC\\?BGl@Gv@CXCXAXCXCXCZCXCZCXCZCXALEd@CXAZCXCXCXE`@ALC\\CZCZCXGt@AVCZCVAH?BAJ?@CXCXCXCX?DCTAXCZCVCZCXI~@Er@E`@]tEo@dIItACREj@GbA?NA?Cn@GnAEv@Et@EnACz@ALA^Ar@ExAAdACr@?D?l@?FClBAzA?r@?f@?`@@v@?p@@lA@fABjBD~BFxBJnC@b@?@Dt@Bv@Dr@J~A?@BX@NFlANnBN~A@L?@Df@?@Ff@PjBNtANrAJv@D`@Jp@D`@Jr@?BRnA\\`CHd@X|ALt@\\jBTnA@BTlABLP|@Np@DRRbADNDNJ`@BL@FHZDVNn@DRBJDPHXDVFVFX@FBL@BDVDXFXDVBL@JDX@HBNf@vCF\\DXJh@F\\@FBL@FTtAJh@DXBNTnAVrABTFXDVBPNz@TjADT?D@DJh@@F?BBLDXFVDXFXDX@F@DBJDXDXLp@FX@LBJDVFZBJ@J@BDTDXDXFX@DBPFXDZDVJj@@FFVDXFXDXHb@BNDXFXDVLr@FXFd@BJBJBLDXFXDXFXDXDXFV?B@BBPP`ABHBP@FDXFXRjAPbA@FRjABJ`@~BHb@H^BRRjABNBP@B@Jn@pDLr@DVFXRhAF^BRFVF`@BPFVDZFVJp@FVDXDXDRBPBJDVFXDVDXFXLr@XbBDVBL@LBJBJDXDVDVH\\RhADVDZFX@FBNDXJp@BL@JLn@DZFXDVDXFVDXFX@JBLFVDXFXDXN~@Jd@DVDXFVDVFVDXLp@DVPfAJf@BNDVFXBLFb@FXDVFZDVFXf@vCDVFVDXDXFZDVDVFXDVFXDXFXDXFVJr@Nx@DPDVDX`@zBDXLr@DVFXJn@RnAFVN|@Hd@DXDXFXDXLp@Jn@H`@Jj@DXFVDZFXDVDXFXDXBLBH@HBNFXDVFXDVFXDXFX@BBRDVLr@FVBP@DRhABNBHDXBL@JFVDXFXDVH`@BPDVDVFXDXDVFXDVFXBN@HDT@BDXDXFXDVFVDXFXHd@@LFVHb@@LFXDXFXDVDXFXDXFXDV\\tBJd@BTFZFV?@DTDXFVDZLp@DVRjADXFVF\\DTDXDVLr@DVDXFXXdBDXFVDXFVDXFZBJFb@FVDVFZDTFZDT@DJj@DVBJBLDVDZ@HBLRlADXDXDVLr@Jr@FXDZDTFVDZFXDXFVDXFXBPH`@FXNp@Lr@FVDVFXDVFXDVDTDXFVDXRjALn@DVFZDTDXDVDX@HBLDXDXFXDXDXPjAFXDZFZDTH`@BPFXDXDR@DDVDXHd@BLFVBN@HBNBHDVFXDZDTFVDXDVFVDVDVDVDXBP@FDVDXDXDVBL@JDXDZDVBNHd@DXDXFXDVDZFXBNBJDVFVFXDVFXDXFXFXDXFVFXDVFVFXDVFXDVFVFXDT?BFVPfA@BDTDXDXP|@Hd@DZDTFXZdB`@|B?D@BBNDVb@`C`@zBDZLr@@BHh@FXDXFXLr@DVbAzF@JNz@@BDXZdBt@jEDVFXDVDXLp@Lr@DX`@|BDVFXDVZdBFZDVBPF^DVDVJj@FZ@DDVDXLr@FVRjADVDXFXRjADXRhAFXF\\BRDP@HFVDXFX`@~BDVFZDVFXDZFVDVDXFXDXF\\DRFXDXDVDPF`@FVDV@BDVFZF\\DPDVBL@B@FH\\DPFZBHDLBJ?DBFJb@BJHV@FFP@FDNHVDLBHHVHXDLBFHVFTJXHVDJNb@JVDLn@bBHTJV`BnE^`A~@dCd@rAVl@BJN^JZTh@HVFL@F`@dAj@|AJTHVJT^dAJVHTJVHTb@jAFNBDv@tBHTFR^`ADJDLJTHVJVHTJVFR@BJVL^Nf@HZHTNl@FVFTFXFXFXFZDRFXDZ@DJl@BP@FDVDXDX@B?DBLDb@BNBZDX@TJhADp@Bd@@XBr@B|@Bz@LhEFnBD~AFbBBp@D~A@RBx@?FBn@B^Dx@@`@@NDj@BZBf@B\\Dd@BTD`@BTD^BXBTHj@Jt@@BDZBTJp@Jr@Lv@Jr@DXRjA?@BN@HFZHf@Jn@BNDZ@FRtADPDX@FDXDXFXF^Lt@@NLt@DT?DDTDXDVFZDXDXDVDXFX@LBJDXDXDVFXDVDZDVDXBN@FFZDVBXFXBV@DDTDVDZDXDXDXFVDXDXDXFXDXDXFXDXDVDXDVFZJr@FXJp@DXDVDXDXFXJt@Lp@DXDVDZRhAHl@F\\DVJt@Lr@DXDXLp@PlADXFXb@tCDT@FF\\BRDZFVHh@DZF`@FXBTRlAFZDVh@lDF^PjAFXDX@JBLDXDVDVFZJr@DXFXDVBXFXDXFZBRF\\DXDVDXFZDTDXDXDXDXDZPjADXFXDXDTFZDXFZDVDXFXzAvJV~ADZZjB?DLr@ZrBHd@Jp@Lr@VfBLp@VfBf@zCPhADZ^|BJr@XfBF\\b@tCf@zCj@pDJr@Jp@l@rDPlALp@XdBx@hFj@rDXdBn@bEn@|D|A|JdBzKv@`FXjB^|BJt@~@|FHb@@JfA~GLx@dAxGz@pFJh@RtAhBdLbCrO@JTrAHh@hAfHHh@r@tEpAjIRjATzAh@fDJh@\\|BF\\BJ~@fG\\xBf@`DJn@RlAfBhLDZ@HLt@PbAFf@VzARlAJr@PdAF\\Jr@PjARhAJr@\\zBF\\Jr@RfAHn@FXDXDVJp@FZBVFXPhARlA@L\\rBJp@PhAJn@FZJr@XbBJr@DVDZRhAJr@Jp@Lr@DXJn@TvATxA@BV`BJr@XbB?DJl@Jl@Lt@DXdA|GDVPfAXfBDZDTDVLr@Jn@Jr@PfAHh@Hd@Lr@BVRjADZPhARjAXdBPjAHd@TvAJl@NfANz@DZ?@@LF\\r@lEPjAV~AF`@H`@Hf@Jr@DXDVFXJr@Lx@Jj@VdBDVHd@Hj@PjAFh@D\\DXJr@NlAFr@Hj@Hz@Fp@LlALtAL~AJvAJfB?@Dj@Bh@?@Dh@D~@@^@JBj@Bj@@f@@Z@P@XB|@BhA@L?V?FDvB@j@?V@V?B?Z@r@?j@?B?Z?^?fA?@?d@?f@?v@At@?\\AnAAp@ChBAXAj@A^AZCv@Cp@AZAVCt@EfAEz@Er@KhBEl@YrEG|@G`AIjAC`@[vE?@KtA?FInAGp@Cb@CXAPC`@AVCZEl@C^ANG|@CZIlAAXCZEr@CXCXEp@Ev@CVEt@CZAT?DEh@Ej@Cb@AFG~@AVEj@Eh@ANAPEt@?@Eh@G|@IzAEd@GjAGv@Cd@CZIlAEt@KrAC^KhBEj@OxBEj@Cj@Gt@Eh@GdAEr@CXEp@CTCj@Ej@El@Eh@G~@MpBCf@Ej@AJANANCb@QhCEl@Cj@ADInAAZO|BC\\Ej@Ep@s@~KKfBCRGdAEt@AXEt@Ad@ALCt@Cr@AHAh@Cl@Ah@ATAr@ANA~@AVAZAz@?j@AnAAF?hA?hB?d@?N?t@?P@`@?t@@jA@v@@x@DrBB~@@V@\\Bz@Bp@Bp@@V@ZF`ABr@B`@B\\VdFFxADx@LzBH~AFpAHrAFlAHvA@RBp@@ZFfB@N@d@@R@DBt@@LF`A@HDt@?F@JF|@Bb@@J?NBXDt@?JB`@@ZH~ABf@BXFbABb@H|A@HDr@Dt@Dr@?D@TBXHhBDr@Bh@@J?@@\\BXDj@@^Bb@Dn@Dp@B`@Bp@BX@P@VFlAB\\@T@RDz@BXDt@?DL|B?DBl@BXDx@NxC@VJlBLfCHhBDx@Bn@RtDLfCPfDDz@HdBDv@JtBJ|AFjANdCHjAD~@F~@FzABd@FbA@b@Bl@F|@Br@BZ@X?PFvADt@@\\BVFnADr@@XBZHfBBXH~AB`@JzBBZDp@Dt@FpABp@HnAJrB@NL~D@BBD@DF|@FxANtCBVVdFFhAF`A@VLbCFrAF|@RrDFtAHdCDr@@ZDp@hA~Q^xGH|ATpFFtAN`DBXFnAFnATrEP|CRvDN|CJxBHrAFrADr@JzBDp@B\\?J@RFhAJhBBXBr@BX@X@XBV@\\BX@XLbCHnA@Z@VDt@@XBX@XB\\HfBBVBp@JlB@XBX@ZDr@@VHnABj@?DDx@@J?HHjADx@@Z@XBR@`@BT@ZDv@HrADfAB\\@TBZ@\\Dn@BX@XDr@BVBl@Db@Dt@BVBZBXFj@?BDj@@JBRJdAHv@BZHv@D\\BN@HBTD\\BTD\\BN@HDXFf@Fb@BP@FDXDV@JBNBN@HBRLt@F\\BRBPFZBNF^Hb@DVFXDTX|AHb@BT@@DXFXRhAH^BRRhAFXJj@@DDTLr@TlADXDTZdBTlAl@bD^vBJl@Jl@d@`CDXDTLr@FXDXFVLp@Jp@FXDVFVDXFXDVDP@FRlAFX@DBPRjAFZLn@DXTjADVDP@F?BDRDVFZ@FDNDXLp@DXFVDXFVF^RfAFVLr@FXJl@DP@JRhAFX@FBJDZFXDXDVLp@TjADZFVDTFZDXFVDXDVFXDVFZLn@Lx@V|AJn@?@Hf@Lz@DRDXLr@Hb@DTHh@Pz@r@lDNv@HZl@dDFZR~@Fb@Ln@F\\Lp@Nx@P~@Lr@RbA@LLr@FXJj@Hf@xA`Ir@zDDXb@`Cf@lC?DFXDTLp@?@X`B@?Lr@DXFXDTF^Jn@BNFd@DZHj@DXBT@BD^Fh@@JFr@Fh@@PDb@?@B\\@NDj@@NJ`BBZJvBDn@Dd@Dx@HrADz@B\\HxAJfBDr@Fz@@RH|ABb@Fv@Bj@HzA\\~FDr@BVDv@F|@?@HxADn@?BDr@JhBDj@HxAXhFDl@B^FhAB\\Dr@?@LbCDp@LhBHzAJdBBh@BXDv@HxAJ~AHtAT`EZfFDr@Dv@PxCBZ@XDp@BZ@ZBX?BHjA@XBV@ZBX@X@FBj@Dt@BX@\\HlA@L@\\Dr@Bb@BX@VBZ@XBXJhBRbDH`BHnABZ?F@NB\\@VBZ@VDr@BX@XBZ@XBV?@BZ@XBXDr@@ZBV@ZBV@ZDr@BX@XBT?B@ZDr@BX@XBX@XBX@XBXBZ@XBZ@XBX@XBX@XBX@ZBX@XBXB^H`BB\\@XBXBZ@VDt@BVB\\@VBXBXBZ@VBZDXBXBXDXDXBR@DDXFVDVDXFVFXFXHXDRHXHZFR@DDPHT@DFRHVHT@BHTBDFNJVJVHRVl@JTrA|Cb@`AP`@Zv@b@bALXFLZr@JVFLBFTh@Xl@Rf@|CdHHR|@pBl@tALXHRJVVl@n@vAJTLXLZnArC@@Rf@Xl@Vl@Xp@JTHPDJDHJVRd@LVDLDFDLJTRb@HTVj@Tf@HPd@fADJRb@JTJTTl@JTBDFNHN@DVj@BFNZJVBDrA~CVj@HTb@`ALVJTDJDJHP\\v@Rb@N\\DJJVLXHPb@bAJTp@|ApAxCVj@Vl@Xr@@BP`@LZd@lAXt@BJFPHPHTf@xAJXHT`@nArA`Ev@~BJXLb@\\bABHFNDLHVJ\\Nb@r@tBPh@n@pBVt@j@bBlAtDDPh@zAf@`B^fABHn@nB\\bAf@zAFNVv@Rl@DNZ~@nAxDXz@FR@B`@lAVt@DNBFv@bCTp@@BVt@v@bCPh@p@nBRp@HTTn@\\bAbAtCjBtFJXJZTt@^bA\\~@JZVr@DNTp@Tn@HTDN@DVp@FPHVBDHTTp@Z~@JVJZHTDNL\\JXPf@L`@Pd@Rl@L^HTRj@HTL`@DL^dAJXFTJVHTHV\\`AJXJXPj@JVL`@N`@h@|AJZ`@hA`@lAPd@FR@DFN`@jANb@?@Pd@Vr@JZN`@Nd@@DVt@Xx@Rl@Nb@Xv@DN@?l@fBTp@DLL\\Tr@r@rBf@xAJVXz@Nd@nApDL\\HTPh@FP^fAHVJTVt@?@FPPf@Z|@Z~@Tn@Tp@Pf@BFRl@JVRl@Nb@Xz@Rl@FLVv@Tn@L^BFNd@N`@^hATn@HTHRTn@ZbAJX^dAJZFR@FPh@HTFTJXFVPj@Pn@BFDPFTn@~BBJJ`@Pr@Pt@Lh@HXDPJd@Jf@H\\Np@Ln@Np@Hd@DRJj@RhALr@Ln@D\\DVFVJp@DZBLF`@Jr@BTDXFb@Fh@DZJt@Hn@DZBXDXDXBXDVDZBXDXHr@DXDXBRD^Hp@BPJ|@BPF`@BVDXBTD\\DZDV@PF^DZBXDXBXJr@BXTfBHr@DXR|AD`@DXHr@DXBXJr@BVDXBXDXJt@Hr@DXBVNlAFf@Fd@DXHp@NlADXHr@D^Hl@NlAD\\Hn@DXRfB@HBNHr@DXNjAHp@D\\DXX~BBVDZBXHp@DZFp@DVB^@NB`@BV@^B`@?B@^@X@`@?V?Z?B@T?Z?XAX?Z?X?X?ZAp@?\\?Z?R?B?ZAX?t@?r@AZ?Z?X?Z?r@AZ?V?Z?X?ZAZ?X?X?X?TA^?X?Z?v@?T?X?JAL?Z?\\AdB?t@?XAp@?B?V?Z?XAX?nA?XAZ?Z?X?X?XAt@?X?D?n@AV?\\?X?F?P?X?ZAX?X?Z?X?XAZ?X?D?R?Z?Z?VAt@?V?Z?ZAX?t@?X?X?ZAX?\\?V?r@AX?Z?Z?XAX?X?X?Z?Z?XAr@?X?X?Z?\\AV?X?\\?p@A\\?V?X?Z?TA\\?Z?X?X?ZAX?Z?V?t@?ZAT?D?X?X?t@AX?\\?p@ApA?t@?r@Av@?pAAlA?lAAt@?t@?V?@?X?\\At@?j@?^Ar@?F?l@?ZAr@?pA?r@AX?\\?V?X?Z?XAZ?X?jB?f@?L@X?\\@p@?ZBr@@t@?@Bl@@XBX@^BZBp@Bd@@NFr@Dr@Hv@Fr@?@BVBJJbABVDVDVDZDXBVJp@FZDXDVLr@Jp@@FBLDZHf@Hb@DZHb@BNDVDXLp@Jr@Lp@Jr@XdBDZFXJp@DXLp@DZDXRjARlAJr@Ln@Jr@DXLr@DXDXLp@Hf@@JFZJp@H`@BNDXRlAJr@F\\BPFXRnAJp@RlADXXbBDZFVTtAPfA?DBNLt@Lv@BPFXRlADX@FBTRdADZLr@DVDXLr@Lp@Nv@DRFZFXNn@HZDTFVHXPp@FTPj@J\\HVFVJVRn@Rn@Vn@Rl@JTFTVp@`@bA?@HRHVJVLXFRLXHTN^DLHRDHDLRj@r@tBRh@^hABHh@tA`@bATl@JTJVRj@JTHTHXJZRj@FLl@lB@F\\`A^dAVn@Tl@LZtA~CVr@Pb@BDJVJTJXJVDJDHHTFPHVHPFTJT@DRd@?@HRVl@Rh@b@dAHRh@zAJZHRHVHXHTJXHVh@~AFN`@fAVr@Rd@DJHTj@|AHTJVTl@HTJVJXHTFP@BJTHXJVHTJTHVJTHVJVJVHTFP@BJVJXJVHTHT@?HTHTLXRj@Vl@Vp@HR^bAJVHVJVHTFNBDHVVr@HPHVN^FNHTHVJTHVJVHVJVHTTl@LZHRHTJVHVJVJVHRHVJVJVJTHTJV@BFPJZJVRh@Pd@N\\HVHTJVJVHTHT?@LXTl@Xv@DHJXJVTn@Tj@Tl@JTJZHRDJDJ?@HRJVHVJXTl@JVh@xAJVVp@HRHTJXHRJVHTJVHTJVJVHTJVHTJTBJDJJVHVJTHVJTHVJVHTJVJVL\\FNHVJTHTJVJXHRJVHTJXJTHTHVJVHTJVFNBDTl@@BHRHVJVHTJTJZHRHVJTJVDNBFJVHTLZFPJXRd@Vt@JTJZRh@JVHTJXJVHRJVHTJXHTJTHVJVJVJV^bATl@JV^bAJXTl@JTHVJVJXHRHTJVJVHTHVJVHTJTHTJXHTJVJVHTJT?@HTJVJVJVHRHVNb@FJJXFRJVJVHVHRJVJVJVJXRh@JXTj@HTJVHVHRLZHRHVJV@BHPJVRh@HTJTHVHTTl@HTDJDJRh@JVJXRh@Tn@Vp@Vp@Tn@HVJTVp@JVBHPb@Vp@Tj@Vn@Tj@Tl@JVTp@HTTn@Tn@Pj@^dAVp@Vn@?@z@nB`@dA^bAJV@DZ~@Rl@Lb@Pd@d@zAlAzDJ\\\\bARn@Tl@BDFRTl@HRHVHRJVJVHTJTJVHRHTLVHRJVHTJTTl@JTHT@BHPXn@JTJVJVJVLXTj@LX@DHRJVJTLXHRDJRf@BFXn@l@vAHT`@`ALXHRTl@HTFLBFTn@Tl@JV^dAHVJVJVHTJT@BHRHRJVHTJXHRJTHVHTJXJVHRJVHTJXHRJXHRJVJXHRJVHVFNBFHRJXJVHTJVHTJVJVHTJVHTJXBHFLTl@BHBHJXTj@@@Rj@JXBDDJ`@dAHTHTJTHVHRJZZ~@HTJVTl@HRJXPb@BFJVHVLVLZj@xAHTLXHTHTLZHRHTJVJXHTJTHTJVHVJTHVJT?@HTTn@JVHTJVHTLZHRHVJVHTJTHVJTHVHR@BJVHTJVHTJTJVHVJTHVJTHVJVJVHTHTJTHVJVHTTl@JVJXRh@Tl@Tl@JXHRJVHTJVJVRj@JXTj@HTLXBHDJFNBDHVLZLZZx@HVJVHVJVHTJVHVJVJVHVHRJVHVJTJVHTJTHVJTHVDHDJJVHTJVHTJVJXTj@HTJVHTJVHVJTHVLXFRJVDLBFLXHTHTHTJXJTHTBFDLLXHTHTLXHV\\~@HRLZHT`@dADLDLTh@HTJVJVHTHTLZHTHRHTJV@@HTHTJXHTJTHVLXTl@HVJTHTHVXr@\\~@DJPd@^~@~AfEZx@FRHT@BHTJTHTJTJXHTHTLXFRLXHRHVJVHTJT@DFPJVHTJVHR?@JVHTJVJTJXHTHR?BJTHTJVDJBHJVHVJTJVHVJXHRJTBHDJVp@HRJVHTJXHTVn@Pd@@DTl@JVJX@@\\~@JVHTTl@Tl@Vn@BHDJJVHTJXHTJTHT?@JTJVHR?BVn@HRHVJTHTDJDJTl@Tl@HVJTBFDNJTJVHT@DRh@JTJX?@HRHTJVHTJVJVHRHVJV@Bh@vAFLBJJTJXFRJTHVJVJTJVDJBHHVJTHVJTHVJTHVJTJVHVDLDHHTTl@JTHVJVHTJVHTJXHRJV^dATj@JVN^Pd@v@rBRj@JV`@dALZHTp@hBN^@BPd@Rn@JTDNN`@JX@DDLHVJVHV@FDLJX@FDNHTHVHXHTHVDPBFHVFTV~@BHHVFXPn@FT@BPn@FVPp@FVFV@DDTPn@DVFVDN@HNp@FVFXDP@BFZFXLn@DVFXHb@BNDVFZBLBJHf@F`@DXLn@?BDVDXDXDVDXDZFZ?FHf@Fh@@HLdADTJ~@Hr@BZDV?DBRBXDXBXFr@Fd@@LBXPjBLjABX@BH~@Db@BNDh@Hr@BTFr@BVBZDXBZBRB\\Hr@BZPhBDVBZFp@Hr@Fr@@FFj@Ft@LlAFf@@LFp@BXHt@BXBXBT?BDXBXBXBXDXBZPfBHt@BVBVBZHr@BX?BHp@Fr@BXDXB\\Fn@DXBXBZBVDZBXBVBZDXB\\@Bl@tGHr@Fp@LpAb@hEJnAD\\BLThCNtA@RDXB^BTFt@Fl@Jz@Fp@Dl@Ft@BXBX@X@N?H@Z@Z@V@X?Z?X@Z?R?DAX?X?ZElAA\\AVAXCXCXAZEXCXCXCXEXAJCLEZETCNGb@GXETABGXGTGXGVQp@Qn@ITSn@KVITKVITKTITITGPM\\Ul@k@zAc@jAGNgAvCQb@_@bAq@`B_AdCe@lAy@|Bo@bB[z@Yx@KVKVIRKXUj@Sl@M^GTGREPADGVGXGVGVEXGVEXCVEXCZCZCP?HE^A\\CX?NAf@A\\?^?V?L?J?N?F?B@X?L@L@X@ZBV?@Dj@BRFl@R~AHl@@JLfAXzB\\fCHv@Jv@VjBL~@?@Hp@Hj@Jv@Jx@LfAJr@BVPlARbBThBFb@R|AVpBJt@RbBR|A\\jC?DRvAFj@PnADXNlAJz@@DFd@?BJ~@J~@Fn@Hz@@@Bf@D\\Dp@B^Bh@@R@LBn@@^Bd@@f@Bn@?@@Z?X@~@@bA?p@?f@?R?V?Z?ZAV?XA^?TARCv@?TAVCp@Cp@Ej@C^AZCVA^Eh@E`@C`@KbACRCZKv@CXOfAE^G\\EXCRA@EVE\\GXEVGV?@EVGXGVGZAHENMj@I\\GZOl@IXGTEPUt@GX[`AGTABIRGTOb@[x@Sh@?BMZKTUj@KVKTKTKRKVe@`AWh@]p@Q^_BbDoB~DIPgEvIw@|AcAtBWf@Q^MVYj@eEvIiCjF]p@q@tAq@tAOZm@lAq@vAWf@Q^Ub@e@~@o@rAa@z@i@fAaAlBUd@[p@Wh@q@rAo@nAi@hAMVWh@c@z@o@rAWf@MVg@`AUd@Yn@Yh@q@tAo@nAYn@Wf@Yl@MTIR[l@KTkA~BWj@e@bAIPc@bAWl@Q`@{@xBk@|A_@fASh@Un@g@zA[dA]fAGTUt@Oj@K^W|@I^WbAOp@YhAI^[vAc@|B]fBSjASjAKr@In@GZE`@O~@Ir@UhBEZMfAMnAQjBMtAEh@IlAEp@C\\AVCZAZCXIjBCj@GpAEr@Ex@Cr@Cn@AFCj@Cv@Ex@AREv@?HCf@Et@Cn@GrAGfAM`D]hHCh@InBGrAOfDGzAGnAKbCGjA?DIbBGvA?DI~AIlBGnACt@Er@GnACr@KdCADCp@GjA?FCj@Ex@Ct@Er@Ct@Cj@Ej@Cz@C`@KzBG`B?BGxACb@?NCd@Cv@Af@?HCp@Ad@?BAv@Ar@Af@AT?J?j@Az@?fA?`@?p@AV?nA?lB?HAh@?t@?nA?`@?l@?D?n@A^?r@?bA?`@?vA?TAj@?j@ARAz@A`@A\\?@GnAA^CXAZCXAXCZAXCXCVATIv@AVEXCXCXEXCXEXE\\CTEZEXEVEVEXEV]bCQnAEZIj@Mx@Kp@Ip@k@xDIp@G\\Ip@EXEXEXEXEVEXCVEZCTEXCXE\\CZCTE^AVCVCVIdAOnCCt@AZAVA^AV?ZAn@A|@Ap@C|D?B?rA?JC|JAj@?L?\\A~CAbHAhC?XA|@?j@C|HAjGA~DA^?bBAlCEpQAjGA|B?lAAZ?lDCxFAzGAlEAzCA~BAjFAlE?|AArE?PAXA~E?~BAhAA|F?lBAzAAzC?bAApDAhEAbB?zBApDAnDAvCArFAbFArD?fACtG?~CC`IAtB?rACdH?~CChF?|@AlCAhFAzDAtD?bCAtD?^AzA?~BAbEAvCAbB?tA?l@AvCAxD?fAAbD?h@?j@Ax@?tCAxB?xAA~@?bBAdC?nAAlA?pAAhAGrCC|AAXAx@GhCIvDEdCI|DC~@C|AElBElBCr@EjCCdAAf@CfAAl@A`@CtAC`BCx@C~@At@CvAC~@AZC`BAPCdAGvC?PAd@C|@A^Ah@Al@A\\A^Ct@EjBCpA?XGhCCjAAXAXCnAItECx@ChACpBClAEzACv@?NCbACvAAr@CdAAZAx@ElBEbBAd@GpCCpAEjBCdBAZAx@Ab@Ct@Af@ClAEnBC|@CrAEfCEtACfBCr@ErBExBCbBCz@C|AAb@AXC`AGtCG|CG|CG~CGbCClBCp@EdCA`@AZAXErCEjBAd@GzBAbACfAGrCG|CG~CIzDGzCG`DGxCG|CEbCGdCEbCG~CG`CCdBEnBGbCG|CG|CKjFA^EfCG`CGnDI|DEbBEtBGjDIfDK~FG|CMnFIzEKvEIvDIzDG~CCdBI`DIzDAbACvAExAEvCAf@AFEbCIxDG|CKdFCbBATAv@CjAAPA\\Al@Aj@ChAA\\Ab@At@C|@CjAA`ACv@AfA?RGvCEpBE|BCfACfAAd@A~@GtBAhAClAAPAVG`DC~AGjDIpDK`GGvCE`BKpFEnBEnBCpBAZA\\MdHIhDIjEInDEjBAj@KzF?HCj@WxMKtFAt@MrFAx@]nPCrAGjDE`CG`C_@bSUlLM`Ge@zUMlHAX?HEbBAf@E`CA|@E~ACZ?RA\\?DAn@KhF?Z?PC`AAv@EtBA`@A^Al@Cr@?TCnAClAIhECz@?JEpA?VANClACn@Cz@A~@AZAd@CbAAr@?`@IdEExBCbAApAChA?BE`BAVQzI?\\Ch@UtMMnFYbOGxC?DCfACr@Ax@AT_@rRGbDClAElBG~CCxAAdAClAEvAE|BQbJMvGA^GvC?VAZAXEjBCfBGdCAr@AXCv@?VAZAZAXCpCExBAXAZAr@I|DAT?TA^G|CAVAb@GxCC~AAf@CfBCpAAXA`@CjAAX?ZAXAX?XAZCr@?ZAXAZAX?XAZAX?XAZAXAZ?XAXAX?ZAXAX?ZAXAX?ZAN?HAX?XAZAX?XAZAX?XAXAZ?XAXAX?ZAXAZ?XAXAX?ZAXAX?ZAXAX?ZAXAX?XAZAX?XAZAX?XAZAX?XAXAZ?XAZAX?DAR?XAZAX?XAX?H?PAXAX?ZAVAX?ZAXAZ?XAXAX?XAXAZ?XAXAX?ZAXAX?ZAXAX?XAXAZ?B?TAXAZ?XAXAZ?XAX?JAL?ZAXAX?XAZCnAAX?XAXAZC`BEpB?XAZAX?F?PEhBAXAh@C~@?ZAXAr@AXCnA?ZANA^CrA?XG|B?F?XEbBCz@?ZAXAZAr@At@EhBAZKhGAZCnAEhBAX?XCt@ChBAZAr@Ct@At@Ar@Ct@KnF?XCt@Ar@AZ?XAXAN?H?ZCr@At@Al@GbC?ZGdCAz@ClACt@?XATAj@GrCCnACnAG~CChBAZA^ChAClAGlDCtAA`@CnA?DAR?ZAf@EtBCt@ErBCvAEjCA^An@Ct@?XCt@?XCt@?XAXEbCAZAXAr@C|@Aj@At@Cr@ChBAp@ElBAXAX?ZClACpACr@GxDAr@AZAXAZC~AOlH?REvBEzA?`@GbCAt@At@AXEhB?ZAXCt@?XCr@?ZCt@Ar@AX?ZEhB?XAXAt@AXAX?XAXAZ?TCx@ClACnACnA?XAt@Cr@?J?LAXAZAXAt@Ar@AXAZAr@AR?^AZAX?XAZAX?XAZAXCnA?VCv@?XCt@?XAXAZAr@At@AXAZ?XA^An@EhBAX?XCt@?XAX?ZAR?DAXCnA?XAZ?XAXAt@?BEdBCnAGbCAlACl@?`@CfAA`@AXCt@?XAZAXO~H?XAR?XAXA`@AX?ZAXCnAAt@CnAAX?XCnAAXAZAX?DAl@?ZE`BCrBCr@Ar@CnAAt@IxD?DARCjBCr@ChBCnAAZCr@?XAZAt@AXCnAAX?ZClAIxDAt@Ar@GdCAr@ClACpAAr@At@AXAX?ZAXAXAXChBAZAX?XAXAZAr@AX?ZAXEhBAt@Ar@AZAr@Ct@?XAXAZIdFAZ?FEhBAXGxD?@ClAAr@Ct@?XAZCnAAXEbC?FAl@CnAAX?ZAXAt@AXAt@AVAZ?XAZAX?XAXAZ?XARCtAAt@ANIlEAj@CnA?XCnAAXAt@AXCdA?HEdCAXCnAAt@AXAt@Cv@Ap@?XAXAZAr@Ab@APChBC~AEzAAr@AX?ZCr@?ZCr@At@At@AXAt@AXAXAZAt@?JAf@AXAZ?XAL?J?ZAXAX?XAZAr@At@AXAZ?XAX?XAZ?XAXAZ?XAX?ZAXAX?ZAX?TA^AX?ZAX?@AXAX?ZAVAZ?RA`@CnAAXAZ?XAXAZAX?XAZAX?XAT?DAX?XCt@?XAXAZ?P?FAXCt@?XCnAAVAZ?XAZAXAX?XCt@?XAt@EbBA`@Ar@At@AXAZ?XAX?PAF?ZCnAAX?XEhBAX?ZAXAX?ZCr@?XCt@ChBAZAXAr@E|BA`@At@CnAAXAX?ZAXAX?XAZAr@AZ?XC`A?LAXAZAr@Af@?LAXAZ?XCt@?XAXCnAAt@Cr@At@Ar@Ct@CnAAt@Ar@AZAr@AX?ZAXAXAt@?XCr@?ZAXAX?XAZ?XAXAX?RCr@AnAAXAXCnAAt@Ar@Ct@AX?F?RCnAAXAZ?XAXAt@Ct@?XAXAZ?XAP?HCnAClAAZ?XCnAAXAt@AX?XCn@?DAt@AX?XAXCnAEhBAt@AX?ZAr@EtA?@?XCt@?XEhB?XAZAt@AXAXAt@AXCnAAt@At@CnAAXCnAChBAX?DAn@AZ?XAXEjB?XAV?@AX?ZCr@CnAAZAr@AZAr@EjBAlACpACr@?XAZAX?ZAXAXEdCAX?XCnAAZAX?XCnAGbCCnA?X?@ClAAXAZ?XAXAZ?XCnACnAAZ?XAX?BAVAr@Ar@CpAAF?PAXApAE|A?JAX?ZEhBAl@?FCnAAXG`D?XADCbBCnAAt@CnAAXKhFAx@An@Cr@At@A`@?XAl@AZA^?NCx@CxA?NAXA^Av@At@AZAr@AZItDCrACjBCt@?XCfACjBCjAC|@?T?BAj@A`@AXAZ?N?HAZAX?XAX?@AX?ZAV?ZAXAX?ZAXAX?V?DATAZ?XA\\AV?XAXA^?RAT?V?VAP?B?PAP?R?PAH?LA`@A\\A`@A\\?^A^A^A`@A\\A^AZ?\\AVAX?\\AVAZ?XAV?@AX?XAZAZ?XAX?XAZAX?ZAXA^?RAZAX?ZAXAZA`@?RAX?ZAZAZ?XAT?DAX?XAZElBAr@AXAt@At@AZAZ?XAV?BAP?^AZC~AAJ?NAJAr@?LA\\AX?XAXAZ?XAX?DAR?XAZAZ?VAZ?ZAXAX?XA^?XATAX?ZAXA\\?B?TAXAZ?XAX?XAXAZ?VA\\AV?X?BAVAZ?ZAX?VAVA\\?ZAX?@AV?ZAXAX?P?HAXAZ?ZAVAX?ZAZAX?ZAZAXAhACvAChAGpCA|@EnBE`CAl@KtFAz@CvAEbCAj@APGhEG|CC~@Cr@Ab@CvACvAAj@C`ACjBAj@CbA?RI~DG~CCtAAn@G~BAj@GnD?@CrACvAEpB?PCvAGdCE~BA~@ItDA|@CfAGbDAXAj@GdDC`BAb@C|@?HAV?ZAV?ZAZA\\?VA\\?XAV?LAL?XAZCn@AZAb@?P?@AZAb@?h@AX?N?HAZA^AT?\\AVAZ?XAXAX?XAZAZ?ZAV?XAZAZ?\\AT?LAJ?XAZAX?ZAZ?VAXA^AX?VAZ?TAZAX?ZAZ?VAV?BAZ?XAXAZ?XAXAZ?VAL?NAZ?TA\\AX?XAXAX?\\AZAX?XAZClA?ZAZAX?XAZA\\?ZAXAV?XAZAZ?XAZAZ?XATA\\?\\ATA\\?XAX?T?DAZAV?XAXAZ?XAZAX?ZAL?J?ZAXAX?ZAXAX?XAXAZAZ?ZAX?XAXAX?ZAZAX?XAZAX?XAZ?XA@?VAV?\\AXAX?ZAZ?XAXAV?\\AT?ZAX?LAH?ZA\\AZ?XAZ?TA\\AZ?ZAX?FAP?XAX?VA^E`C?FCbBAb@E`BAt@CnAG|CCpBGjCGpDIbEA~@IvDC`A?TAZAp@AZAj@C`A?ZChAA\\?LALIrEAX?JAh@AZAdAAb@ClAA\\At@AV?\\ANA~@ClAAZAj@Ab@?XCnACv@Ap@Av@AX?ZCnAAj@ExAE|CCv@?ZCjAAXCnA?ZAXAX?XAZAZ?ZAXAX?XCr@?XARGzEAr@EpAChBs@l`@G~CChBAXAt@AT?ZAXAx@AXAXChBAXAZ?VAZAt@Ar@AXAX?ZAXClBEhB?ZEfBAlAA\\AX?XAZAV?^Cl@CdCCx@AZKrEAp@IjEGjDQnJAfAA`@Af@IlECt@IpEEhCEzBEbCWlNA^?RAX?JEzBGzDAXIrEChBAB?ZAn@AXCx@Aj@IxEK`HAVAv@AZIxDAt@AVGbDItEG|CClAChBAr@Cp@Ax@?ZCr@AlAAZAZClAAt@ChBCbAAj@[vPInEQfJMlHa@vTU`MGvDKvFAt@ATElBGhDS`MGvCKjFEjBCjBIvDAx@KnFCnAGpCGnDOnIARCtAExAElCC~ACz@Ar@ClACjAC|AClACvAAd@EdCKnFCrAAn@?XANAfAARKpFEbCAj@C|AMjHE~BKtEAl@EfCAv@ElBCfBCv@Ar@An@A^EhBAr@CpA?ZAVA\\Ap@GbDC~AC|@CpAAr@CjAAz@A\\?RAVI|DChACrAAv@ChBAZAVAr@AX?\\AVAt@At@AXA\\?TCf@Af@?ZAh@C`AClAC~@At@A\\Ar@AZAV?\\Ar@Cv@Ap@AX?XA\\AX?VAX?^AV?JAL?XA\\?XATA`@?TAZAV?ZA\\AT?B?VAZAX?\\Al@A`@AXAR?X?BAZAv@AZAT?ZAXAv@AV?XA\\?VAZA\\?VAZAZ?XAVAZ?\\AX?VA\\Ap@APAb@Ar@?ZCr@At@AX?\\AVA\\Ap@A^Ar@AZ?V?FAP?XA\\AVChBA\\AZ?VAXAX?ZA\\?TAX?DAZ?VAVAZ?XAZ?BAn@AZAX?VA^AZ?XAVAX?J?VAb@AL?RAZ?XCv@AX?ZAf@C~@AX?ZAXA\\?VA\\Aj@Cz@CnAAt@A\\Ap@A\\An@A\\?XAXAv@An@Av@CfAAd@?TA\\Ar@A\\AT?ZAV?ZAXA\\?XAVAX?ZAX?XA\\AZ?VAZAV?XA^AX?XAh@C`A?XAXAZ?RA^Ar@A\\?VAV?N?LA\\ChAA^?VAXA\\?VAX?XA^AV?XAT?\\AZA^?VAXAV?ZCx@An@ChBAXAZ?XAl@Af@Ct@CnA?NAz@AXA\\?XAt@At@?Z?@ARAx@AXAV?VA\\AX?H?LA\\At@A\\AN?ZAj@AN?ZAN?ZAJ?B?ZALAZAt@A\\?B?TAV?XAN?JAXA\\?R?BAZAX?XA\\C|@?LA^?VAXA\\?XAT?FAl@Ax@AV?XAL?NAn@Ab@AT?H?JA\\?@AT?XAZAt@?j@AF?XAZAr@?PAh@Ap@Av@AZ?RAb@?l@A^Cr@Av@An@Cx@Cr@Cr@Cp@AZGrAIjAAXCd@Ej@Ep@CXCZAVCZGp@Gv@?@Gj@CZGv@CXGn@?DGr@Gr@It@C\\CXCTKnAGp@Gv@Gt@Gp@CVABKjACXM`BANCTCXCXGp@CXKnAIt@APEj@CPGr@CTC\\E`@IbACPMtA?HGn@CZCZKfAQlB?DIx@?H]zDOdBAHM|AMpAKjAGv@Gr@KlAMpACTCZSbCCZGp@OhBY|CGr@WzCCZ?BKhAYbDIbAQnBw@~Ii@tGWvCYbDY~CCVOlBCTGr@OhBCXGr@CZCXCZMjBCTCXGlACZAVEv@GpA?DEl@GfBEpAARA`@AZ?XAZCr@?REvAAr@Ct@?ZCt@Ar@CnAAZAt@CnA?ZAXAv@AVARAl@Ah@Ap@Ct@CtAAn@AX?@?XCr@GbDAf@?JA\\Ar@AV?\\AVCdACxAAt@AX?DAT?\\AL?@CvACnAAZAt@AZAp@GfDAj@A^AZKdGAPAb@Av@Av@ClAG~CCr@?ZAXAXAr@A\\Ar@At@AXAZAr@AZ?XAV?ZAXA\\?XAVAVA~@Ap@ChAATAZ?^CnAAXAZAv@Ar@Ct@At@Al@C|@ChA?\\Ad@AP?XAVAr@AXAZ?ZCr@?XAPAf@CnA?J?JA^AX?P?BAZ?JAd@Aj@AJAt@?TATA`@Ap@C|@?VAZ?JAL?VA\\AR?D?ZAZAX?XAZAX?VAXAX?RAb@AVAx@CjA?ZAZAXA\\Ar@A\\?D?LAZ?XCt@?HAj@A^?HAh@?ZAt@?V?TAZ?`@?Z?P?z@?V?Z?X@X?V?^?V@V?@?V?R?F@Z?F?R@V?D?d@@d@@Z?@@T?\\@V?J@N@V?B?V@Z@X?H@L?\\@Z@X@X?D@R?X@X@N?D@^@p@?@@X?N@H@X@f@@d@@\\?T@F@p@@Z@X?\\@TBr@?J@P?X@V@\\@X@r@?@@V@V@\\?T@^@V@Z@X?D@T@Z@R@Z@Z@VBZ@L?JBZLjABZDXBVF\\?@Jn@DVDVFXFXFVFXFVFXFTHXHVHVHTFTHVJVJTRj@LZJTJTHTJTJTLXJTJVHPLXHPJVLXHTHRHPDNFLHTHTJXHTNf@L\\Nj@J^FTHZNl@DN@HFVNn@FXH\\Ll@DZDVFXDXDXDXBH@NDXDXBVJt@BVFv@D`@BPBZB\\@RBZ@XBZ@R@^@XBr@@Z@Z?X@Z@Z?V?X?^?h@?b@?XAX?ZAZ?XARA`@Ar@AXCr@AZ?\\Cp@?RCf@An@AXAXAt@AXAXAZGfCIzDAXAVAp@?PAJAZ?XAXAZAZAZ?VAZAZ?VAXAV?BAZCr@Ar@AZAZ?VAZAZAXAZ?VAZAZAXAXAZ?XAXA\\?TAZAZCr@?ZAZAXAVAZ?ZAXAZCnAAXAZAXAX?D?TAZAXAX?ZAP?FAXClAA\\Cr@Ar@?FARCr@?XCr@AZAd@MhFAXIpDIdECj@CnAOlGMrFEjBA\\?BAh@C|@KhEANGzB?BAb@GjC?BAp@ARIhDIrDAf@KxEKrEK|DCrAEhBGhCC~@CfAEjAAf@ChA?BCx@An@Cz@CfAAT?XEzACzAIjCG`DCx@SbICzAMnFMjFI|CG`DMfFI|CI|DKvDOhGClAEdBM~EMrFIdDIrDS`JYfMIpDAVKpDIjDCtA?PEfA?ZGbBAj@?XCh@At@GjCA`@GpBCbAEbCC`AAXCjAAXC|@ClAEfBATAZAx@Cr@CrACr@AZA`@?RCnAGjBA^An@APC`BAd@KhEIdDCj@Ah@?TALSpIAx@AXCr@MhGE|AYtLIdDi@fVMxEIdDAt@IlDIrCErBCdAOjGEbBErBk@lVCjAQ~G?NGlCEnAClAIbCC|A_@bOCpACbAE|AGpCCjAKrEInDMdFAd@CjAAj@GdBGjBMrFCfAIlEAt@AZCz@?RAZAVAZAr@Ct@IzDKzDAv@ClAClACr@At@EnACr@?HGtC?DG~BEjBYrLClAAX?TCp@A\\AZ?XCr@AXA`@An@AXAXClAEhBAb@?FALCnAEjBAn@A\\Ct@Ar@C`AAN?XA\\AVAZAXA~@CfAAVCt@AZ?VAZAXAZ?XAZAXAXAh@?RCp@Av@EfBAPG~BC`ACrAClACz@At@GnB?JChAElBEtACpACjAGhBElBOhHI`DCbACvAEhBKfEAb@A\\Ah@ExAMbGA`@ElAAp@EtA?XAVA`@Al@A\\Ar@Ar@?D?^?r@?j@@R?b@@`@@V?Z@XBX@X@XBZBXDp@@PHz@BXBXD\\Ff@?DF^BTLr@DXLn@FZLr@FVFTBLBJFTFZHVFXHTHZFP@BFR@DFRHXFPHVBBHVRn@Rl@^hAHRJXHTh@~ARl@HVHXJVHTHVHVHVJVHVHTRn@`@jAFRh@~AHTJVHTHXh@|AHTHVTp@\\dAFPVr@HXJVDPBBHVFRJZFRLXFTJXHVHTHVRl@HVHTHVJVJXHVHVFVRn@HXFVPn@FVFVFXFVFVDZFVDVFZDXDXDRD\\DXDXBXBVD\\BRB`@?BBRBZBZ@ZBV@\\Dv@?V@X@T@^?V@X?\\?H?L?X?X?Z?t@?nA?VAjB?t@?r@?v@?X?X?ZAr@?X?Z?X?X?Z?r@?t@Av@?r@AhBAZ?X?X?Z?X?Z?X?v@ApA?fCAr@?Z?V?X?Z?h@Ad@?r@?v@?lACjG?t@?t@AdC?J?h@AxD?t@?t@Ax@?n@?t@?\\AtDApA?X?P?pBAt@?r@?t@?t@AbA?J?t@?t@?t@AV?nA?hBAt@?Z?N?~@AdCAxD?jB?t@AjB?zA?L?\\Ap@?pA?V?RA`@?r@?jB?t@AbC?t@AhB?bCAdC?nAAnA?t@?r@?X?j@Aj@?j@?h@?l@?XAvA?vA?d@A|A?vAAtA?j@AjC?Z?Z?rAA~CA`C?dC?v@AdC?nAAd@?h@?nAAjA?x@?r@?pAAjB?hAAlA?r@CbN?jBC`L?|@AbCApFAxDA|B?D?nAAnB?dC?j@?@ArAAfD?b@?j@?V?r@?^AX?Z?F?b@?t@?^?DAp@?r@?h@?d@?r@?d@Ar@?j@?r@?r@?FA\\?p@?h@?\\?\\?T?VA^?X?\\?X?D?R?\\?X?X?VAZ?Z?\\?T?\\?V?\\?X?F?@AZ?b@?^?Z?R?^?\\A\\?X?V?Z?X?H?@?H?^?T?X?p@?b@?NAzA?T?X@`C?jA?v@AP?x@A^AvA?JAhA?D?^?\\AZ?Z?V?^?P?ZA\\?Z?V?V?r@?pA?`@?RAlA?T?d@?V?X?X?XAb@?hB?j@AT?T?@?x@?^?`@?T?t@AX?Z?Z?X?\\?T?Z?XAZ?V?F?P?\\?Z?p@?XA\\?V?Z?Z?X?Z?T?\\?XAT?V?dE?`A?@?x@Ap@?nAAZAnBAfA?b@AP?Z?lA@r@?X?P?b@?XAr@?v@?D?T?T?^?r@?v@AX?V?Z?t@?l@?`@AT?^?Z?B?T?T?\\?t@?ZApA?j@?H?r@?n@?X?`@Ar@?@?Z?n@?x@?l@ApB?T?^?X?X?VA^?Z?Z?~@?d@?x@Ap@?D?R?Z?\\?V?\\AnA?l@?z@?Z?Z?\\?`@A`A?xA?p@A~B?h@?F?p@Ar@?dA?rBA|A?rAAnD?|B?HAb@?nA?hB?n@?d@A`@?X?ZAX?P?F?Z?Z?T?B?V?N?JAZ?B?T?X?rA?dA?^?L?R?T?P?XAn@?\\?P?^?j@?Z?T?DAT?\\?X?X?b@?j@A\\?Z?\\?X?V?b@?l@Ab@?\\?l@?^?f@?j@Ad@?j@?Z?\\?^?X?X?Z?ZA`@?Z?L?\\?p@?H?T?T?n@?`@A\\?@?X?N?F?^?X?P?B?b@?p@?Z?X?\\?RAv@?p@?Z?B?V?Z?Z?Z?V?R?H?X?\\?V?Z?V?h@?L?jB?J?\\?h@?n@?`@?T?D?Z?X?V?Z?Z?X?V?Z?X?\\?V?L?f@?V?\\?T?N?v@?X?\\?^@fE?`@A~@?h@?lA@l@?FAjE?X@R?\\?Z?R?`@?X?L?R?dA?\\?nA?t@?\\?^?r@?bB?pA?n@?r@?|@?z@?p@?b@?P?p@?\\?P?b@?~@?T?`@?v@?l@?zA?~A@lA?R?\\?t@?t@?n@AnA?^?R?FA`A?bAAr@?x@Ar@AlAAx@?t@Al@?`@At@Ap@?\\A|@Al@?ZAX?X?XAV?^?XAV?^?XAV?ZA^?h@?\\Ax@Av@?f@Av@?XA`@?ZA\\?X?XATA|@AnAAxA?l@AN?x@Av@Az@?VAXApA?Z?XAt@Ar@ApA?ZAX?t@AZ?X?ZAX?T?^AX?X?ZAT?D?NAf@?Z?PA^?X?`@AR?XAZ?Z?XAZ?Z?XA^?\\Ah@?h@A^?\\Af@?L?\\AXAv@?x@Al@A|@Ap@?X?ZAj@?d@AX?X?ZAl@AvAAZ?LApAAx@?`@Av@AnA?t@Ap@Ar@?\\AlAAr@?b@AN?^A\\?t@AX?\\An@?NA`A?\\?ZAZ?V?ZAX?ZAZ?X?ZAXA`B?d@An@Ax@?j@Az@A^?V?^At@?TAb@?l@AZ?t@An@AZ?^?NAj@AhAAx@?`@?^At@ArAA`@?XAt@Ap@?V?^AZ?b@?PCfBArA?t@ApAAt@Ap@ApA?b@Aj@A^?\\A`@CnCAtACzC?J?d@A`@?j@Al@?d@An@?f@At@?\\Af@A|@Av@?f@Af@Ar@?t@Av@Ar@?v@AB?p@Al@?\\A^?f@?b@Av@Ar@?X?^AX?f@AT?TAn@AfA?z@AT?|@AhAA^Ap@?^At@Aj@?V?f@An@Ab@?PAn@?d@At@?b@Al@A|@?|@?BAt@?^CjA?z@Ax@AjAAt@?XAr@Ar@?ZA`@?Z?ZARApA?R?VAd@?T?L?^Ad@Ap@?D?Z?XAn@?T?FAZ?p@A`@?R?VA\\?XAX?X?@?X?x@Ar@?F?L?\\?Z@Z?x@?F?|@?^@h@?n@@h@@t@@Z?Z@f@@d@Bv@Bz@@f@Bt@Bf@Bd@@b@Dr@Dv@Bj@Dv@@TDd@Dn@B\\@XBXBX@XD\\Dp@BVBPDf@@PD`@Fn@B\\DXD`@Ff@BXD^D\\Hr@BVBTDZBZBL@JBXDZBXDXBVDZBZDVBZDXH~@Db@Db@Db@BTBZDZBZ@RBXD\\@VBXB\\BVBZ@XBX@VBZ@ZDr@?BBV@X@\\@VBZBr@@X@X@\\@V@\\?V@XBv@@p@@b@@p@Bz@?j@B|@@r@B|@@b@?h@?H@X?X?Z?n@?v@AfB?rA?v@?rA?v@?lA@bA?xA?lB?`A?n@?V?`@?f@?d@?j@@P?j@?r@?~@?p@?p@?v@?v@?^?n@?r@?Z?^?l@?`E?lA?v@?hA?x@?n@?t@?t@?t@?t@?t@?n@@t@?^?X?t@?X?ZAZ?X?Z@lB?z@?n@?pA?nA?`C@rA?v@?R?x@?`A?r@?n@?v@?fA?t@@rA?bB?jC?lB?~A?rA?^@r@?jB?jB@rA?r@?tA?pA?n@?fC?tA?nB?`@?^?zB?x@?bD?vA?vB?nC?j@?r@?rE?lB?lB?j@?dD?v@?vA?vA?jC?j@?`B?tA?nD?V?R?j@@zE?fG?lD?dC?lE?x@?j@?rB@nF?vE?jA?tE?pF?f@@~C?t@?Z?b@?h@?`C?rD?~B@zC?X?X?Z?fA?fC?|@?jA?l@?J?lA?j@?J?fC?lA?Z?pA?X?v@@X?V?`A?lB?X?P?d@?^?dB?`@?l@?t@?pA?X?|@?l@?X@t@?t@?X?~@?j@?Z?X?X?X?pA?pA?r@?t@?pA?X?jB?Z?X?Z?nA?r@?pAAt@?ZAX?XCt@?LAPEhAAXAZCn@Er@Gv@IpAGt@It@Ir@Gl@OjAMz@Ir@ET?BKj@Gf@UvAW`B[tBMt@Kp@Kt@Kn@EZGXEVQlAWdBSlAKz@Ij@Mr@Kr@Ir@EVEZM`AEd@O~AI|@?HEh@G|@CZA^Cf@Cr@Cb@EbBCt@Ax@Cn@AXAt@Cz@ChAE~BEtAE`CEtA?XE~AC`ACnAAb@ARAXAv@Cp@Ax@EbBCz@An@ClAEnAAr@EhBObHElAEpBAp@AVAXAXClAEbBCbB?BE|AGpCCzACn@?ZAZAVAX?ZAXAX?XAVCv@?XAd@C~@Cx@?LCbAA^Al@AXAZAX?XCp@ChA?HAX?XA`@Ap@Cp@Aj@Ez@Cd@EbAAVIbBOfCKbBEn@Gx@S`CMnAK`AE^In@Iv@M`AEf@G^MbAGd@CTKj@G`@UzAWdBShAMp@EZGZKj@Kd@Kf@Id@GVUhAS`ASx@GVGXQp@On@GVIXGVGVIXGTGVGVIXGVGZGTCJELGTGXGTIVGZGTGVIXGVIVIZGVGVQr@GTGVIXETGVIXGTGVIZGXkAzEOn@Uz@a@`BCJIXEPQn@Ol@I\\IVq@rCIVMj@ADOh@Op@s@rCKd@Mb@IZi@vBQt@Oh@GV[nAGVQn@Mj@c@fBK^Sz@[pAOj@{@fD[pACLGTAFERQp@AFMf@CFOp@Mh@K\\[nA[pAELEPQn@Op@WdAa@`BU`AGV]rA}@jDm@dCYfASx@CHOn@GRa@bBOl@GR[hAOl@e@~AADYdAGT]jA]hAEPABCDCJABMb@K^ABOf@IVEJu@bC}@rCA@GRITIVGRKVKVITIXIRKXGRKVIVSn@ITITUp@Sj@KVIVIVKXIRIXIRKZITITKXSl@Sj@IVKVGTKTIXKVIVGRKVKXITIVKVIXSj@KZITKXIRO`@M`@KVQh@KVQj@Sh@Sl@Un@CHELITa@hAIXSj@Up@IVKXIRIXITKXEJCFIXITITKXITKZIRKXGRKVITITKXITITIVKXIRIVKVGTKTIVIVIVITKVSl@IVITKV?@ITIXITITKVIVKXIVITIRABGRKVGPIXKXIRITIVIVKVIVITKVIVIVKXSl@ITKVITIXKVGRIVKVGRKXITIVKTIXITKVIVIVIRKXGRKXGRA@GRKXKVIVITKXIRIVITKZIPIVIVA@ITITIXM^O`@IVKXIRIXIPKZGRUp@KVELAFKVITIXITKXITITIVKVITIVITIVKVQh@KZIRITKXITELCHUn@IVKVi@~AITUn@GTKV_@bAKZKTGRUn@ITITIVIRKXGTITKVITIVUn@[bASl@IVITWp@IRIVKZITITKVIVITITKZGPKXSn@ITIVADGNIXIRKXGRKVGTKXIRIVIXITITIVITSl@Wp@ITITKXITIVIRKXIXITKVITIVIRKZITITITKVIXITKVITITKXIVITGRKZSl@IRKVGTKXIRIXIVITKXIVGTKXKVGTIVKVGTITIXITITGVITIXIVIXITGVKXGRIXIVIVIXITIZIVIVGTIVITIVIXITAHELSn@IXIVQj@IVGTSn@Qj@KZIXQl@IVITIVIXIRIXIXKZGVIVGTSp@ITK^K\\EJSr@Ut@_@jAg@`B]fAGTQn@IXIVSn@IXIRIXGTKZITIXMb@CJGTUp@Qn@KVGTCJELITIVIXGTKXGVOd@CHGVIT[dAQl@IVQl@IXIVGTIVIVIVSn@ITEPCDGVITQl@[fASp@Ql@IVIV?@ITIXGTIXIVITQl@IVIXITENCHIVGRSn@IXITIVSn@Qn@ADGNGT?BITIVIXITENCFGTKZQn@[dAIVQn@IXSj@IVGVABGRIVIVIVIVQn@g@`BYbAGVITIVIVGTKXGTIVITKZGVA?Qn@IXIVIVIVGTGTIZITIV?@GRITITIZGRKXGVIVITIXGPCFGRIVIXSp@ITAFGPIVIVIVITm@xBKZ?@[bAQj@EPM\\Mb@a@tAa@pAOh@a@tA[`AOd@Of@GVITIXIT?@IXIVQh@Ql@IVKZGTQj@Sn@IVIXQn@ITK\\Oh@KZIVIVIVIVIVIXGTITIXIVGTIVENCFIVIVIXGVITIXIVSl@K\\Oh@GTGRIXIVIVITGTIXENCDIVGVIVIVGVQf@K\\IXGVITIVIVIVGVIVKVGTKZGTIVIXGRKZGTIXELCHIXGTIVGTIXIVGVCHELGTIXQl@I\\GPIZIXCJCLQj@Kb@Mb@IXGTIVQp@GTGVMb@?@Of@EPGVIXIVQn@Md@[nAc@|AI\\CJMd@Kb@Sr@Mb@Mf@ELIVGTGVIZ]rAMj@ADGXKh@Mr@I\\GVGVIXGTMd@EPGRI\\GTCNKd@YpA[pAWjA_@bBo@pC?@a@~AQp@Qn@YfAQp@Qn@cAvDUx@Ql@YjAQn@YdA]rASt@Sp@YhAIXENMb@WbAYdAQr@Sv@]lAIZQl@U|@[jA]nAa@~AGRWbASt@Sv@Qj@Sx@cAtD[nAm@vB[dA]fAADY`Ag@|A]jAGP]fAo@tB]dAo@vBSp@GRSn@Ql@]hAQn@ABQj@YhAK`@Md@[hAU~@Ux@YbAIXKd@CJm@|BYhAUx@c@bBYfA]lAOh@CLWz@Qr@]pAUz@a@zAABm@|BSt@]pASv@Sr@On@a@vAa@zACJa@zAEN_@xAYfAABMh@Qn@Ol@]lA[fAI\\IVUx@c@xA[dAY~@Sp@EPY`AY~@a@vAOf@Uv@]fAEPKZuAjEmBnGk@jB_@nAM^oAbE_BpF{@nCo@tBAFIVCFENIXK\\Ql@Qh@K\\CHQj@K^ABUv@CD]jA]fAIVYbAa@vAQj@IVQj@IVQj@Sn@IVABc@tAo@xBg@bBMb@IVGVA@GRIVIVGTITIXKXQl@IVIXUv@GN[dAELiBnGCJ_@nA[`AK\\Sl@A@Qn@Sh@IZQj@IXSp@g@~ASp@wAvEw@lCIVIVQn@]fAQj@IXITGTGTGTABOf@?@Sn@Of@Of@CJKXOf@Of@IVELADKXEPIVABGPIVGTGN?@M^Oj@CDIVGVIXIXe@zA?@Ut@Qj@GPK\\IVITIXIVIVIXIV]jAIVENCHIXIVIVIVIVIVGVw@jCM`@aA~CENc@xAc@tASn@CFK^Qj@CFOd@GRGREPGPEPGNMb@Md@CHIVSr@GPM`@K\\IXELCFSn@[dAIXIXGPADIZw@fCM`@Qn@ITK\\EJUt@GVg@`BWx@GTM`@ABOf@ENIVIXELM`@ABK\\CHGPK\\CJKZCJKZGTGNGPK\\K^M^Od@IXELMf@A@Md@ADK`@EPITGVQf@?BOb@Qh@Od@Oj@Od@Mf@K\\AFOf@Mf@ABOl@IVQl@IVGVMb@Yz@Md@Of@GPSl@ELY|@ENWx@Uz@GRGVK\\Ql@ADWx@Wt@IVk@jBAFOf@Ut@Sl@EP_@nA]hAOf@ITGTIXSt@Up@Up@?BWv@M`@Oh@KZM`@Of@MZABYz@]dAUl@Wr@Sh@Sh@_@~@sBlFWr@O^CBa@hAOZO^GNO^]~@Wj@Ob@Sd@MX?@Wn@MZSb@c@dASf@A@]`AIRMXa@jAWl@O`@Wx@Qf@K^Mb@K^CFIXMf@K`@Qt@Kd@Mf@Ib@Q|@AFI`@EXETGd@GZANGb@G`@SfBCXGp@Gz@G~@IzAAPAXCj@AXCb@AZC^Ej@G|@AVI~AATATEt@Gl@?FGj@?@Gh@Gh@WbBOtAETETQdAKn@AFG^CTOt@Kn@UtACTEPEVIf@Ij@G^GZIb@G^Ih@ABId@AHG^CNMp@CPCJGb@Ib@I^Kn@A@If@Mh@EPGTOh@IZMZGPITQj@Wp@KZUh@OZUd@S^W`@]n@KNOVKNYb@OREDEDWX[^SVUXk@p@c@j@KLABYZ]b@qA~Ag@n@A@q@v@QT[`@]b@]b@ILEFQVINMTOTKROT[n@CFKNOZQ\\Qf@Wn@Ul@?@Sl@Oh@K\\Sn@Qr@S~@]bBOp@Mp@YjAOp@On@Mh@Oj@Op@ERGTK`@Ml@CHMj@GVYhA?@Qr@Qr@CNCFOp@I`@I\\ENWfAGTEPOr@GVAFQh@IZITIVADMb@GLITWj@CFO\\ABQ^MVMVMTGJOXYf@CBOXWd@CDCFU`@GJO\\KTGJMZKVO^M^GVCFU|@AFI^CJAHEREXGZGh@CPGf@ANAJATATC\\AXARElA?DAd@Cj@Cj@Al@Al@Ch@Ab@Ch@EvAElAAFEvA?REbAAPCx@A\\?X?DAV?h@?n@?J?P@b@@Z@b@B^B\\BZ@HBRBTBRDTBRHd@FZ?@DTBNJ`@Nl@J^L`@N^JVDLDJP`@NZJRFLDHR\\Tb@JNNXb@t@^p@T^T`@PZNTR`@b@t@T^NXRZb@t@PXNVR^PXJRLRVb@JRLTRXT`@JNJPRZNRNVJNLPHNTZRZTZX`@RXX^HNLNFJfChDfAxALNnAdBZd@d@r@|@vAv@nAV`@^l@b@t@T`@v@vAJPh@`AT`@NXTb@P\\R`@`@|@`@x@@DXl@j@nArA`D\\x@P^Xt@Zx@Tn@Tl@LXL\\\\`ATj@HVTj@JXTl@JT?@^dA@?Ph@Rf@N`@HTRl@BDPh@Tt@@BLb@XdAPp@J`@ZrA@H@@F\\Jh@Jf@f@hDH`@?FHh@@FFh@Dd@@LFr@@RFp@@B?DJlAJpAD\\Fx@BZBRBZDXFr@@P@FFp@B^Fh@Fz@DXBZFn@Ft@BXFt@B\\?@Hn@B\\@PNvANbBRtCb@rE\\zDDb@LdAJbADh@D`@LzAFn@Fn@ZrDRtB@JFh@Fj@Hl@DXFXLl@FXHZBLBFFVHVHTL^FPJTJXJTLZd@z@Xb@LRHJDDFHh@l@^^PPFHFDPNNNHFHF^XBBfAp@LFJDRJNFPHTJXJTHf@PXHPFJDVHVHh@Pd@Nh@PRFRHRFd@NB@RHLDVJLFJDRJLFLFTJTLHFFBTNHFHFRLHFHFDDLJPLNPHHRPPPLPNNLPNTNRLRFJPXJPLVJRLXHPJR@@LVVh@LXHPLTJRLTHNNVR\\V\\FJTXX\\VX@@JLRPHJVRNLNLDDHFNJZTJHVP@@PLRLPLDBJHPNRLFFVRb@\\B@f@f@B@BDNLDFJJNRLPJN?@RTFJDFLRLPHLFHLRHLBF@@JNFJBDPVXb@FFDHPVLPLTn@bAPVLRl@~@NTXb@\\h@j@z@\\h@RZFHNVHLJPLRd@r@T\\R`@DHJLj@~@JPLPDFj@|@LRX`@LRNT?@@@T\\Vb@FJLRJPJP?@JPLTP\\JTDJDHLXPb@NZJXRj@JXJZPn@Pl@FVH^DPTz@FXLl@BFBPF\\Hd@@FFZJz@Hr@D`@BL?@Bb@B^B|@Dz@FpC@nC?\\?dB?j@?pB@nB?~@?V@jB?hA@j@?b@?N?j@?h@@j@?N@x@@b@?V@b@@fA?h@@J?v@?Z@n@Ap@?B?JA~@AZAd@AN?H?PCf@Ad@AJANATARA`@CVAZCRAZCXARADC^En@ANI~@C`@ATCl@A^AZ?VAL?P?X?V?\\@Z@d@BZ@\\B\\?@Dh@@H?DFb@BXBTDVHl@Hd@Lf@Hb@Ld@HZFNFTDJDLBHDH?@Tj@BFDJLXDJLXXh@PXR\\LTLNd@n@VZJLFHt@bAh@p@p@x@`@d@VXTXRTPTHFFHLNJLBD@?BDRVr@z@RT^d@\\`@p@z@VZFJZ\\bAnAj@p@rA~ABBp@x@t@|@|@fA~@jAx@`Al@t@n@v@`@f@b@h@pAzAfB|Bt@|@VXVZRTZ`@VZ\\`@bBtBjAvA@?`@f@j@r@t@|@JLb@h@RTX\\PT@@x@bAh@n@PTX\\t@|@t@|@h@p@FH^d@LLLRPTLPT`@DDXd@Td@PZP^FL`@bAN\\Nb@JXBHJ\\@FNf@Jb@Nj@RbAFZBPLx@Hj@Ht@Dj@Df@FdAFhABv@@b@FpBB`ABn@@V@XD~@Bt@FzABl@?L@JHfBBp@DdABn@H|AHtA@NHfAFv@Dh@Ft@LrAHbAHl@B\\Fh@BVFj@DZJdAJx@Jv@NdA?DHd@Hh@Lz@PdARlAHb@Lp@Lr@F^Hd@RdAFXF\\H\\Nr@P~@FXFVH`@DNLj@Rt@@HRv@Nr@FXLj@Jh@F`@F\\BR@HN~@@LDXBPLfAFr@@JDn@BX@R@b@Bb@?NB\\?V@\\BhA?DDbB@`@?RBt@?V@^@f@@d@DjBH~D@h@Bx@BrA@^?ZBbBBvABnA@V?@BjABv@@RBt@@n@Bt@DnABxABbA@n@BfA@|@@j@BlA?`@@F@`A@f@?H@XBl@?R@T?VBt@?L@r@?j@Ax@?TAXAf@Cv@C\\Ej@?BARCRCTAPMfACNGf@EZAFCNCNCJETABGZCJCPGTIb@K^CRQr@GVGRCLa@|AU~@Mj@Ql@WhA[vAI\\GZEVI`@ETIh@YzBABAHK`AOfBGbAC^AJEbAAj@Aj@?^AVAvA?`A@vA?j@@lABZPpFDvA@d@FzA@XDv@D`ABx@FvADrA@XD~@@\\Bt@B~@@X?P@\\?V@P?L?bA?^A\\A^Ad@ADAb@Cp@CVEj@CRC^Gd@It@EXGf@EVIb@Ml@Kh@Md@ERGTOh@Mb@ITENOd@KTELADCDKXKTUd@O\\a@z@q@xAIRsAzCw@nBABcAtCs@zBK^Sn@IZOf@Qn@IRERELq@~BMf@_@pACHK`@[dAw@lCIXK^Mf@Of@CH[hAAD_@lA[fAK`@W|@Of@K\\CHOd@Wz@Uz@EROf@K`@IXER[hAM`@CJK^ENI\\Of@Sr@CJGRK\\Of@ADWbA]hAUv@IVMb@CLg@fBq@~BOf@Mf@GPGTq@~B_@rAa@|AA@Md@?@Od@?@Od@[dAW`AWx@y@nCM`@IXUx@YbA[fA]fASr@g@|AKZSt@KZCJGR?BENIV?@IVELU|@Qn@Oj@EPGR?@Qh@Mh@m@vBK\\?@Sn@Mf@Of@Mf@WbAe@xAAHOd@GPIZIXm@tBOh@Qn@e@bBKZW`Am@xBCDENQj@y@xCABOj@a@xA_@nAAFK^CDCN[fAYbAMd@Of@AD]fAg@dBGVK\\Y|@e@bBK`@Oh@i@jBITGVIVIXQn@yAnFKZCJ]hAMb@IVERCFOd@K`@ABIVSp@Sn@GVGPADSn@IVGVITIVQn@?@Ql@Sn@GVSr@Y`AADSp@]jAOj@Ql@Mj@Mh@c@zAY`AMf@YfAM`@[fASr@CJK^Qj@IZIVMd@Mb@GVEJMb@Qn@IVEPMb@Ux@Ux@Wz@c@|ACHIV[hAiA~DaAnDa@vA_AhD}@zCERGPk@tBw@lCwClKCJMb@K^Of@Od@q@bCoArEs@dCi@jBGVc@xAK`@g@hBw@nCe@`BENUx@Of@a@rAM`@]nAOf@A?ELIVSr@_@nACF[dA{@pCSr@y@nCc@zAkAvDe@~AUt@g@`Bg@~Am@tBQj@Ul@g@~A[dA[fAM\\Mb@Oj@Ur@ENK\\[dAGPUr@Y`ACH[bA[fACFW|@c@xAGPWx@Ql@O`@G\\Ql@a@rAIXUv@_@nAs@|BW~@GRKZ_AxCCL_@jA]hAMd@GTUp@q@xBY|@Sl@e@|A[fAGVIVOf@]nAe@vAIXQp@g@~Ae@|A[fAy@jCITQh@i@dBSn@Mb@Ut@IXu@bCy@nC_@lA]jA[bA]fAe@`BK\\Sp@Of@Ob@k@jBg@bBq@|Bg@`BKZUv@W`AMh@Mf@GVKn@GVCNAFEXEZEVEZEXC^CRE^CVAXCXC\\AXCZAXAZ?TA\\A\\?Z?ZAZ?J?H?^AXAnA?ZA\\?XAt@Ap@?v@AnAAv@Ar@?^A\\?RA\\?t@At@Ar@?v@Av@At@?r@?v@?p@?^AT?Z?t@?v@?t@?t@?t@Ar@?v@At@Az@?p@At@?t@?t@Ax@?t@At@At@Ar@?x@Cp@Av@Ct@Cr@Ct@E\\ATGr@G~@En@KlAMjAK`AK`AG\\U`BOfAO`AKt@[tBIj@SrAIh@SzAIh@Kr@CJQrAUzAIp@Ij@Iz@Q`By@zFe@fDYjBWlBKp@Kr@Kr@QjAKp@E\\EVMbAM`AGj@E^CTCXCTEt@C\\En@Ep@CnAAv@At@?r@AX?L@j@?\\@r@@r@@N?F@V@X@R?HBp@Dt@@J@LB^BRBXBXBVFf@Fd@Hf@Hn@Hh@Jv@Hn@Lv@?@DVLdAF^DXBVDXF\\BRJt@BXDVHj@Hv@DZHp@J~@`@jDP`BFn@H|@LnALbBJfA?B?BFx@@D@L?FLhBB^Db@Dx@JfBDt@BX@VFnA@XBt@@XBr@Dt@DnA@XBlA@X@Z@X?X@Z@X@X?X@X?Z@X?X@Z?X@V?@@dC?lA?t@At@?p@ApAAl@AX?V?TA\\Ar@AZ?XAXAv@Cr@AZ?XQhGCx@Ap@A\\CXAZEnAEr@GnAEt@AXCXAXABAVInAAVCZCXEt@CXAZCXAZCXATADAXCXAXCXCZAXCZCXCXCXCZCVEZCXCXEVIt@Kr@Ir@EXEXOjAEZAFCPOnA[|BEZIr@ABCRIr@Kt@EXCXEZAHANCX?@CVCXAZEr@?\\?ZAX?F@PBfAFjA@HDn@LpA?FRxBX~CTdCZ`D@TPbC@f@@T@R?BBb@BxA@vAAzCGxB?JEdBGbCAx@AdA?|B@N?d@@h@L`DDr@N`BNzA`@xDTnBV|B`@xD^bDPdBDXJfABVBRLrANpBH|BDpB?r@@vACtBUrG_Bbc@_@hKG|AIxBM`DOxDEjAInCCh@MnDQnEGtAAZ?HANEjAAXCh@?NM`DE|@Ad@A`@Ev@ATG~AIzBEdAIvBSdGg@pMI`CIrE?hA?t@?N@l@?R@TBrABp@FfAHpAB\\@D@LJhAFb@BN@LF`@Fd@RrA\\~Ab@rBNt@FR\\nAXfADLp@vB|@hCjBtEjCtG`@bAXr@z@vBd@hAl@~Af@lAXp@^`AtAjDN^Xp@j@tAlA|CdAfCl@|Av@lBf@pAv@lBzCtHhAtC~@zBfAlCb@hAL\\L^",
                      },
                    "start_location": { "lat": 35.5008876, "lng": -97.8963328 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "317 mi", "value": 510161 },
                    "duration": { "text": "4 hours 32 mins", "value": 16298 },
                    "end_location": { "lat": 35.1719923, "lng": -111.6528567 },
                    "html_instructions": 'Keep <b>left</b> to stay on <b>I-40 W</b><div style="font-size:0.9em">Entering Arizona</div>',
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "i`fuEnjkjSVh@T`@FRLXTj@JVJTj@xAPb@Rd@Pd@JTXr@d@hA@BHR`@bAx@pBZv@Pb@Tj@JV`@bAXt@Rd@l@xAn@~ARh@HP?@DHDJFLDJ@FHPHPHRJXl@xATl@Vj@l@zA`@bATl@JT`@bAJTPb@N`@JVHRJVHTXn@HTJTJVJVPb@Xr@JVv@pBRd@DPDLtAhD|@|BVn@Rb@z@xB@?JXlAzCzAtDx@rBr@dBzAtDVp@LPFPLZLVTl@LXL^h@pAJVHRTj@Th@Vl@Tj@JTXn@Tl@FLBHb@bAJVJXTh@L\\Rf@Pb@N\\Vl@Vj@JVJTVj@n@xATj@JRJVHNLZTj@JTTl@JTVn@Tj@JVTh@Vp@Tj@b@dATl@`@bAHVTj@Tj@Vn@`@bAN^Pd@Vn@l@xAJVTj@x@pBFNL\\JVTj@Vl@@DHRZv@DHJV@@Rj@Rf@Xp@@B`@bATj@HPZx@BFHPLZHRJVJT^bALXDHBFFRDHP`@LZTl@@B`@~@Rh@LZ`@`AJV^`AVl@Tl@JTBFHPHTb@bAHTHRLXHVJTJVFNL\\BDN\\FRLXJXLXLXHTb@dAHRXr@L\\N\\JXj@tAVn@Xn@Rh@b@dATj@`@bAb@hAb@dATj@Tf@JXJVPb@N^Rd@LZPb@N^JTTj@DLDHJZHRTj@Rb@N^Tj@?@Xp@HTTj@JRBJFN\\x@BFJVTj@Pd@Rb@FN^`Af@nARf@JVBBFPJVXr@lCxGp@dBFJfBlERh@b@dAjAtCbEdKBH@BZt@n@~AJXJTVl@DLDJLXx@rBlAzC`@dAPb@DJJXLVL^@Bd@hAl@~A^|@HRJV`@~@FNPb@Pf@N\\Vl@DNd@fABFXr@FPb@dADHd@lAXr@f@lAhArCn@`Bb@bADJHRTj@JXTh@Zz@HRTr@d@xAf@|AJ\\d@dBFXR|@Rz@?@Lf@?@RfA@FPbAX|ALx@F`@@HNpAJdANzADr@@B@NJnAL|ALvALtARbCJrAH~@t@vI`@vELdBPjBThC~@jL`@xE^vEd@tFFt@Ft@Fn@t@~JZrD|@vK@LHv@Fr@LdBPnB@PFr@NdBBXFt@JlAFp@BZBZJjAFt@R`CBT?BBXDX@VDZDr@LnADp@N`B?DFt@NfBBZBXBXDZ@VBZFp@@BDp@Fr@BXFt@Fr@Fr@\\vDJlAFr@BZFn@Dd@Dj@JjAFv@Fr@LxA@LJnAFr@JnAFp@Fr@Fr@Fr@BXV|CBXJlABZBV@D@TBVBZJlABVBZBXBVFt@BXFr@Fr@Ft@Fr@BXBXBXBZBXBXDX@XBZDX@VDZBXBXBXBXFr@BZBXFt@HjAJlAHt@JlANfBRbCFr@JlAJnAJlAR`CJlAFr@RbCFv@JhAJlAFt@Fr@Fp@Fv@Ft@JjAFr@H|@H~@B\\Ft@JnALhBZ~CHr@Fr@TzC^nEFr@BZJjAFr@JlAFr@Hz@@RFr@JnABXFr@BXBXBXDZRhCb@bFDb@LzAFt@PhBFr@Jr@Hr@DV?DHj@Jt@DXDXDVJr@NjADVJr@Jr@Jt@PjAPpABTPhAJt@Hp@Jp@PnAPjAJp@Jr@BXDXFZHp@PjAJr@Jr@Jr@Jt@NjAJp@PnAJp@NjAPlAJr@Jr@Jr@Z~BJt@Jp@Hp@PlAJt@DVTdBPlAPjAPnAJp@Hr@Jp@R`BF^Hp@DXDZDVJr@Lr@Hp@^`CPjANlAPlAJr@NjAJr@PlAJp@Hr@VfBPlAJp@Jr@Hp@PjApAjJJr@VdBJr@Fh@@HPlAPlAPlANjADRJx@Jp@PlATfBJr@VdB`@xCPjAJr@Hh@Fb@Jp@NlAz@`GTdBPnAPhA?@VhBTdBVdBVfBl@jENjAPjATbBVdBNjAPjAPjABPJx@PjATdBPjA`@vCJr@Jp@BPLx@Z~BNjAFZBTJr@Jp@TdB@BNfAVdB\\|Bd@pDl@jEVfBNhAJn@PlAJt@Z|BVdBj@fE\\~B\\`CBXVdBp@vEh@zDZ~B?@Jn@f@tDZvB`@hC@NZzBZ|BF^h@|DL~@ZvBJr@DZJt@NfAf@nDHd@Ff@RtAJp@BND^VfBd@hDLv@Z~Bp@zEZ|Bf@hDPrAF`@N`AJz@BNDXDXVdBFh@BHHp@DVPlAHn@?@Hh@Fb@Jn@BVJr@Jr@DVNdA?BLt@Hn@BRJv@Jp@Jp@DX@HHj@Jr@Jr@@LF`@Jp@Jz@BPJn@PnADVHn@PnAFZBRJp@Jv@PnA@DFh@Hj@F^DTHp@Hj@@DJt@Jn@BR@FJr@Fd@BLJr@Jv@Hn@@@Jt@BTDXRpAHn@Jv@F`@Hj@Jp@DXBP?BDXFZDX?@D^BN@BHr@DVDXDXDXDVDZDXDXJr@DXJr@Jp@LbAL|@Jr@DXDXDXJr@Jr@Hj@@FJp@DZBVJt@DXJp@Jt@Jr@Jp@DXDXTfBJp@D\\DTDZJr@Jr@Hn@FZDXBVF\\Hn@Jt@DXJn@Jt@DZDTDXDZDXJr@Hp@Jt@DTBXDXJt@PjADXDXDXDXDXJr@DXDXJr@Jr@Hr@Lr@DX?BJn@BXFXDXBVJr@Jp@Jr@BXDVPjAJp@DXBXDVJr@DXDVBVJr@Hd@@JJr@Hn@Jr@Jp@Jp@Hp@FZBVBL@JJr@Jp@Hp@PjAJp@Hj@@DHp@DZDVDVPjAHr@Jp@Jr@Jp@@HRzAZvB@DJr@Hn@Jr@Lx@hBrMNhAVbBPnAJx@t@dFv@zFt@hFn@rEHh@Hh@Fh@Jr@Hj@Hh@RrAFh@@@PrARrARrAFh@RvAVbB`@tCPrANdAVdBDXL`ALz@T`BF\\Jp@D\\Jl@Jn@TlAVjALl@Nv@Rx@R`Ax@rDp@|Cd@zBt@fD^dBx@pDR|@P|@ZvA`@dB\\`B`AlEZtADVNp@Nn@Np@Nn@FXDVNn@Np@FVFXFVFTFXLp@FVFVNn@FVLn@HXLp@Nl@FX?BLf@?BFVH\\DRNp@FTNp@DVJ^Jf@Np@Np@Ln@Np@FVNn@Nr@HZDRFVNp@DVFVFXNn@FZFTFVFXJb@BLLl@FVFXFVNn@FXFXDTNp@FVFXNn@Nn@Jf@H^FZNl@FXFVDTHZDTNp@Np@Ll@FXFVNp@Jb@Jb@FZNl@Ln@H\\FTLp@Nl@Ln@Pp@Nr@Ln@Np@Nl@ThANn@Np@Np@Jf@J`@Np@DRFZBJBJFV@DDPDTHZDVHX@HBJHZ?@DTFTFZBHJd@FXFTFX@HBLFVNp@FVNr@FRFXLn@Nn@?@Np@Pt@DPFVFVLp@FVH^DPFVNp@Nn@Np@BNBHDVFVFVFVFXFXFVFTFXNp@FVDVHXDVNp@FVJd@J`@Np@Np@DVJ^BPNn@FXFVLn@HXFVDVVhANn@FXFVDVHXDVFVNp@FVNp@FVFVLn@Pr@DTFVFXFVFXNn@FXDTPr@H`@R|@Np@Nn@Nr@FVDVFTFXFVNp@FVFZLj@^bBNn@Ln@Nr@FTFV?@FVFVNn@Nr@Ll@FXNp@VhAR~@BHH^BNNn@FXFT?@FXFTLn@Np@FVFXNl@FX?@FTNp@DTNp@Np@Nn@?@FVLl@J`@R`AFTNp@Lp@Nn@Np@Ll@@@VhATfANr@FXVfA\\~ANp@FVNp@Nr@Nn@FVNp@Lj@FZFTFZFVNn@DV@@Ln@FVNn@Nn@FXLn@FVNn@FZFTNp@DTNp@FTFXJf@Px@FTFZFVFVFXFVLn@HX@FBPFTFXf@zBNn@FXFVFZBHBJDVNn@FVFZNp@FTNp@FV@BLl@FTLp@FVNp@Np@FVNp@DTFVH`@DLFZFVNn@FVFXLn@FXFTNp@VhAFZLj@Np@FVFZDLH`@FVFVFXBN@DHXFZDTHXDTBLBHFXFTDV@@Np@DV@DDNNr@BJBJFVFVDTHXFXDTFXFVFXFTNp@DTNr@HXDVFTFXFXNn@FVFXNn@Lp@Np@FVFXNn@FVFXFT?@FVFVFXFVDVHXDTFXFVDP@FFVFVFVFV@DDPLp@DN@FNp@FVBHBLFXLn@HXLn@FXFVFVNn@?BFTFVLn@FXFVFXNn@FV?@FVFVBL@FHZDVFVFT?BFVFVNp@FVFV?@FTFXH^BJTfANp@^`BBJh@dCNr@Nn@VhAFX@BLl@FVFVNp@Nr@TfANp@Np@Np@Ln@Pp@Lp@J^R`ANp@@BLh@?BFR?BH^Lf@Np@Np@FZJb@XrAFXNp@Rx@Pt@P|@FXFTLp@BHR~@Np@Np@Nl@Nr@FV?@Nl@Nr@VhAThAVfA@FT`ANp@VjANn@Np@?@FXNn@Ll@VjAXnAFZNl@Jh@H^DLJf@Ll@XlAR~@Hb@Pt@d@rBf@zBXnAJh@Rz@p@`DLj@Lf@VlALh@`AjEXpANr@|@bEJd@DNFX?@Nl@VlAJf@BDFXNp@Jd@Jf@@BJf@XpALh@XrAJb@Lj@dAxE|@`EH`@FZRx@R`AFXNp@Rx@?BJb@VhANp@f@|BFVFXFXFVNp@VlAFTFXFVNp@Nr@FXNn@Pv@DRNp@FVFV@FH`@@B@DFVVjANp@FXVhAVjAPv@TdAv@lDTfA`AlEp@vCLn@Nr@XjANp@Nr@Lp@Lp@Lr@Lp@Jr@Jt@Jn@Hr@D^BRD^Fr@Hp@Fx@Fr@Dn@@XDt@Dr@Bt@Bz@Bn@@X?X@t@@v@?v@@p@AX?t@Av@Ax@Ap@Aj@ALChAEt@IbBC\\Et@CTC\\Gz@KhAGn@C\\MnAOhBKjAEn@Iz@Gr@SdCGr@Gr@Gt@OfBGr@E\\CZKnAKjAAJEh@Gr@Gt@Gr@Gr@KnAGt@CXCPGz@Gt@Gr@Gr@MpAGt@SbCCXC\\CVCXE\\CXGr@AVKlAMnAKlAKpAKlAKpAGp@CZCPG|@Iv@Gr@En@KnAMnACVCZOjBGr@CZGr@KlAKnAKlAOjBGt@MlAGz@CRGr@KpAOfBOfBKpAKlAKrAKhAKnAKnACXCXCXGf@M~AcA|LQlBC^k@xGs@vIIp@k@hHEf@eA~LOjBAPI~@C`@UjCALE^CVALMxAKtAIz@CVQtBMtAKtAS`CGl@KpAGp@KnAS`Cg@jGE`@E^e@|FObBEl@QnBGn@UtCKlAM`Bk@pGGz@a@tEEj@a@vE_@vEYfDSdCGj@KtAAJGp@S~BGp@UtCm@fHM~AOhBi@pGO`B[rDKtAAH_@bFYlDy@lJIx@W|COfB]dEs@pI}@rKy@xJm@pHi@jGUpCObBEh@mFno@SdC}@nKKjAMdBM`BKlAIfAInAGdAEv@EjAGdAElACr@ElAAf@A^Cr@Av@Al@Ap@CnAAbB?nAAhA?d@AjA?pAAdCAvCAbB?r@?lAAp@A~B?vB?DAdBAhB?dBA`B?jAAjAErOAV?d@?^?d@A`@?`@?b@AxA?d@?f@?^?JAb@?Z?X?Z?d@Ad@?f@?\\?\\?XAX?b@?B?r@?t@Ax@?x@Av@?nAA`A?`AA`A?n@?bAAx@?|@?f@AbDAbDAvBA~A?@?lA?`DAfA?fAChBCxC?xCAjFAzCAnFIzVCxEAtDAjA?hCEdLChECbIArEAvEEpIAhCEbOAnEEvKCvJ?@?^?ZAX?V?^?V?X?XAX?Z?X?X?Z?XAX?Z?XAX?XAZ?XAVAZAZAVAZAXAXAVAZCXEr@AZCXCXCXCXAVEZCXCVCZEXCVEZCVEXEXEXCVEVYfBGVEZGVEXGTGXGXGXGVEVGVGXGVGVGTELCLGTIXIVGTIVIVIVWv@Od@Ul@GPM\\ITIRKVIRKVKTKVKTKTKRKVKTKRKTOVCDGLKRMVMRKRMRMTKRMROTMRMRKRIJEFMRORMPMPOTORMPMNQVMNORMPOPOROPMPOPMRQRMPORMNQRMROPOPMROPMPQRORMPOPMPORMNQTMPOPORMNOROROPMPORORMNOREDILMNOROPOROPMPOROPORMPOROPORMPOPMROPOPMRORONMPORMPOROPMPMPQTMNKLCDMNORMNOROPQTKNOPORORONOPMROPMPGDKNMNOROPCDMVMLk@t@QT[`@SVk@t@{BrCgDjEAByAjBg@p@}@hAe@n@_CxCq@|@aAnA{@hAuAfBeArA_C|CeC`DeBxB{@hA{@fAIFgB~BcAnAWXmAzAi@l@eAlAUZ_@Z_@d@UVsCrCw@v@q@l@CB]^}@t@oAdAYVo@j@u@l@QLYTyBfBGDGDSLc@VyExCSLu@d@sAx@[Rs@b@_@TUNq@`@IFoAt@QL_Aj@MHe@Zg@XUNOJQLiAp@[Rg@\\}@h@_Al@{A~@SLQJUNGDo@`@WNMHWNQJ_@V[RQJMF]TMHQJ]Tq@b@WLSLe@ZMHWPQJSLg@ZkAr@g@Za@VUNk@\\a@VSLQJ_@To@`@SLo@`@IDQLC@c@XIDUPWPEBIFYTMJQLKJEBOLURKHONQPCBKLABQPORQTOPMPMPQVMTa@p@_@p@Uf@O\\O^M\\K\\O^Oh@IZGVGTIXETGXETGZE\\ETGZAHCPEZANCLE^G`@E\\CXETE\\OlAIn@OnACNCRE^Kt@Gf@EVCZETE\\CVEXIn@CRQvAEXEXCVQzAWrBIn@EVCXE\\WnBGj@ETE\\E\\CVEVEXCTE^AHE^Gd@CRE\\CNGd@E`@CNEXCPCRGj@Ij@EZE\\CXKx@a@bDGb@CVE\\Kx@CNEZE\\Gh@Ip@Kp@It@Gb@ALE\\E\\Ij@In@Gf@E`@Kr@?@Gh@AJOdAIv@SzAANIh@AL?FCPAHCRC\\CXEd@Ch@APAVE`AAh@AT?p@?`@AX@X@v@?\\@\\@X@\\@R@D@XBX@ZBZDZBVD^BRD`@DZDTF\\BTH\\DVFZHZJd@Lh@Pp@Rl@JZHVJTFRd@lARf@r@hBb@jARd@@DRf@N\\FR`@`Ab@jAf@pAv@pBdAlC^`AN`@pBdF`AbCVn@Xv@|@~BDFJZJTHTLZ@BDLFNJXn@~AJXJXLVHTJVFNFRFLf@rAJVJTJXVn@j@vANb@Rf@HRJVb@hAHR`@dADJ`@dAN`@d@jAd@lAHRJXHRVn@Tl@Tl@Pd@rAjDJVHTVn@HR@@HTDHN`@HTJVJTHVJVVn@HPVp@HTJVLZJZFLVr@Xt@Vr@j@bBVx@ZfADNRr@DPPp@H^Lf@VjALp@Np@DVF`@Lp@Hh@Fd@Hf@D`@BNBXDZBRDVB\\Fl@@D@RBPDh@BVHfADz@Dl@?F@H@N?FBp@Bb@?H@L@b@@P@b@?R@Z?L?N@V?\\?b@?N?X@ZAX?P?N?P?X?r@A~@Ah@?v@AdBA^?TAr@?t@A^AhCAh@?h@AxAAvAAzBCdCAzA?d@?XAZ?V?\\?XAX?X?XAt@?V?B?NA|@?XAV?X?^?LAd@?ZAfBAX?X?T?DAX?V?V?B?ZAX?T?`@?VAVAhB?ZAr@AnA?r@?XA\\?X?R?V?FAN?F?R?`@Ap@?F?RAX?v@AV?Z?X?RA^?X?ZAX?X?XAX?Z?X?XAZ?X?X?XAZChEA|CCjC?nAErF?RCfCEfGCtECtFEzEAlA?TArBAh@?~@AdA?d@Ap@?\\Al@A`@?V?XAhBAZ?T?t@At@?t@CtDAnA?XChBKxPC`DCpGElFEbH?j@EfGCbBCzFCjEAdBAj@AfAAnBChCIxBAt@GnAAb@Cj@ATQ~DMhBIrAIhAEf@Gr@C\\CXCVALE\\Eh@U~BGj@Il@E\\CTE^CTABEXE^M`AKp@EXE\\EVEVGZEXKp@GXCTGXEXGXMn@G^w@jEo@lDg@fCETQ|@ADI`@o@lDUjAUlA[bBi@vCUfAALKf@[bBk@xC[~AOv@gArFcAjFi@`Cu@fE]pBu@vDGXg@jCy@lEg@pCKf@w@fEMp@a@xBA@a@xBMr@Mj@{BtLe@bCCNEXYrAOv@SjAMn@WrA[~AUlASjAMp@GZEPMt@Mp@WpA[dBGZKh@Kf@Kh@Kh@WrAMn@Kn@Kd@SfAKh@Mt@UhAOr@Mn@Qz@I\\Or@Ml@Kf@Mh@Sx@Qt@ADQn@GRGXIXGPSx@Qn@Sr@Qj@CH[bAQh@KZIXQf@M`@GPKZQf@Wp@GNENSh@[|@Wn@MZYp@_@~@?@Uf@MZWl@c@`AABSb@Yn@q@~AABm@rAQ^_@z@Wl@]v@Sb@INIRQ`@Sb@g@hAIRINYn@MZYl@Q`@Sf@a@z@ELMV[r@Sf@OZ{@lBe@fAq@xA[r@w@hBe@bAWl@ABWh@Sd@o@xA[p@Wj@a@~@g@hASd@_@z@GLc@bAm@tA_@z@k@nAc@bAWj@e@fAQ^i@lAQd@_@v@_AvBk@lAaBtDk@pAs@|Ao@vAc@bA{@pBIPm@tAa@|@m@rAQb@e@dAO^m@rAADe@bAIRe@bAe@fAKPKTMTKTMTYh@[j@CBU`@A@S^W^S\\U\\MRA@KNY`@W\\Y^]d@g@n@_@`@A@MNOPOPa@b@]\\a@`@?@a@^i@f@]XONc@^MJ[TQNIFYTMHEBQNMHm@b@g@Z[RUNUNOHQJSJMF]ROHMF]P]NULE@SJSHSHSHSJ_A\\SFSHUHSFSFUHSHSFUHSF}@ZUFUHUFSHSFQFWHSHUFQFC@SFSFUHSFUHSFUHSFSHSFSFA@SFUHQFA?UHSFQFWJUFSFOFYHSHUFSHUFSHSFSHUHSHUFSHSHSJC@OFUHg@TSJSHSLSJSJQJSLe@XGBKFSLQLSLQLSNQLQNQLMJCBQLSPWTOLQPQNQPq@p@QRONOPQRONQROPMROPA@MPORMROPOTMR]f@MRMTMRKPABMTMRMTYj@KTMTKR?@KTKTMVKTKVGLAFKVKTIVKVIVIVIVKVIVIXIVGVIXGVIXGVGVGXGXCJCJGXOr@Mp@EXEXGX?FEPEZEXEXCXEXCXCXEVCXCXCXCZCXAXCXAZCXAZAXAXAL?LAZAV?ZAXAX?\\AX?X?ZAX?X?@?XAX?XAZ?Z?XAX?Z?XAX?X?ZAZ?X?VAZ?Z?XAZ?X?XAZ?L?JAZ?X?XAZ?X?ZAX?Z?VAZ?Z?XAZ?X?XAZ?T?D?XAZ?Z?XAX?Z?XAX?ZAX?Z?XAZ?X?\\AX?X?XAZ?Z?XAX?ZAZ?VAt@?X?Z?VAD?j@AT?`@Av@?`AClB?NAtAAp@?l@A\\Ar@?B?v@Av@At@?r@Ar@?ZAv@AjA?F?T?NAx@?VA`AAT?t@AV?\\An@EzE?ZCrCEjFAjBALA`CAlAAt@AjA?NCbB?r@AZ?X?VAb@?RAlAAjBAlAAt@?Z?\\Ar@At@?p@C`B?TAr@ApAAFA|@?N?h@AfA?j@AP?d@Ar@?HAt@?l@AJ?R?~@?n@A|AAdA?BCpA?PAjA?TAr@ArBApACnB?r@AnAApACbBApBAt@AvA?XAp@AfA?h@Ah@?FAtA?`@CnB?HCnDA|ACvCAdBCnBAt@?t@A|@A`BCdBAnAApBAnAC|BAbA?h@AlAAz@ApAAtAAnAAlA?^?j@?F?b@Ah@Av@CbBAdA?FArAAt@AjBAhA?\\Av@Al@?f@?DC~A?j@CnBArA?v@AhAAx@?NAl@?h@At@At@?t@AV?\\Ar@?n@AD?t@Ap@?@?t@Ar@?@At@At@AnA?r@At@ApAAt@Ar@?t@Ar@?ZAf@?f@At@?t@At@Ar@Ar@?\\?r@At@At@At@?t@Ar@At@?t@At@?r@At@At@At@?t@At@Ar@?t@At@At@?t@At@Ar@?t@At@At@?t@Ar@At@?t@At@At@?t@At@At@Ar@?t@At@?t@Ar@At@?t@At@Ar@At@?t@Ar@?t@At@At@At@?t@Ar@?X?\\AZ?XAr@Ap@?BAnA?t@Ar@CfDCpDE`FAbAC~DCfBAvBAbAAp@?ZA~AAfBClBAnAAdBEvFCzCCnCAvBChBAfCEvD?l@CzAAdCAjAAnAApAC~CApBCdB?~@?JAb@AlAAt@?p@?\\Av@?n@?d@Aj@?P?F?Z@\\?^?j@@f@?b@?V@`@?\\@T?P@b@@X?V@X@^?X@d@@d@Bt@@Z@\\@TFnAFnAFtA@TDr@Dt@Dj@@LDn@B\\BZ@RD`@?@@VBZDX@PBR@N@L@J@N@HBXDX@PBVJ~@Fj@Fd@BNBX?@Hp@Hr@Jv@NpAVzBHj@NtANrABRPzAD\\LbARfBTfBTpBLdANnAV~BF^Fh@Hv@NnAJv@?@BTDb@LbAHp@Fh@R~A\\zCJt@BVHt@Hl@Hp@D^BRFj@Jr@BZHp@Hr@Hp@@DHn@LlANnAFh@@HDXDVBXD^Fb@Fb@D`@LfAHr@Hr@Fd@Ff@Hp@@DBZDXBVDVD\\BVBXD\\DVBVDZBVDZBTD^DVDZBXBTDXDZDXBXBVDZDZDXBVBXDVDZBZDTD\\BVBVD\\DVBXDZBXDVBVD^DVDZBXBTDXD\\BVDVD\\BVBXDZDXBVDXDXBXDXDZDXDZDVDVFVD\\FVDVFXDXFVFZFVDTFXHZFXFTFXHXPn@FVHTFVJZFRHVHZHTHTJXHVHRJZHTHRHTLZ`@`A?@JTJTHRNXHRXl@JTJRXn@JRJRLXJRJRP`@FLJRJRLVJRJTJVLTJRJVLVJRTf@BFJPJVJRLVJTLVHPLTJTXn@HNLVJTLVJRBFFLJTLTJVJTLTJTLVJTJRJTJTLTJVJRLTJTJTJRJTBDHPJTJT@DJPHTJTJVJTHRJZJTHTHVJVHVHTHTHXHXHTFVHVHXFTFVHZFTFVHZDVFT@D@HBHFXDXFXDVBN@HDXDXFZBVBL@HDXDZBVBVD^BVBVDXBZ?H@NBXBXBZ@X@XBZ@X@X@Z?D@R@X?X@Z?X@Z?V?Z?Z?X?Z?VAX?^AX?TAT?DAZAXAXA\\CVAZAVC\\CVAXEZAXCVEZAJALCXEVCZEXEXCVEZEXEXEXEVEXEZEXCVEVEZEXEVEZEVEZEXEXCTG\\EVCXGZCVEXEVEZEXEVEZEV?DCREVABEVCXAHEPCVEXCNAJEVEZETEVE\\AHCREVEXEVAJCNCVEXCPCHCVEXEVEXEZEXEXEXCXCJALGXCXEZEVEXEVE\\EVEXCTABEVCVG\\CVEVE\\EVEV?BERCXG\\CRG`@CTEXEXEXEV?BEXCTGZGb@CNCVEZEXKp@Gb@CNEXCVGZCXEZETAFCPEZCVEZEVEZCXEVEZCVE\\CVEXCXC\\EVCZCVAJALCXCXEXCZCXGp@Gt@Gr@EZAJAJAXCXCXC\\CTAZCZAXCV?@AVAZA\\AZAVAVA^AVAZAXAXA\\AV?BAXAVC\\AVAZAZAXAXAVAZAZAXAZAZAZAVAZAZAXAXAVAXC\\AXAXAZAXAXAZAZAVAXAZCZAVAZAZAXAXAZAXAXAXAZAXAXAZAXAZAXAXAXAXC\\AVA\\AXAZAVCZAXAZATCZC\\ATC\\CVGn@C^EZAVEZEZCVCVEZKr@CTG\\CVGZEVKr@GVGZETEVGXG\\GTGVGZETIZETGZGVGXGVGVGZGXETI\\ETGXGXETIZMn@GZGTGZETGVG\\GVGXGTGXGXEVGVGZGVGXADEPGZMp@WjAGVGXEVGXGXOp@GXMn@WlAOp@I^Mj@EVGVGZGXOn@GXERG\\WhAGXEVGXGVGXGZGVGXGXEVGXGTAFCNGXGXIZEVGTG\\GTGZGVEVIZEVIXEXGTOr@GVEXGVGVWlAETWjAG\\ELWpA_@fB]bBGXOn@]bBiAnFe@rBg@tB_@nAMf@ABGTe@tAm@hBCHk@xAMXw@jBq@tAGPw@vA{@vAmB|CMPOROTORKPOPORCDILOPOTMNOROTkA~AmBfCMPORMNGJGHMPQTILQVORMNOROTOPMPA@MRMN{BtCOR}AxBMPgBbCCDMNOTMPOPOROTORMNQVMPORMNORMRORMPMPQTMNQTMRA@KLKNEDMPEFGHQTMPOTMPMPQTMPKNA?QVMPORORMNMRORABKNOPOTMNQVMNMPQTCDILMPORMPQTORKPORMRMPCBKPOTMRKPQTKREFIJKROTMRKPOVMROTKTKPGHGLMRMTGJEFKPOVKRMROVU\\eElHu@rAMTMRMT[f@MVKRQVKRKPOVKPOXKPMRMTKROTMTKPA@MTKROVMPKROVKPMTMTMPMTMTKPOXKPOVMRKPOVKRKPOVKROVKPMRMTMTMTMRMRMTA@KPMTMTMRKROTKRMRMTMTMRMTMTMTMRA@KPMTKRMRMRMVMRMTMRKRMRMTMTOTKROTKRMRMTMTA@INOVKPMTOTKRMRMVMRMTMRMTMRKRMTOTKPMTMTKROVMPKRMTMTOTKPMTMRMVMRMTMRKROTKRMTMTMRMRMTMRKROTKROVKPMTMRMTMRKTOTKPMTOVKPOVKRKPOXMRMROTKRMTMTKPMRMTOVKPMVMRMRMRMVKPOTKROVMTMRMTKPMTMTMRMRKTMRMTMRMRMTMTMRMTKROTKRMTMRMRMTMTMTMPKROXMPKROVKROTKRMRMTMRMVMRQXe@x@GJm@dA_@n@EHYf@]j@OXe@x@OV]j@MTYd@w@tA[j@g@z@c@t@S^]j@Wd@SZ]n@CBMT[j@]l@[h@Yd@_@p@CB_@n@i@bA]j@q@lAU^A@a@t@MRMRWd@_@n@OXGHGJGJQZEF]n@Wb@ININCBU`@INYd@INCBCFGJWb@]n@_@n@S\\MROVEJOVg@z@a@r@U`@Yd@U`@S\\QXS^Wd@QX}AnCaA`BGJEFIPU^GLKNa@t@u@pAMRw@rA?@c@t@c@r@[j@q@jAINo@fAaAbBWb@OXgAhB_@p@INe@x@MRg@z@INS\\_@p@g@x@m@fAaBrCe@x@a@r@a@t@{@vA[l@CBy@vAs@lAMTOXU^_@p@Yd@]n@aA`B{@zAc@r@O\\OXcCfEW`@U`@U`@wDvGEFUb@U^i@~@MTILA@s@nAi@`Aq@hAOXGHkAtB}B|DwBvDa@r@OVKRe@v@OXMPm@fAKNQZGLMRGJOVQXkCtEeAjBqAzBq@hAU^SZy@lAo@|@EHGHIHGHMPQTKLOP]`@y@`Ay@z@a@b@e@b@ONs@p@wAlAiA|@_CfBeAx@oCrBWRMJqCvBc@ZcBnAo@f@}AlAw@j@]V]Vc@\\{@p@yAhAYTMHOL]VC@e@^m@d@GDOLQNQNOJQPCBKJSPQNOLQPONMLCBOPONONONQPMPQPOPMNQROPMPMPQRMPORMPMPORORKPOTMRMPMRMRMRMRKRKPILILKRKRMTMTA@GPMTMTMVIRCDINIRKVKTKRKVEJEHITKVKTITM\\GNKVITKVITIRKXITIVKVIRITKTITKZKVO`@O`@KZKTIRGPKVKXQh@Sh@Qd@Yt@Qd@Wp@Qd@Yx@[v@_@fA_@`AGPEJCFUn@Wn@Sh@KZ_@`A_@bAKVKXGRUj@Sj@Wp@e@pAg@pA{@`CUl@_AfCuAtDQd@Qd@cHhRQd@KTIVITKVKTSj@{BfGeAnCa@fAg@tAqAbDiDpIa@bAa@bAKTUj@Wn@ITUj@MXUj@aAdCa@`Aa@dAIPADO`@Yt@kAtC}AxDw@pBo@|AGPeChGGJGLITKTKVITKTKVIRKVITKVIRKVKTIVWl@IRKTKVUj@KVITO\\GNITKTKTITKVITWl@Ul@KTITm@vAKVKXmAxCUl@ITKRKVKVKVIRITKVKTUh@Qd@O^KTKXIRa@bAWl@IVKRKVITKVIRKVKTUj@KVIRKVKTIVIRKTKXKTO^EHIRMZMZGLGLQb@MVKVINEJMVCBQ\\INKR_@p@e@v@g@r@MRMR_@d@ORMPOPMPQRMNORMLa@b@OP]\\A@WTMLONOLMJc@^URMJSNOJSNQLQLSLQLQLQJSLOHIFUL[PQHQJGB_@PUJSJOHUHID]NUHMDa@NKDYHKDe@Ns@RqAZu@NA?UDe@JWBKBI@SBSBSDU@UBSBWBU@UBK?G@U@UBU@S@U@SBW@U@W@G@_@BW@Q@S@WBU@]Ba@@UBU@S@U@UB_@@_@Bk@DU@i@BaAF_AFU@i@Di@BQ@Y@WBg@BS@W@UBC?Q@U@K@O@]BC?U@U@S@WBW@M@u@DQ@S@S@S@WBU@Q@WBS@Y@S@U@C@O@U@W@e@D_@@c@DU@YBY@WBsAPWD_@Di@JG@SDUFk@Li@N]Jc@NSFQF[LQHIB[NSHWLQHQJWNMDYROJSLSLQLSLQNIFGDQLQPQLQNQNSPa@^a@`@c@^OPQNQNQNa@`@QPQNmDdDyArAuBpBeFzEsAnAsAnAcFvE[Z]X{@v@[Zc@^SRQNMJUV_@ZQPQNOPQNONSPc@`@YVYVONQPQNQPONSPMJQRQNOLQPONWT[Z[XWVQNSPWTYXc@`@WTm@j@QNs@p@ONQPSP[XGFSPKJc@`@ONSPONQNa@`@SPMLQPQNONQPQPOLONQPQNQNONa@^c@b@OLSRONOLc@`@QPa@`@c@^c@b@QNQNQPONQPQNOLQPc@`@QNONYTIHyBtBONUP_@^SNONQNQNQPQNOLQPQNQNSRONONWTKJa@^g@b@KLk@f@k@h@ONQNa@^QPg@d@YXSPQNONONQN[Xg@f@OLQPa@\\QRQNURUTUTOLQPQNUT[Xc@`@ONQPONQNMJc@b@QNONQNQNMNSRQNWT{@v@ONa@^QPQNGHi@d@ONyGlG]XmCdCWVa@^QNGHGDQNcA~@sApAUR[ZKJWTuAnAs@p@q@n@_@\\u@p@cB~ASRqAjAgD~CoDfDc@`@A@c@^cB~AA@kAhAEBABUPGFgAbAWV{@x@QNa@^e@d@KJONQPONA@OLWVSP{@v@q@n@URi@d@k@h@YVWVML]XUTYVUTc@`@w@t@[X[Zk@h@_@^WTONWT_@\\c@^k@h@aCzBy@t@WVy@t@c@`@]Ze@b@GFc@b@i@d@a@`@QNWTYXQNONKJIFSPA@IHOLQPQPOLA@a@^QPA@QNg@d@GFo@l@C@u@t@A?[ZqBjBg@d@s@p@c@`@a@^a@^ONa@^c@`@a@`@a@^QNa@^QPq@n@SP_@^c@^gBbBmCdCABYTa@`@eA`Aa@^s@n@q@n@QPc@`@kAfAIHONQNED]ZGFi@f@QNQPOLQPONQNQPQNONQPMJUR_@`@QNQNQPA@OLONURk@h@QNQPONQPOLQPUR]ZQPONQNQNONONQNOPQNONSPc@`@ONWTQNIHGF_@\\ONMJQPQNMLONQPQL?@OLQPQNQPQNSRm@j@SP_@^QNQNONQPa@^GFIFONQNQPQNOPOLQPQNQPSPa@`@}A~Ac@d@a@`@MJUT_@\\_@^URMLWV[\\ONIJA@QRGFiAjAOPOPUTA@[\\OPc@f@GHSRa@b@OPON_@b@_@b@QPONUXWXSROPOPONm@p@s@v@q@t@OPOPe@f@{@~@aBhBm@p@iDtDo@r@aCjCMNaBhBs@v@aDlDIJON_@`@aBhBQTKJQRQP_@`@q@p@_@`@s@p@o@n@SPQPOLKJ]ZIHSPc@^EDYVUPIHC@ONQNQLQNMJEBOL_@ZUPiAx@IFKHMJe@ZSN[R{@l@mAx@A?MH[RMHg@ZsBlAMFWPULQJSJWNc@R]PKD]PWLYNWL]N[Ng@TYLID_@Nc@POHWJQH{@^YLSHSJ]NWJC@sB|@IDwCnA}BbAcAb@cA`@e@Ts@ZsB|@w@\\q@Vu@\\o@Vu@Z_@Pq@X_@Pc@Pc@R_@NEBi@T_@Nc@Rg@Tu@ZYJ[Lo@Tw@V]JIBIBi@Pg@Lk@Ni@Lg@Ji@Li@JI@_@Fg@H{@Lq@J_ALk@H[DQBg@Fa@Fo@Ho@Hi@Ho@Hc@Fi@He@F]DK@u@Ja@Fq@Ha@Fq@Ho@Jg@Fq@Ji@FK@m@Hm@Hg@He@Fa@Fe@Fa@Do@Jk@Fg@Hc@Fq@Ha@Fg@Fc@Fa@Fa@FUBOBk@F[FI@w@JaALu@Jq@Jg@Fm@HWBi@Hg@Fe@Ha@F_@D}@JA@aALm@HyARe@FSBMB]D_@F_@FWDSBi@F[F_@Du@Hy@JoAPwAPUD[D{@JoAPeANmBVE?kAPo@HuAP_ALk@Hs@JiANwAPeANc@FSBk@H[D_@Do@HUBe@Fm@FE?c@Fi@D_AJaAJ_AHK@u@Fk@Fi@Dk@Fi@DsALcAJaAHi@Fi@Dk@Fk@Di@FS@k@F{@Hc@D{BRiBNm@Fk@FWBk@De@Dg@Fi@DeE^w@HU@QBm@FQ@oAL{BRO@wANWBU@i@FYBOBm@Fc@D_@FM@w@L[Fq@Le@HYHi@JYHq@P{@Xi@P]LaA^gAd@eF`CeF~Bu@^kClAMFkBz@sCrAWLUJaAd@w@^OFsDdBmLpFoB~@sDbB{@`@_Ab@OHi@TQHULg@Te@TUJ}@b@a@ReAf@u@^e@RSJ_@PGBkAh@aAd@wB`AcBv@kD`B_EjB{E|B_DvAgErBkClAaBt@gD~AgCjAaBv@iAh@o@Xe@TWJy@`@u@\\aAd@e@T_@P[Pi@Xs@`@k@\\c@X]T[Te@Za@Zc@\\g@^QNQNQNONQNQPQLQPONQNQPONOPOPQNORQPOPONOROPQRMPOPKLORQVMPORY^_@j@[d@]h@Yf@]h@QXKRYh@Yh@Q\\MVYl@Sb@KTWh@Wn@KXQ`@M^KTKVGTKXUn@Wv@ENSp@g@~Ac@zAk@hBSr@_A|CIXELUv@[fAUr@Y`A[dAIV_@nAw@jCKX[dAQl@Ut@[bAY|@Of@GVSj@Sp@Sp@Uv@K\\Ur@m@nBc@xAg@~AGR[dAi@hBq@vB_EtMaDpKOh@q@xB[fASn@]dAGTq@zBg@`BSn@]hAQn@Sl@Sp@Sn@GVKZwAvEQn@IVIRaBrFIXIVIVIVIV[fAITIXg@`BIVGVIRcEdNGTKZQl@q@zBmA|D]hAIXcAfD[dAQh@GTQj@ADCFIXa@tA_@lAKXUv@o@tBs@~B_A|C]jAUv@a@pAeAlDc@vAOd@Of@IXyA|E[bAIXGPADM`@?@Ob@Qn@KZWx@]lA_@nACHOb@IXITGVA@[dA[dAWv@Md@M`@oBpGIVELAFIVGRIXIVKZK^Ob@?@Qh@[dAIVIVIVSr@GPW|@Wx@IVAFWz@GRI\\Qp@GVGVK`@Mf@GVETGX?@GTERG\\CNI`@EZCNCHCTMp@E\\ETCXEXEXOjACXGd@OvAIr@MjAShBIn@CVCXQ~AKz@a@rDE`@AN_@~CCRCVIt@It@Ix@Gh@Ir@W~BKx@_@lDCXIr@MhAEXGp@c@vDUxBADGj@MfAW`CW~BQ~As@nGQ`BIn@q@dGGh@SrBCLGl@WvBGn@gAxJW~BGj@W~BGj@Q`BOnAMlAIp@CTE\\MjAk@lFKx@K`A[rCGj@qBxQgBlPOnAo@`GADOtAOtAIv@}@nIq@dGUvBGj@_@bDYjC_@vCOlAKt@]|BKr@WbBMt@c@`CUhAMp@]~A_@dBS|@u@~Cw@dDmB~HSx@?@Uz@gBpHS|@e@nBm@bCMd@?@y@lDeBfH}@tDCJIZg@vBMj@Uz@e@xBUhAUlAYdBKp@YvBE`@Ir@Gp@MnAi@vGc@vFEj@Eh@Eh@M`BKvAS`CQ`CMdB]hE{BdZk@nH_@`FIbACVEj@OhBUxCe@bG]xEC\\ALQvBEh@Gt@Ej@IjA_@xEAHGv@C^KtAw@bK_@zESpCIz@SlCKvAGt@E^C^Ej@YtDi@fH?D?@CRANIpAQzDE`AAXAd@Ch@?DA`@CvAEbBElDAJ?L?RAN?PA^Af@?ZCfA?@AjACxAE`CCpBAT?ZAb@Af@?ZAZ?b@AX?XAR?V?JALAv@?^APAl@?H?L?NAXAt@AX?ZAX?ZAV?XAZ?ZAb@?NAZ?VAZAV?ZAX?ZAXAx@A^An@?VA^Al@?ZAXAX?\\AX?XA\\A`@?^EbCCdAAv@C~AAx@?b@AZ?NAXAt@?PCfAAbA?HAN?l@AVAV?\\?RCjAAt@AX?D?F?J?B?D?FAH?TAZ?XAZ?ZAREpCAbAAx@Ax@AT?\\Ad@C|@?R?RAj@AZAZ?Z?HAN?VAZAdAGzBAr@APAd@EbAEv@G|@AL?LALALAJANAHAJAL?HAHAFAH?FAFAJ?FADAPIn@?BCNGh@SbBMbAK|@UhBKt@In@Ix@CLALETMjA]pCA@k@tECVo@fFCPCTIl@Gh@OjA_ArHQvACZEXEZEXCVEZEVCZET?@EZCXEVCXEXEXEXCXEVEZCXEXCNAHCVE\\CTEXEXOpAEXEXCVGf@Gd@EXEXCXIl@EXCXOjAa@hDStACZUdBAFCVEZQ|AWlBAD?DAD?FA@?DADAHADAJAHADAJAF?DAFAJADAHAF?FAFABALAFAHAFAJAJCJAJCNMjAAF?@ABALAHAD?DAFADAHANCNCLCTEXCT?BAJCH?DAFAHAD?DAD?BAD?BADAD?DAHAHCNALCJAJCNk@vE{@jHYzBSfBWnBGj@CPm@zEE^UfBQtAAHAHANOnAQnAYdCQnA?DGd@AHM|@Y~BAJKz@K|@CLQxAIr@a@zC?DQrAi@nECLUhBK|@Ih@?FQlAc@rDi@pE[bCe@tDY~BALiDxXOlAIr@QnASdBEVIt@OnAUfBOjA_@|COlAOnAUdBY`C[bCOlAOlAOnAY~BOlAIr@Kr@Ir@Ir@OnAKr@OlAUfBOlAShBUdB_@|COlAk@nEc@tDOlAQnASfBOnAaBtMSdBUfBOlAc@tDe@vDOjAIr@Kt@Ir@Kr@Ir@Ir@Kr@It@Ir@Kr@Ir@Ir@Kr@Ir@Ir@Kr@It@Ip@CNGb@It@Kr@Gh@AHIr@Kr@Ir@UfBIr@Kr@Ir@Kr@Kr@Kr@Kr@Mr@Kr@Mp@Mr@Mp@Mr@Mp@Mr@Op@Mp@Or@Op@Op@Qp@On@Op@Qp@Qn@Qp@Qn@K\\ERQn@IX]dAg@`BSn@Sl@Up@Sl@]dA]dAUn@Sn@Un@]dAUn@Sn@Sn@Ul@Sn@Un@Sn@Un@Sl@Sn@Ul@Sn@Up@Sl@Sl@Un@Sn@Sn@Ul@Sn@Sn@Un@Qh@KXIVIVITKXIVITUp@IRKZIVGRIVKVIVIXKTGTIVKVIVIVIVKZIRIVITIVKXITITIVIVKXIVITIVIVITKXIVIVKVGTKXIVITIVITIVKVIVIVKXITITIVIVKXGTKVKXGRIVKZIRIVITKXIVITSl@KZGRIVKVIVITIVIVKXITIVIVITIVKVIXITIVIVKVIXITITITIVKXITIXITKZIRITIXITIVKVIVIVKVIVITSn@IVKXIVITIVKVIVIVIVKXITSn@ITKXITIVIVKXKXQj@KXIVITKZITIVUn@_@jAKXIVKZITIVKXKXIVIVKVIVIVKXGTIVITKXITIVIVIVKVIVSl@IVKVIVIVIVKVITIXIVIVKVOd@M^KXIXITKXIVKVIXKXKZSl@K\\c@nAYx@Qj@EJCH_@hAcAzCUn@}@lCUn@Sn@e@vAkBtFa@lAQf@Od@Wr@k@dBGNUp@]dAEJc@pAOd@O`@IVIV}@lC}@lCs@vBUn@Qh@Un@IVIT?@e@tAM^IVIVKXITIVIVIVITKXITKXENCFITKVITITUl@KVKTKTKVITWj@MVITKTYn@c@~@IVKTKTMXITKTIVKTKZGRCBQh@IVIVKVITIXITIVKVIVADGRITIVKVITIVSn@IVKTIVM\\EPKXSl@ITIVIVKVIVKXGRIVKVIXUp@ITITIXKVITIVGTKVITIXITGNSp@CFITIVIVITKXIVSl@GPCDg@|AIVKVIVIVIVUl@Sn@Sl@KXIVITSl@Up@Sn@Sl@KXGPKXSn@Un@Sn@ITSn@Un@Sl@CHELKVIVIVIVITKXSl@IVIVITKXIVITIVIVUn@IVIVITIVKVIVSl@GTCBSl@Sn@IVKVSl@Sn@Un@Sn@Ob@CHUn@Sl@c@tAKVCHQj@Un@Qh@KXK\\ITKVIVIVIVIVIVKTIXITIVIVKVSl@IVIVUn@Sn@IVSl@Un@Sl@IVIVUn@Sn@Sl@Un@IVIVIVIVUl@IVSn@_@dAIVSl@IXUl@q@tBKVIXIT_@fAGTKVSn@IVUn@Sl@IVUn@Sl@Sn@KVGTk@bBIRIVIVIVKTIVEPCDCHELIVIVKVIVITIVIVKVITIVIVIXKTIVIVIVIVKVIVIVIVIVIVKVIVITIVIVKVIVIVIVIVABIRIVIVIVQh@CDIVIVIVKVIVIVIVEHCLITIXITIXITIXIVIVIVIVGVK\\GPIXA?GVIVGPELENIV[fAo@vBc@xAKZCDGVIXIVIVIVIVIVIVIXGTIXIVIVIVIVGVIVIVIXIVIVIVGVIVIVIVIXITIXIVIVIX[fAITELCJIVIVGVIXELCHIVIVIVIVGTABGTIXIVIVIVIVIVIXIVIVGVIVIVIVIXITIXIVGVIV?@IVIVIVGVIVIVIVIVIXIVGTIXIVIVELCHIVIXGTIXIVIVIVIVIVIXGTIXELCHELCHIVIVGVIXIVIVIVGTABGTITIVIXGRIZIVITIXIX]fAI\\CHWz@_@nA_@lA?@_@lASn@K^]hAa@rASn@yAbFQf@aAfDK\\Ut@m@pBCHGReAdDK^GPg@zAK\\Wt@CFK\\a@fAIV[z@Sl@kAbDIRUl@Sj@{AdEIRIVIVKTIVITKTKXITIVKVITITKVIVKVIVKVITITKVIVKVITIVKTIVKVITIVKTIVITKVIVKVITKVIVITKVKV?@KXITITKVIVITA?IVKVITIVKVITKVIVKTIVIVKTIVITKVKXIRIVIVKVITKTKXITITKVIVITELEHIVKTIVITUn@ITKVITKVKVIVITITKVIVKVITEJEJOd@Yv@KVUl@i@|Au@rBk@zA_@dA_@dAUl@ITA@ITKVUl@KTWj@Wl@Wj@S^Q`@INCDKRYf@MVMTMRMTMRMRMT[f@MR]f@{@lA]h@k@v@{@nA{@jAa@l@w@hAkA`BOTILm@z@]d@KNQVEFW\\MR]f@]f@UZU\\m@x@_@j@Y`@]d@]f@iA~A[d@EFq@`Aa@j@k@z@a@j@g@r@m@z@a@l@uAlBaE~FYb@e@n@y@nAsAvB[j@U`@S^MV]p@Ud@[p@e@dA[v@_@~@Qd@Yv@Ob@M`@IR]fAUx@M^IZQp@Ol@K`@Kf@GRCPK`@Kh@?BMl@Kn@Mt@QhAMt@MbAKt@m@hEObAQnAOdAU`BM~@a@tCETKv@QjAU|AQnAWhB]bCWjBYtBWhBYlBYtBKl@Ir@YnBStAm@lEQlAALg@jD[zBYvBQnASpAU~A_AxGwAfKc@xCIn@c@~CUbBSpAObAu@lFg@tDQlA_@nCuAtJKv@WnBi@tD]`C{@jGWbBYtBq@`Fm@dEUfBEX[xBm@hEYpBa@pCKr@M~@a@xCa@pCg@rDq@xE?@YrBIh@Gb@ADIh@e@hDAJEVAFk@dECLGb@ADIh@Gb@In@QnAIl@SvAIj@EXIj@EVCVSvAKn@CVABCNObAKx@WfBKr@Ih@EXc@`DSxAUzACVa@nC_@lCGb@G`@CXIj@Kv@M|@AJG^EX_@jCO`AGh@CRKn@G`@?@Ij@OdAAFQrAEZIf@E\\Il@CJCVKn@_@lCE\\AJIj@O`ACPObAIh@EXETCNCNAHCJG^Mp@?@EVERKf@WtACHSbAETI^I\\Sx@S|@Sz@YhAERMd@Qp@GROl@Sr@GPe@bBs@jCw@nCu@nCAFmAlEs@dCe@bBuAbFg@jBADk@nBqAxEy@tCk@tBaAjDa@zA[bASt@k@tBe@bBW|@e@dBi@lBkDfMwBvHaBdG_@rAs@hCQn@U|@Ql@GPCJYdAUt@WbA]jASp@YdASp@Md@W|@Qn@c@`BK^IZW|@[fASt@CLABA@K`@AB?@[hAa@tAOl@Sr@GROl@YbAUz@Kb@Qr@K`@IVIVIV?@M`@M`@ABMb@Ql@M`@K^St@Mb@ABMf@c@|AYbAMd@GPGTGTSt@Mb@Qn@Sr@IVOj@IZQn@IVSr@Oj@Ql@K^GVIVOf@Ux@CLOd@Qn@Qn@YbASv@Ql@Qp@[fAGVIXSr@g@lB_AfDWz@Qp@IVGVIXK^Qn@Qj@i@pBe@`Bm@vBU|@[fA_@vAOf@Qp@Of@IZg@dBOj@m@xBi@jB_AjD_@tAk@vBc@~AQx@Qn@GVKf@CLOl@Op@Op@UhAI\\I`@I`@[zAI`@Mj@Mj@UhAI`@Kf@Q|@Kf@Kd@I^WpAENId@Kb@Kh@IZm@zCe@zBk@rC_@fBKb@]fBi@hCCLOp@UhAQx@Qx@o@~CCNGV?@k@nC]fBiApFMn@YrA]`BWlAWpAUdAq@dD[zAI`@WpAMh@UfAUjAgAhFG^UdASbAWlA[zAQ|@g@bCa@pBWlAGVGXOv@c@xBo@vCUjAm@xCS~@e@~B]~A[zAMl@UjAo@zCSbAq@`D_@lB[|A]~AOr@S`Am@zCWnAWlA]bBeAfF[zAKb@ETI^c@vBUhAg@~BWlAG^UbAMn@UfAWpAYrAKj@Mh@Ov@WhAUjAI^[zA]dBWnAQv@Mr@Mf@Q`AI^Ib@UfAWlAUjAIZCJG\\IZQ|@Q|@a@lBQx@GXOt@I\\G\\GVOt@Ml@G^Or@Ot@CNWrAId@Id@Kn@EZERG`@Gf@Gb@CVEb@Il@Gr@It@Gt@Gv@ATCZEl@A`@CZCr@Cn@Cz@Cr@C`ACf@An@Af@Cp@GhCC|@A`@Cz@E|BCdAEnAE~BEjA?RCr@Aj@Cr@GzBAj@Aj@AH?`@Cj@G`CI|CA~@A^K~DEtAAj@EpACpAEfBAf@Cl@CjAGnCGbCAL?FC`AAj@EvAKhEAZAXAr@A\\AXAVAZ?XA^ATAZAX?XAXAZAX?JCj@ClAGdCARIzDGdBAd@EfBAb@Al@AZAXAZAX?VA^AXAZAR?VCh@?PAZA\\AVAb@Ad@Ax@Cv@Cr@?FGzB?LA\\ANCtAAf@Cj@Aj@C~@A^A\\?D?VATCt@?XCp@?JA^Cd@EnBCt@?HCn@An@Aj@A^?@A\\A\\Al@AVA`@AL?JCpAIhDErAM`FAj@C~@Cr@G`DKdEAXCn@G`DAVAXCr@?LAf@AXAZAX?XCr@A\\AX?ZAVAZCp@?\\AZATC`ACx@C~@Ar@Cx@CdAAb@E~AAf@An@ADAv@ApAA^?T?p@?lA@j@?b@@Z@r@@n@Bt@Bn@Bj@Bj@B^@VHlADp@BZB\\JfAHz@@FBZF`@Jx@Hp@DXJt@H`@BPDXHd@H`@Lr@Hd@@@Hd@Lr@Hb@Hd@@@Jn@Nr@DXRfANv@Jh@Hb@Ll@Lv@TfADT?BFZFVDXHd@Jf@b@|BJn@TnAVpAVvA`@tBXzALp@Lp@Jl@DXLv@Jt@D^BRB\\BZ@VB^@T@V?F?R@T?`@?RAV?T?JANAb@AZARC^CZC\\CTEZGd@I`@GZETK`@GXGTGTKZELELENKTIVKTUf@Sd@mAvBWd@iAtBkArBS^Q\\e@|@MTMVEFU`@KPUd@S\\KPMVKPMTMVOVIPEFU`@KROZILOXKRMVQ^ABKVKRO^KVM\\KZ]bAENGROh@CLIZGTEVKb@ERETCNGZCNGb@EZAHCTCPEZC\\CVCZCTC`@AXCj@Cd@Ad@Ah@?R?J?X?lA@n@@\\BlADv@?LF|AJ`DB`@DjAF~ADnAJjC@b@Bp@@R@\\@Z@XBZ?F@L@X@V@X@b@?@@Z@T@X@Z@L?HBZ@`@?F@V@N@V?N@D@d@Bl@Bt@HbCB\\Bl@@^Bv@@^Dv@?FBd@Bt@@^Bj@@^FbBDz@Bl@?J@LBh@Bn@Bt@@^Bj@@`@Bp@Dt@DjA?TDbADx@@ZBl@?TFhA@b@@\\D~@DjA@d@Dz@@^HlB@\\Bx@?@B`@B~@HfBBt@Bp@@XBj@?JDz@HvB@f@@^HdB@b@Bt@Dz@BbA@VHbBDtADpAD~@HxBHbCHhB?HDbBBz@@h@@t@?H?jA?~@AjA?r@AT?F?VAJ?VCbAC\\Ct@I~AEv@CXM|AGr@[dEKfAIjAGp@OnBEd@]hEEv@Eb@E|@Ex@GxBAL?ZEfB?lBA\\?X@lA?fA?dA?\\?vB?zB?lB?j@?f@?d@?bB?hC?fF?|@?nB?zB?nA?pB?`E@h@?d@@z@@j@B~@FnADx@J~AT|BHr@NdAF^PdARbAFVDXXnAXhAPv@BHJf@FVFVFXFVFXNp@Pr@Jh@DLLn@Np@DTJh@DRF`@DZFb@Fb@LpAFr@Dj@@N?DD|@H|BBj@Bf@D|@Fx@H`ADb@Fn@Jx@Jn@Jp@Jn@P~@XrALr@J`@ThATdAJd@DRBLFZDPFXNv@FV?BH\\Jf@@BLp@Jd@FVVrAThAFXNt@H^Hd@@FF\\Fl@Hj@D`@Ft@@JJ`BFrBB`A@x@?f@@n@Ah@?l@?L?j@?jA?pC?zE?`B@vB@~@@x@?H@R?XBj@@l@Bf@FnADz@F|@H`A@R?BFr@H|@F`@NvANnANdAZnBRdA\\fBH`@VpAXtAP|@P|@H\\Hb@FVF\\VlAXxAHb@Pz@R`ABLLj@^jBVrAXtAHb@F^XrAXtAXvAVtADPHb@Np@Nt@b@zBJf@VrA@DDPVrAFT?@BPFT?DH\\FXDVDPFVFZDVFXFXDRDVH^DPFXFZDTDRNt@Jf@P~@@DTfAFXNt@Jf@Nt@BJJl@Lh@Jf@Lr@TfALl@?@Jh@Lj@FZDVDTFTHb@BJFVBNDTFXFZFZH`@BHH`@Jh@Np@@DJj@FZLn@Pv@Jj@Pz@BLFVF\\Pv@RbALt@Np@RdANp@?BTjA@@Lr@Nn@Lt@TjAVhAZ~AF\\FTJh@Jf@Jh@FX?@Jf@H`@TjAH`@Lh@Nv@Ln@Pz@Hb@FZFZJf@Jd@Hb@Nt@Lp@FVFV@HJf@H`@Jf@ThAP|@DLFZDRDR@HH^DNFXPv@Lj@Nn@J^Tx@Tv@Rl@@DPh@N`@Pd@Tl@L\\Pd@Xp@?@Rj@Tj@Xr@Rf@DNN^JXZx@@BVl@Tl@^bALV^bAVn@Tl@JTHVTj@Rl@Rn@Tl@Pn@Rn@HVNl@Pp@Pp@BJJd@Np@ZtAJh@Lp@Lt@Hh@Lx@Jr@Hr@Hn@BXFp@DZ?@Fn@Db@D\\@PFl@Dt@?@J`BFxABt@BxA@N@t@@r@DjC@pA@l@@p@@b@BvBDhCFhEBvB@X?Z@h@?@B|ABhABbC@J@|@@vABp@@z@@n@?b@@P@t@@h@@n@Bt@?NBZ?B@LBd@D`@Fn@Fj@BRFd@DVD\\BJFZH`@Ln@Ln@Pt@Jb@Nd@FRDLBJNb@FJHTJZJRJZJVRd@NZHRJRLTJPBDJP\\h@HL^j@NR\\b@^b@?@NNNPZ\\NPDD^\\b@b@PNPNLJRR`@^HHVTRNPNNNVTzCnCx@t@NLtBlBHHFDNNPNRRJHfAbAl@h@j@h@B@r@n@tDfD^\\RPNNNNr@n@XTnBhBPNPPPNNNNP\\^d@h@PRLPNRLRNPLR\\h@JPLTLRLTLTBDFLJTJRLVJTJTJVHTJVHVHTHVJVHVFVFTHXHVFVFXFVFXFVDXFVDXDZDTDZDXDXBXBVDXBZBXDZB\\t@pHDZBXBZDXBXBXBXDXBXB\\BTDXBZ@H@LHr@BTD^PfBBZDXBVBXBXDZBXFj@Hz@D\\BXBTDZ?DBRBXBVBN@LDh@Fh@?@Fj@Fh@Fj@JbAD`@BVBX?@BVDXBX@H@NBZDV@P@FBZBXBVBX@X@@@XBXBXBZBZ@XBX@VBVB^@XBX@X@XBZ@Z@XBX@X@Z@X@X@Z@X@X@D?TFhBDfBBz@@HBpADpAH~C@b@@ZHxBDnB@\\DfAJvBDj@@XJ`BLzAH`AFf@Fp@@JJ~@Fh@Hj@BR@LBNHn@D\\XfBXfBx@hF`@lCNx@DXDVRnAXdBXhBJr@n@xDTvAPjAt@rEPbABTb@fCXhBDZF\\n@~DBNNfAHf@F^PbAHl@H`@Hl@b@hCJn@?Bt@pERrADVHb@DXHf@Hf@XfBRjATzATtAVdBLp@Hh@RrAX`BTvA^~B^~BjBpLDTF^FZn@`EJl@TvAL|@Hf@Jp@@DBHL|@F^Jl@BPRjALx@XjBJl@F\\L|@Jj@Hh@Lr@Fd@H`@F^BRFZBTLt@Hf@@LJj@N|@Jn@j@nDHd@b@rCXbBHf@Hd@Hh@H^DZFXDVLl@Jj@ThAZvAThAVjAXhAFRDRFTH^HZFTRr@Pr@^tATz@^nAFPRn@Pj@@DHV^hARl@JV?@Tl@HVJVHTJXPb@f@lATj@Tj@DLBBFNHT^x@?@Rb@Rd@Vj@R`@d@bAJRN\\LVd@bAj@lAHNJRJTVh@JRJTR`@N^JRLTHRLTJRHTb@z@Xn@Vh@Rb@DHb@|@@BLXFJJTt@|AjB|DHRVh@LVJR|@lBdFtKVf@p@xAbAvBDFXl@x@fBR`@P\\d@`A@DDFN\\`@x@LX`@z@dExI?@JRLXb@z@Xn@n@tAXj@JR~@nBFN`BhDJTv@bB\\r@FLRb@Xl@^v@JRj@jA`AtBZl@Zp@jCtFb@~@Td@hA`CvAzCb@z@LZd@~@FJP\\T`@Xh@FLNVR\\JRXf@Vd@PZJNLTf@x@LRHL\\j@PXXb@\\h@f@r@RXFJt@bAf@r@l@z@HHNRZb@b@f@JNLPlAvANRPPJLTVX\\Z\\TVNPPPPPRT\\\\nArAl@n@HHd@h@PPXXh@j@^`@|@`AbA`ANNNPNPNNNNPR^^RRbAdA`AdALLz@~@FFFF`@`@XZLNf@f@PR`@`@VVvAzAp@r@@BXXdAfAn@r@|B`C^^t@v@\\\\hAfAFFHHZXt@p@NN^\\PNb@^p@h@d@`@FFHF`@\\b@\\PLNL^Vz@n@FFj@^TPNJZTXRt@j@RLPLPLPLPLPLPLHFVPRNFDn@b@^X\\VHDf@`@LFRNFDXRRNNJ`@ZTNPLNJFF\\TxAdApA|@r@h@JHPLPJRNPLRNPLRLPNPLPJHFZTNLRLt@h@RNhAx@\\VXPPNRLPNPLd@\\RLTPp@d@HFHFTNLJPLPLDB^VTPLHPLn@f@HDDDHFPLTNLJ@?NLPLRNHFFDRLPLPL?@PJPNPLPNPLPNTPLJNLFH@?HFNNBBJHFHHFHHDFFFHFPPNNFFFFHHDFHHVV@@HJNPLNNPPRLPPRLPBBJLNPNTLPNRLPPTJP?@NRNTJNLT@@JPLRNVLPJRLRLT@@LRLRLTJPLTLRNTLTLRHNBD@@LRJPHNLRNTJTNRNVLTLRLR@B@BFHBDLRLTLRT^LTLRJPLRJPNXLPNVFLNTNVLRHL@DHL^l@Vd@NVNRLTPXBFNTLRLTLRJRLRNVLP?@JRNRLTJPLTLRLRNVJPLRLTLPJRNTDFFLJPFHLT@Bd@v@Zh@NTDHNTJPZh@LRXd@JPPXDJ@@DFJPJPJPLRPZLPDHFLZf@JNJRRZHNLRJRNRLT@@JPJRNTJRLRJNrBjDx@rAjCnEbCbEV`@T`@@BT\\FLLRLRr@lA^l@x@tAJRJPLPXf@R\\^n@DFPXXd@Zh@h@|@j@`ALPLVLRZf@LTHLBDLTLPh@~@h@|@NTJPNXJNLTLRLRNVLRJPLTLRLT@?LRJRLTh@z@NTJRLTNTHNLRNVNTLTJPNVLPLTLRNXVb@NRLTLRLTj@z@LRNR\\d@NRLRNRNPNRr@x@JLNPPRNPNPb@d@LLPPNNPPPPPNRRLJNLPPRNPNPNPNPNPNPLPPRNNLPLd@`@xAlAb@\\b@^b@^b@\\b@^b@\\NLPNfA|@PNPNPLPNb@^RNb@^xAlAt@l@`@\\t@l@d@^PNhA|@b@\\t@n@RNbAz@t@n@xAlAz@t@ZXxAjAb@\\v@l@RNPLRLd@\\RNPJ~AfAJFv@f@JF`Aj@PJRLRJPLRJf@Vd@X|@d@x@`@z@b@RJRJPHRJf@Vf@VRHRLRHRJ^Rl@Xf@VpDfBRJf@Vx@`@@@d@Tz@`@RJPJf@VXLt@^VLVLRJPHRLRHNHRJTJPJRJTJNFVLPHRJTLNHRJHDJDRJNHRJRJTJPH@@PHRJPJRHh@Xt@^^PLFNH@@PHNFFD^PTJRJTLPHRJRJRJd@TJDFDRJRJd@TRJRJRJRHPJRJd@Td@TTJPHTLRJRHRLPHRJPHPHh@XTJPJRHNHVLPHRJRJHDJDHDXNRJRJTJNHTLRHRJPJRJPHPHVLPJPHTJRJPJPHTJTJPJPHNHTJLHRHHDPJ\\NZPRHLF~@d@RJRJRJNFTJRJRJPJRJVLPH`Af@\\NRJPHTLPHTJPJRJPHXLPJNHTJRJPJRJTLNHVNLHTJPLPJPLTLPJNLRLTNNJPNRNNLPLBBNJNLPLPPPLPNPPLJNNTRNLJJTVNLNNLNRRNPNNNRPPNRLNPPNP\\d@NRLPNPNRLRLPNRLRNTLRNRLRLRLTLRLRJTLRLTLTJRb@z@NXJTJTJTJTJTJVJTJTHRJVJVHTJTJVHVJTHTHTJVHVJVHRJVHTHTJVJVHTJVHTJVJTHTLZRh@lDpJXt@Xp@x@xBL\\N\\h@xA\\z@`@hAJVFPJTHVJTJVRl@JTJVHVJVHTJVHTJVJT^dAJVHTJVJVJXHRJVHTJVHTJXHRJVFRLXJVHVJTHVJVLZFPJTHVJTv@vBRf@JXHRBFFPJV`@hAHP^dAJVHVj@zAJXt@pBt@nBd@nAJZJVHVJTHVJTHVJVHTJVJTHXHRJVJVHTJVJZHPRh@HXJRHVJV`@jARf@`@dAb@lATh@Rj@JTLZ@BFPLTJTJRNZFLLRNXHNNRPXLRJNPVNPFJPTLNPRNPPRPPLLb@b@HFLJTRRPLJ\\VPLRLBBLHd@XRLTLRJ\\PXNTJTHPHh@PRHVHPFPFVHRFVHnA`@RF~@XVJTFRFRHTHRFRHRHTHRHRJRHRJRHRJRJPJD@FDDBB@DBHDRLDBDBDB@@HDFDPLRJPLPL`@XTPRLNLRLRLPLPNPLRLPLPLPLRLPLPNRLPLLJHFHFFFDBBBPNRNNNLJBBPNNNRPNNPNNNHHDFPPPNHJ@@NRLNPPRTLNPRNPLP^d@BBJLLRNPLPNRNRLRNTLRXb@NTLRFHFLZd@NTLRNTLPLRLRLRLPJNPVNRj@r@Zb@DBdApAHH^b@PP^b@PPNLNPLLTRJJPNPNNNRPNLNLNLLJ@@TNRPRNPLRNLJRLPLRLPLPLRLPJRLRLPJRJRLPJRLPJRLRJPLd@Vb@VVNPJPJVPNHRLRJPLRJPJPLTJPLPJTLNJRJRLPJRLLHD@PLRJRLPJRJRLPJRLHD`CvAzA|@PJPJRLPJRJRLPLRJPJf@XTNVLJFPLRJPLRJRLPJRLPLRLPJPJRLRLt@f@RLPLXP^VNLRLPLPLRLPNPLPLRLPLPNPLPLRNPLPLPNPLPNPLPNPLPNPNJHDBPNPNPLPNPNPNPNPLPNNNPNPNPNNNPNPNPPxBpBb@`@LLPPRPp@p@^`@NNPPNPPPNLNPPPLNPPNNPPNPNPPPBBHJb@b@RR\\^NPPPn@r@hBlBBBpBxBHFTVVXbAdA`@b@^`@`@`@hAlAr@v@VXfDnDhDrDnArAn@p@LL`@b@b@d@VXVXpBvB^`@PNNPNPPPLLb@d@^b@`AbAPPNPPP?@ZZRT^`@^b@PPNNNPNRZZPRPTn@t@p@t@lAxAb@h@PRNRNPNPNP^d@\\b@NPNRNPNPLRNPNPNRNPLRNPNR\\d@\\d@B@V^PTFHj@t@b@l@hA|ADHX^f@r@@@|@pANRRZFHPTZd@NRZd@\\h@PVJNLRLR\\f@\\f@LRLRLRNRLRNTJNNVLRLRLRLRLRLTNRf@x@@BJNNVLRLRLVLPLTLRJRLTLRDFFLJLNXLTLRLRLTJTLRLRLTLTLTDHDHLRLTLTJRLTJRLTLTJRLTLTJRLTJTLRJTTb@`@v@HNLTJTLTJTJRLTJTLTJTLTVh@JTLTJTJTLVLVXl@JTXj@JTJTJTLTJTJTJTJVJTJTJTJTJTLTJTJVJTJTTl@BDRd@JVJTVj@JVJVHRJTJVJTVl@HVJTTl@JTJVHVJTJTHVJTFRVp@JVJTFRLXHVj@zAHTJVHVJT^fAHTJVJXHTTn@Nd@HVJVJZHVHTHVf@|A`AvC`AxCf@xAHVTt@HVJVRl@FVJVZ~@J\\HVHTHXJTHVFPJZXz@v@`Ct@zB`AxCXx@DNHTRl@Rn@^fA`@jA\\dA\\dARn@^fAHT^fAHTt@zBn@jB`AvCx@dCRl@hAhDFNjAlDpA`ETn@\\bAHVFR^hATn@f@zAFPbA|CPd@h@~AfAdDFR|@nCTn@tAdEt@|Bh@|AHVHVHVNb@lApD\\dA\\fAHVJV\\dAr@tBHVHVf@|ATn@|@rCJVDNHVXz@N`@HTHVf@zAr@xBJXHTHXHTh@|Ar@vBJXv@dCN^HVHVJZFRHVJVRl@Rp@JTHVRn@HVJVHVHVRn@FLBJTr@Rl@h@`BRh@\\dAHV|AtEHVDLBJJT\\fAHVRl@HVTn@Rl@HVPf@L^HVHTHVHVHVJVJ\\HTTn@HVDLBHHT@DFPHVHVr@tBRn@HV^jAFL@DTr@z@lCbA~CPj@j@dBHVJZPj@L`@t@|BJ\\FP\\dAHXHVHVHTTx@j@bBFNDNRl@Lb@Nd@pA|DL`@DJHXHTZdAJXNf@L^HVHTHVHXHTJZ?BPd@Nf@t@~B@DL\\ZbADLHVRn@FTFNj@hBHV\\fARn@f@zAnA|DBH\\bAPj@\\dARn@FRBFHX\\fAHVRl@DLDJFVHVHTFPxB`HJZHTZbAPj@L`@FNHV\\dA\\fALd@DHHZFRFRDHX`Af@~A\\bAr@~BX|@Nd@Nf@@@ZbARn@HTFP@FJXFRFT@BBDDNDNL^Nf@Nd@JVFVFP@DHVHVHVHVHVRl@FXX`APp@BJ?BJb@FVFVFZ?BJb@Hd@DTJn@DZDX@HFh@DXBVFf@@LBXBZBVBZ?J@PB`@B\\?JBX?RBh@@j@?Z@t@@h@?f@A~@?f@?@AZAr@Ct@CXCr@GnAEx@Cp@ATCb@AVEt@SlEEv@Ct@Er@GfAMjCAZAXEr@AXCZ?LEr@Ex@GfAEt@Ct@Et@Ev@Cp@Et@Et@AJCf@Ev@Cr@En@Ev@K`CEv@Ex@GfAGpAGpAAJE~@EbAEbAIrAGhAGnAGnAGpAEv@Ev@Ez@Ex@A\\G~@EfAGlAARAPG`AEz@Ev@E|@AREr@Cl@IjBG|@E|@?JGjAGpACv@GnACv@EjA?@Ch@Ad@ElAGdBCx@CnAElA?R?FAVCx@C|@ChAAv@?L?@C~@At@AfAE~BAlAAv@Ab@EvHClD@xCAZ?dK?V?b@?v@?X?X?Z?X?X?\\?p@?x@?r@?X?Z?X?Z?\\Ar@?nA?jB?p@?T?bA?~@?|A?t@?rA?fB?pA?vA?f@?~@?x@?jA?lA?rA?h@?rA?D?pAAhB?nA?`@?fA?hB?nB?bB?vA?dB?l@?t@?V?zA?vD?pA?fA@|@BvABr@@V?D?H@ZFzADrALrBFbABb@BTFx@JnAJ`AJ`AJdAJ|@PlANbA@FJr@RjAHd@BLLr@Lp@ThAFXH`@d@vBXpANl@b@pBDh@l@fCLd@d@lB^fBBHH^l@jCTdAFXJd@Pr@b@pBXrAFZVfAJh@@F\\xAFVTbANr@Jd@h@dCVhAf@~BLh@H\\ZvAR~@f@xBBNXnAZrAVjA|AfHHZH\\\\|ADRFVPz@DTHXFVTfA@BNn@HXFVJ^JZBJ\\fAFRTr@^dA`@bAN\\Rd@^v@BHHNZp@LTf@~@LRh@|@d@t@BD\\f@l@z@l@v@FHVZn@t@p@p@r@r@NPb@`@b@b@^\\bAbAXVXXNNr@p@ZXVVr@p@JJTTr@p@b@`@`@`@RP^^`@^JHVT`@`@b@\\r@p@f@`@p@j@RNp@l@b@\\PLRPj@f@j@f@PPFDv@t@FDb@b@ZZPR^\\r@x@b@d@\\^p@r@`@d@t@z@Z\\r@t@~@`A`@`@`@^j@h@lAjAx@x@nDhD\\\\d@b@b@b@x@v@TTNNJHRRFFPNd@d@r@p@RRb@`@FFFHp@l@RP`@b@ZXHJPLJJb@b@~@|@BBd@b@LL`@`@PNHHRTFDZZdB`B\\\\l@j@z@x@XXdAbAb@`@JJDDNNPPb@`@^\\TT`@`@XXd@b@^\\\\\\d@d@^\\@@VV^^h@h@\\ZTTNPLLXVHJr@t@b@b@Z\\TT`@b@`@b@RT`@b@p@v@PPHJ\\^l@p@j@p@VZ^`@NR`@f@X\\bAlAd@j@p@z@f@p@f@n@dAtAr@~@|@lA^h@z@jAHLNR|@lAj@x@Z`@`@j@x@hAr@`Af@r@DFJLTZX^t@dAp@~@p@|@p@~@lA`Br@`An@|@|@nAn@z@r@`ARXV\\n@|@t@`AX`@h@t@d@n@PVRXl@v@JNRXTZTZTZJNZb@p@|@V^x@hAj@v@TXLR^d@hA~AbAvAjA|AhA~A^f@b@n@`@h@PTNRnAfBv@bA^h@X`@p@~@v@dAZ`@JPPTj@v@l@x@NRZb@@BHJ`@h@JLLRBBJPTX^f@NTLNT\\JNX\\@@BDX`@PVLNLPTZV^PTBDLPPTJLBDDFFHRVNTLNFHHLLPBBV\\@@JNPVPTNRRXPTRXV`@`@h@NTV\\PVLNJNLNNTX^RXRVLPTZHLRVLRTXTZRVNVJLJLNTPTHLFFNTNRPVPTPTTZFJDDRZDBHLPTV^LN@BRVPVNRBDRVFJPTV^BBLNFJJLFHRXJNLPX^NRPTPVXb@RVRV@@DFFJFHLNNTJLFHLRDD@@FHLRNPNTLNLPJPRVRV@BLPPTZ`@l@z@x@fAJNp@~@RXRZt@dAj@z@`@l@HL\\h@X`@@BjBtCxA~BXd@v@nAR^^l@\\j@`@r@`@r@Xf@h@`AXd@DHZj@Xf@h@bAVd@JPNXf@`Af@`Ah@bALXFJZl@l@nAR`@DJNXXl@Xl@Vh@LVNZFLXp@Vh@j@nAVj@rA|CnAxCx@nBJVvBtFf@rAj@vAHTHVJZJVh@xAt@vB^dAh@~Ad@vAVx@f@|ARl@Tx@n@pBPl@XdAJ\\X`ALb@XbAV~@Vz@ZjA?BFN|@nDVdAb@`B?BXlANj@Pv@Np@J^BNHX^hBTdAVjA^dBNr@P~@BLf@hCP~@TjATnALr@RlA`@~BDTZjBHh@j@tDn@jEr@hFd@rD`@dDtAzKXzBr@rFzAzL^vC`@~Cf@~Dr@pFR`BJx@Lz@fBrN|@fHt@bGl@zET~ATjBRxANjA@LHn@NdA@NPtAX|BF^ZjCZ~Bj@lEb@pDT`Bp@pFDVBP^xCj@rEBPR|ANlAHn@n@`FTlB\\fC^zChBvNf@`EVlB\\rCl@xEbAbItAvK`@~CBVRxANjAHr@PtAVrBx@nGL`ATbB?Bp@jFFh@lBbOhA~IFh@NdA@NDXHj@Jx@BXVfBHt@Jr@Ht@TdBJt@Fb@BR^|CVhBXzBTlBTbBHp@D\\ThBTdBb@lDF`@DXD^b@hDBXPpAL`A\\lC|@`H@LHp@BR?B@BFd@~AdMNnAPnAHt@PlANlADXl@rEHd@NtALt@f@fDBLhAtHZnBLx@RhAN|@XdBl@rDJl@\\jB`@bCVrAJh@TjAhAbGBNNn@f@fCR~@b@xB`@nBLf@P|@Nn@b@jBNp@DXNl@Lf@`@`Bf@rBf@nBRx@v@rCBJ\\lAb@~ADLl@tBj@jBNd@r@zBJZ?BBFJZPf@Pl@~@rC@BPd@~ApEJXh@xAfAvCt@pBbAdCRh@pA~CdB`EbClF`AvB|A`DdAtBfBhDHPjAxBLRf@|@h@`ALTLRHPT`@T^Zj@Xh@\\h@LTLTXh@Zh@Zh@Zh@Zj@Zj@PXTd@Zh@Zj@Zf@f@~@j@`A`@r@`@r@Zj@h@~@f@|@v@vAd@v@^n@j@bAb@x@bAfB\\n@Xd@h@`Al@dAHN|B~DpA|B~ArCdAlBhAnBfCnEnC|EbF`JlEzH|@~AZf@rBrDnAzB^p@x@tArFzJrA~Bj@bAVb@`@t@r@lAlAtB~@`Bv@vALRLTd@x@BFLRXf@Vd@JRp@hAp@lA@@`AdBJP^p@f@z@bAhBZh@h@`AHNv@tAXd@r@pApA|Br@lAt@rA`@t@b@t@PZh@~@v@rAbD|FbAfBh@`At@pAt@tAf@z@\\n@d@t@\\n@bAhBl@dA^n@b@v@j@`AZh@^r@\\l@Xf@\\j@Xh@T`@\\l@^n@R^R\\b@t@lAvBd@x@n@jA|B~DjBdDdAjBl@fAr@pAh@~@Zh@v@vALTJRNTJRZh@\\j@d@x@\\j@`@t@lCzEXf@DHR^x@zAb@x@d@x@NVJRT`@PZLTLRLTJPNVLTLRLTLRLTLTLRLTLRLTLTLRHNR\\JNLTXh@h@|@LTLRZj@Xh@LRLTZh@Zh@FLp@hAjAvBn@fAd@z@t@pAj@`Af@|@h@`ArA`CnAxBj@bAv@rAb@x@h@|@d@z@^n@r@pAr@nA`@p@d@x@b@v@n@jAf@z@\\l@Xh@Xf@j@~@f@~@`AdBf@z@Zh@f@|@Zh@Xh@Zh@LTJRLTPXLVJRLTLRTd@LTLTJRLTLTJRNZLTLTJRLTJTLTJTLTJRJTLVJRLTLVR`@Xl@Vj@Zn@`@z@\\v@z@jBXn@Vd@lAhCd@bAn@vAb@dATj@^~@JXJXj@tAf@rAZv@Pd@Zv@`@bAZ|@`@dAXv@^dA^bAt@tBz@bCZ|@^lAfBjFr@~BJ\\bAbDd@`BVz@BJ\\hAZhAPn@ZfAt@rCNh@Rt@Lf@J`@HVDRHXFXHZFTRr@Lj@H\\J^Lh@HZFTFTFZHVFXFVFXHVPp@Np@Nn@Pp@Np@HVFXFVFXPn@FXHXFTFXFVHZNj@Jd@Lb@H^Lf@H\\Nn@J^Lf@Rv@Nn@Np@Pn@FXZnALj@Lf@VbANn@f@rBj@xBh@zBv@~CT`AXhAJb@Pv@J^@Bd@pBXhAH^Nl@Ld@@HnB`IzC`M~ClMjCxKpExQ`A`EbCtJxAnGvA|FtArFjCxKL`@Lf@@FLf@FTJ^^zAf@rB`@`BtA`GJ^^zAv@`Df@tBd@hBl@fCnAdFFTd@jB`@`Br@tC~@|Dn@fC`@fBTx@`A~DZnAzD~On@lC^`B`@fBPx@l@vCr@pDh@lCP~@PdAZ`Bp@|DXfBj@nDXpBf@pD\\bCLbAPzADX@PFZf@jEZvCPhBBVLvAVpCPpBH`Al@zHj@rHHz@HdApAtPJpAd@dGP~BJtALvAP`CTtCl@zH^bFBX^vELbB`@pFHbAJpAH~@Fp@?FJfAPxBL|AP`CDj@@D?J@Dl@zH?@LfBJ~AZfEh@lGLzAHdAH~@JlA^zEv@jKDd@^vE`@nFZ~D|@dLnA`PXrDHjAPvBd@dGXvDPtBPxBLdBH~@R|BJtAPfBLvATvBXrC^dDHn@b@pDFb@Ht@VhBHn@p@vEHh@\\~BF^Jl@P`AXhBNv@\\nBTrAVpAJh@XvAX|AZzANx@^fBt@vDThA^pBXtAVlAXvANv@Jh@VrAp@bDP|@v@xDJj@Jd@Jh@VpALp@`@rBd@zBJh@Jf@TnAThAt@pDJh@Jf@Jh@Ln@TlAd@|BtAbHn@~Cn@bD`@pBLr@XrAb@zBJf@TjAXrAVpAb@zBd@zBJj@Jd@?BJh@tA|G?@xBxK|@pEzAvHDT@FBF\\hBdBvILj@ZzAJj@Ll@Nv@lAfGJh@b@xBXrAdAnFtCxNtA~Gz@lEx@dEjCxMf@fCvAdHzAtH`BjIb@xBn@dDh@jCh@jCf@dCTlANp@Hd@v@zDhAvFVtAv@vDXvAnDpQl@|Cr@jDP`AbA~EVnAb@|B`CrLrEnU\\bBv@|DbBlITlANr@TjAdC`MpBfK^hBVlAThAn@dD@FFVNt@FVDZFXFVFXFXDVFVDTFZFVFXDTFZLp@FXb@xBFVDVNr@FVDXFVFXFZDTFXFXDTNp@FZFVFX@HLh@FVFVFXFVDVHZFVFXFXFTFXDTHZFXFVFVFVFVHXFVFXFTHZFVFVHVFVFXFTHXFVHXFTHXDRJ\\XhAHVHVFVHXHT\\fAHXHTHVHVFVHV`@zAHXHTHVHZHVFR@@FTJXHTHVHVHVHVHVHTJVHVHVHTHTHVJVHVHTJXHTJX@FN`@LXFTJVFP~@dCj@zAZx@FLN^FPTl@JTJVHRLXVl@FPNZHRLXHRFNBD\\x@L\\JRVn@LVHRLTJTJVXj@Vl@LRJVJTJRJTLTFP@@LXJRJTJPDJFLJTP\\NZNXLXHRP\\Tf@vAvCr@xAbBlDv@bBb@|@`@z@^x@R`@LT\\v@p@tAZl@p@rAnAhCjDfHP^Rb@HR?@HNRb@Rb@Rb@JXv@`BjAdCjCpFjAdCzA~CzCnGzBzEf@dAdD`HbCbF?@bBlDR`@nBbEf@dAzA~C|CpGxCnGDHRb@Zn@Xl@Vh@Xl@dAtBt@~Ap@vAHR@@p@vA~@jBvAxCZr@lB~DbAtBNXf@fAt@|AVh@Xj@d@`Ab@~@xA|C|@lBjA`C^v@P^LVn@tAjA`CRd@`@v@Xn@|@jBLXv@`Bf@dAhClFvAzCf@bAl@pALVRb@bArBt@|An@rAn@rALVVh@\\t@vBnEhAbCd@~@\\t@DJpAlC|@jBr@zAFJVh@|@hBXl@d@bAv@`BDHP\\l@nAJTXl@JRd@~@Xn@BF^t@Zn@Vj@JTVf@Zn@HPXl@NZJTR`@LVp@tAn@tAh@fATf@Td@P\\HPZn@N\\^v@HNNZJTR`@h@fAJTLXjAbCRb@pBbE\\t@Tb@FNRb@JRHPhA|BRb@|@jBf@fAj@lAP\\Zl@`@z@Zn@b@~@l@nAVh@~@nBb@|@Rb@Rb@j@hAf@dARb@Tb@d@`Ap@vAd@~@Vh@Zl@JRR^Rb@T`@NZJPP^Tb@b@x@h@dAVf@Tb@h@dATb@Tb@vAnCXl@Vd@DHjA|Bt@vAVf@zAvCLVVd@R`@v@xAt@zAJPZl@|@dB~@hBTb@BDd@~@|AvCv@~AJPHPTd@R`@f@bALVTd@DJFJZn@@DVh@\\v@LTb@~@Xn@\\t@FLP`@Rb@^x@FNbA|BBHj@rAPd@DHN\\JTb@fA|@zBr@fB`@dAf@nAL^b@fAHVTl@JXRf@HXJTRn@\\~@Vt@Rh@JXJX\\bARn@`@hAZbARl@Rn@HVRl@JZDNNd@Pf@ZdAZdAHVJ\\HVNh@JZPl@^pALd@Rp@Nh@Rt@ZhALf@Rv@HVHZFVHZFPFVJ`@DRHVFXHVFTFVPr@Nl@Np@HZBHBLHZFTVhAPp@Ln@HXDVHXFVDT@DDTFTFXFXFVFVFXDVBF@FJf@DPFXFVDXFVLn@FXFXF\\FTDVFZFVLr@FVJp@FZLn@F\\DRDTLp@F^FXFZJl@DZFVLr@Hh@`@bCF\\XhBJl@VfBVfB@DNbAJt@Jv@@HFd@BJ^rCPxABNHj@BV@H@D@JXzBD^Hp@LlAFh@@JBP@JF^BZFb@Fl@D^Fn@Fn@DZ@PBZF^BXBXHn@B\\DZFp@DXB^DVFr@BVD^BVJ`A@JHx@BPD\\BV?HBLHt@Fn@@JFh@BZBTBT@HJ|@Dd@D`@BNDb@Db@NrAVjCDXHv@PfBD\\Fp@Fj@Ht@Fr@LjAFr@LjA@@Fp@d@vEJ|@Fn@BV^rDFj@Hr@NpADf@XhCPdB@H?@@HDd@J`AJ|@b@hETzBXrC`@vDNzAj@rF@LBRFj@T~BDX@N\\jDVdCLjA^nDFj@N|Af@`FDTFp@Db@Fj@`@zD?@BRHn@B^DXPbBFr@DZHr@Fr@LlALlAV`CHv@Fn@Ff@\\hDRhBBVHr@D`@T`CP~AHt@PlBFj@NpAH~@NzAHv@Hz@JbA?@JnAR`CBRB\\BZFr@LzALxAT`DHhAHlAB\\@XHjAJzADj@JdBJfBDv@Dv@Bd@@JBj@Bj@JdBJ`CJtBBf@HdBFdBFjAB^Dz@DjA@P@N@ZDr@?B?FB\\@\\HbBFtADn@@ZDp@@`@@V@TB^@XBT@Z@XB\\Bn@B^@RDpAB\\@V@V@ZB^Br@LbC@TDx@N~CTfFDv@@XDr@Bt@FlA?DFhA@XBZ@\\@V@VBZ@V@ZBX@\\@VB\\@T@\\@VBX@X@X@D@T@X@^@VBV@^@T@XB^@V@TB^@T@\\@@@TDv@@VDz@@RBv@Dt@FhBHfBDnA@XDjABt@Dt@@\\@V@r@Bn@?^BlA@p@@X@z@?B@X?N@L@p@@r@?p@@B@~A@hB?X@X?Z?D?l@@V?b@?Z?r@?Z@lA?T?\\?X?@?V?ZAZ?X?X?X?X?Z?XAZ?V?Z?XAZ?X?XAX?Z?XAV?\\AZ?XAX?XAZ?ZAN?F?XAZAZ?VAZAZ?XAZAX?ZAVAZ?XAX?XA\\AX?VAZAX?ZAXAZ?VAZAZ?VAZAX?ZAXAX?ZAXAZ?XAXAX?XAZAZ?VAZ?VA\\AZ?XAXAZ?VAZAX?ZAXAX?ZAXA\\?TA^?P?DAXAZ?XAZAZ?XAV?T?F?RA\\?X?@AX?V?Z?XAZ?T?B?X?@?V?X?R?F?XAZ?X?V?\\?X?X?X?Z?X?X?Z?V@Z?Z?X@X@r@?Z?V@Z?X@Z?X@X?Z@X@X?X@X@Z?X@X@Z@X?X@X@X@Z@X@X@X@Z@X@V@Z@V@Z@X@X@XBZ@X@X@X?BBV@V@X?@BXBr@@F@P@XBX?B@TBZ@XBX@V@BFdAJrAL|ABZLdBHt@VxCTxBBTDh@Db@j@nFB`@\\`DFn@Db@NtANtAb@tEPzAJlANnAJlABVJz@JbAD^Fl@ZbD^nDDh@^pDHt@Hz@Hx@LjAHr@JlABLHv@JdAHt@H|@@NRfBDf@Ht@D\\T`CNzAVdCT~Bl@xFBVXxCRjBFn@DZBXBVDZBZBTDZBXDZBVBZBTBRD^BXD\\BTB\\BTDZBXBVBZDXBXBXDZBVBXDXBZBTBZDXBZBVDXBXBXDXBZBXDXBVBZBXDXBVBXDZBVBZBVDZBVDZBXBXBVDZBXBXDXBXBXDXBZBVBV@JBPBZBTDZBXBXDVBZBVBZDVBXBXDZBVBXBXDXBXBZDXBVBZBVDXBXBZDXBVBXD\\BVBVBXDXBZBVDXBZBXDXBVBZDXBXBXBXDXBXBXBXDXBZBVDXBXDXBXBXBXDXBXDZBVBZBVDZBXBVDZBVBZBVDXBZBXDVBZBVDXBVBZBXDXBXBXBXDXBVBZDVBZBXDXBZBVDZBVBXDZBZD\\B\\D\\BVDZBVBXDXBXBXBXFh@Fh@BTBZDZBVBZDXBVBZBXDXBXBVBVD\\Fh@@L@LDZB\\BRD^BZDVBZBXDXBXBXDXBXBVBXBVDZBZBVDXBXBXDXBZBVDXBZBXDXBXBXDZBZBVDXBXBXBXDVFr@BXDZBVBXDXBZBXDXBXBT?BBT@H@LDZBZDZBXDZBVBVD\\BXBTBZDZBVBXDZBVBZDVBXBVDZBXBXBXDXBXBXDXBXBXDXBVBZBXDXBVBZDXBXBZDVBZBXBVDZBVBXDVBZBZDVBXBZDXBXBXBVDZBVBXDXBXBXDXBZBXBP@DBZBVBZDVBXBX@DBRBZBXBVDX?FBNB\\DVBXBXD\\BVBVBV@BBVBZBXDVBXBVBXD\\BT?BBTDX@N@JBXDXBVBZBXDXBZBVDZBXBT@BFt@DVBZFp@DXB\\BTDZBVPhBHn@BXD\\BXFn@LlAD\\BXBXLlABTBXDXBXBXDZBVBXDXBVDZBXDXBXDXBVDZBXDVD\\DVBTD\\DVDVBXDZDXDTDZDVDZDVDXDXDXDVDXDVFXDVDZDXFVDZDTFXLr@DVDVFXDVFXDVFZFVFVDXLn@FZLn@FVHZDVHZ@FBLFTFVFXFZFVFVHZFVFTH\\Lh@FVFVHXFVNn@DNHVFVFVHVJ`@HVFVL`@FVNd@HXFVHTHXJZFVHVHTFVRj@FVBDHXHXTn@HTFTJXHTRn@HTLZFPHVHTJVHTHVJTHVHTJVHVLXJVPf@BDDNJTJVJVHTJVJVJRHTLZHPJVJRJXJRJTJVJTJTJTHRLVJTJTJTJTLTHRLTJTJRLVJTJRLTJTJTFJBFLTLTJT@@JPJTLTJRLTLRJTLRLTLTJRLRLTJRLTLTLRLRLRLTLRLRLTJRNRLRLTLRLRLRLRLR\\h@LPLRLRNRLRLPNTLRNPLRNRLRNRLRNPLRNPLRJLBDLPNRLPNRNPLRNPNRNPLPNRNPNPLPNPNRNPNRNNNRNPLNNRNPNPNPNRNPNPNPLPPRNPNPNPLNNRNPNPNPNRNPNPNPNPNPNRNPNPNRNPNPNPLPPPLPPRNPLPPPLPNRNPNPNPNPNPNRNPLNPRNPNPLPNPNRNNNRNPNNNRNPNRNPNPNPNPLPPRLNPRNPLPNPNRNPNRNPNPNPNRNPNPNPNPNRNPNPNNNRLNPRLNNRNPNPNRLNNRNNNPNRNPNPLPNPNPNPNRNPNPNPLPPPLRNNNRNPNPNPNPNPNRNPLPPPNPLPNPNPNRNPNPNPNPNPLPNPNRPPLPNPNPNPNPNPNRNPNPLPPRNPNPNPLPNPNPNPNRNPNPLPHHLNNRNPNPLPp@v@NPLPNPNPNPNRNPNPPRLNNRNPNPNPNRNPNPNPPRLPNPNPNPNPNPNRNPNPNPNPNRZ`@PRNPNPNPNPNRNPNRNNNRNPNRNPNPNRNPNPNPNRNNNRNRNPNPPRNPNRNPNRNPPPLPPRNPNRNPNPNRPPNRLNNRNNNRPPNPNRPRLPNPPRPRLLNRLLDDLLNPNPPPNNNN@BNNPNNPPNPPPPNLPPPNPNHHFFPLPPNJPPRLPNPNPNRNRLPNNJ@@PLRNRLPLPLRLPLRLPJRLRLPLTLPJ@?NJlAp@d@V^RZNPHRJRJRJTHRJPHTHTJRHRHRHTJPFTHTHRHTHRFRF~@ZVHNDVHRFTFRFTFRFTDTFRFTFTDTFTFRDTFTFTDRFTDTFRFTDTFTFTFTFRD?@TDRFXH^Jn@RTFTFVHPFTHRHTFRHTHRFTHRHPFB@RHRHTHRHRHRHRHTJRHTHRJRHRHRJTJRHRHRJRJRHRJRJRJRHRJRJRJRJRJRLRJRJPJRJJFFDRJPJRLRLRJPLTJPLPJRLTNPLPJTNPLPJPLRLPLPLRLRNPLPLRNPNPLPLRNPLPNPLPNPLPNPNPNPNNLPNPNPNRPPPRNNNPPPNNNPNRPNNPPNNPPNNPPNNPRNNRRNNNPPPNPNPPPLNPRPRLNPPNPLPFHn@v@\\b@RVDD~@lANR|AtBhAbB|@rAZd@\\h@LT\\h@h@|@t@pAZj@v@vA~@fBh@dAd@~@rAxCBBv@hBVj@N^P`@Pb@p@bB@BN`@Pf@Rd@FTPd@Pf@d@rAJ\\b@tAL\\Pj@HXHT^pARr@Rv@BJHV@DLf@BJVbALf@Lb@f@|Bj@jCNt@DNTnAb@fCF^Lx@Lr@@H\\zBHf@XpBNjAb@bEN~AFh@N`B?@LbBBZBVHhAFz@@TB^?BDp@HxAJzB?D?JBj@Dj@?H@TBn@D`A@RB^Bj@@L@VBj@@Z@VBX@^Dt@@Z@V@ZBZ@X?DFjA@V?BDp@@X@JBj@Bf@?N@T@D@V@XBn@@V@H@R@^HnABf@@H@ZDr@B\\@VBXB\\B\\@RBR@LBXBZBTBT?FHn@B\\D\\DXDZD^Ht@BJ@LF`@D\\Hh@F^Nx@?DVtADVNv@H`@DTH^FVDVBJBJHZFZH\\XjAHZDNLb@HZ`@xAJXFVL`@Nh@HTHVV|@DNRn@Pl@BHNd@Rp@HVRr@Pl@\\hANd@J^`@tAPf@FVHXHVHVHVPj@?@HTLb@Nf@Pl@JZFTRn@Rp@FTFVHZNf@Px@Rx@?@DRDTH`@FXDTFZBN@LDTF\\@NBJBVDXD\\BL@LBXD\\D\\BZBZBZB\\BXB\\@\\B\\@XB\\@\\@ZBx@@Z?Z@\\?\\?X?\\?x@?\\?N?LA\\Av@AZ?\\AZA\\CXAZALCh@AXCXCXAZCXAZCX?FAPGv@AZCZC\\AZCXCXAXCZAZCXCXAZCZAXCXAXCXCXAZCZC\\AVEt@CZAVCXA\\CPC`@AVIrAATCXGnAC\\ATGr@AXG~@KdBAR?BCZEt@APCX?HCZEr@IrAAVIpACZCf@APCVC\\A\\Gr@A\\MjBATAFAZC^O|BAXEp@C\\ARI~AEbAEr@AXEh@ANCZCZA\\CXCZCZAZADARCVAXCVATAVCV?HCXEr@Et@CZC^C\\Er@C\\A^Gt@C`@GjAKhBc@fHAZqAlTG~@Q`DO`CIpAGhAKdBInAOpCc@~GUzD_@lGY`FShDShDCh@AHWfEMzBGdAKfBC^AH?HKrACZCZCZCZCZAJCNCZCZCTCXCZEZCTCZEXCXCXEXCTEX?@CRGd@It@EVEXCRGh@Ih@GXEZEVEXEVEVEXG\\Kn@GXKp@Mr@Or@Mp@Mn@Op@Or@Mn@GXIZGVGVOp@GXQn@GVQp@Qp@IVOl@IXGTIXIXITIXIVGTSp@IVIVITIVSn@IVKTIXITKVIVKXITIRKVIVKVITKVIRMZIRKXUh@KXIRWj@KZWj@Wl@KTKVWj@KTITMVIROZCFOZABKVKTKRMXIPMVCFILWj@Yj@e@`AYj@Yj@KT[l@Q\\GLYh@Yh@MTg@|@MVYh@w@tA[f@e@x@MT]j@Yd@CDKPS\\e@t@EFYd@S\\SXYf@[f@]h@KP]j@SZW^i@|@W`@S\\i@z@a@n@GLy@nAWb@QX_@l@eAbBs@hAQXeBpCg@x@[f@wA~BqArBg@x@wBlDOTg@z@]f@w@nAgAhBo@`A[h@[d@i@|@g@v@]j@OVGHcAbBCBS\\yA~BCBU`@{A~BmAnBwA~BaA~A_@j@i@|@EHkAjB]h@s@jAaAtAoAzAaAdA_@^SRg@d@}@r@i@b@_BhASLYPUNkBjAkBnA}@p@o@f@UROJUPOLQNQNSPONOLURONa@^OPa@^SPONQPMLc@b@URQP_@\\OPQPc@`@m@l@UTSPMN_@^KJGHSTKLOPUZY\\ORKPMNSZW`@CDKNOVOXWb@Yf@MXKRMVKTIPGLQb@KVIRUn@KXSl@MZOh@GRELOf@Sl@a@nAc@tA[bA]fAY~@M^GVSn@Ur@Qj@]fAg@~Ae@zAM\\Ur@Oh@Sl@Sr@]dAQl@]fAg@`B]dASp@{@lCQj@KZUt@[`AGRWv@[bAIVQl@KZIVQl@Sl@IVSn@GRIXg@|AwArECJe@vASr@]fASl@ENOf@[~@q@xBe@|AUr@Y|@Od@Y~@[dAa@lASn@[bAQl@_@hASn@]jA[bASn@GLK^Y~@CFe@xAuApE]fAABITOd@a@tAM`@i@`BQj@Y|@g@~AK\\IXSl@GPIZEJENKXIXOb@KZ]lAO`@Uv@]dAQl@ITIXQh@EPOb@Sn@Sl@GVIRKZY|@ADIXIX_@lACDCJIXITSl@Ql@IVSp@Sp@Oj@GVGTABGVGXOl@Kh@I`@EZKl@Kp@CZG^AHEf@I|@ANC`@Ef@Et@A\\ARA\\AbA?HAr@?^?t@?F@j@?Z@f@D`A@\\@VB^BV@TB\\BTBTB`@DZBTBXF^@PHn@D\\BXDZ?DBJBXJz@BTDXBXBP@JBTBZ@PD`@BTBZBZBVBZ@XBX@VB^@X@X@VBZ@Z@\\@V?V@X@\\?Z@V?Z@N?J?@?X?V?Z?j@?d@?p@?V?\\?\\?X?Z?X?V?^?V?T?F?X?X?X?X?Z?Z?X?X?Z?X?r@?Z?Z?X?X?X?Z?X?Z?X?X?X?X?X?Z?X?V?\\?X?X?Z?X?X?Z?t@?~@?L?Z?V?Z?X?D?T?X?X?Z?X?X?X?Z?X?X?ZAX?X?XAX?X?ZAX?N?JAXAX?RC`@AX?JALAZAXCXEv@AXCXEr@Er@Gj@Cb@EZCXCXCXCXCXCXCXEVGt@CXGr@CXCVCXEZCVCXCZCXCXCXGr@KjAEZCZCXCXCXCXIr@Cj@AHKlACXCXEb@ANGr@CXGt@Gr@EXCXCZCVCXCXCZ?DCRKjACZIt@C\\CTCVCZARE^CXMnAAVEXCZCXCXCX?DCTCVCZCVCXCXEXCZCXCXCXCXCXCZCXEVAPAD?DAJEf@CXEX_@rEGh@MtA]fEAJE\\CZC\\Ix@CZCZE\\CZIx@CZC\\CZE\\CZC\\EZC\\C\\EZCZC\\EZC^Gv@It@?BIx@CZC\\CZE\\CZCP?JE\\CZCZCTAJCVC\\CZE\\CZE\\CZObBKjAAL?DE`@CVCXCXCXCXCXEZCVCZCXCXCXCXCXCXCXCXIt@Gr@CXGp@Gr@CXCZCXEZCXCXCXCZCXCXCZCXCXCXCXEXCXAPAHCVCXCZGp@Gt@Gr@KnAGr@MjAGt@Gr@Gr@CVGr@Gt@CXEXCXCXCZCXCXCXCVCXCZCXCVIr@KnACVGr@?@CXCVGr@EZGr@Gt@Gp@MlAGr@Ip@Gt@KjAIr@CXCXCZCVIt@IjACXCXGr@CZCZCXCZCZCZCXGv@Gr@E^AVIr@E\\Gr@CXCXGr@Gr@CVCZIlAA@KjAGr@CVCZCZCVGr@It@CXCXCXGr@Gr@MnACXGr@CXCVCXGr@Gr@Gt@YzCCXCXCXCZCXCXCVCXCZCVEZCXCXCXCX?DCRCXCXCXCZCVCXCXCXCXCZCVEXCZCXCXCXCXCZCXCXCXEZCXCXCZCVKnACZCXCXCXCXEXCXCXKlAGr@CXCXCXCZCXCVCZEXCXCXCZCXCXCXCXCT?BCXCZEXCZCVCZCXCVCXCZCXCXCXCZCXIr@CZCVCZCZCVEXCXCXCXCXCZCVCXCXCXCXCXCXCXU`CCXCXC\\CVCVCXANAJCXCXCXCXCXCXEZCVCZCXCXCXGt@CXGl@C^CXCXIr@CXCZCXCXCXCXCRC^CZCXCXCXCXCVEZCXCXCZCVGt@CVCZCTGt@EXCVCZCXCXCXCXCZCVCXCXCXCXEXCXGt@CXCXCZCXCXEZAVEZCXCXCXCXCXCXCXCXCXCXCXCXCXCXCXCXEXCXCXCXC\\CVCZCVCZCXCXEXCXCVCZCVCZCXGr@CZCVCXCXA@AVEXCXCXCXCXCXCXCXCXCXCXCZCVCZEXCVCXIfAAFCXKlACXCXCXCXMnAGr@C^[~Cq@fI?@It@CXALAJCXM~AOpBCXAPCTATCP?@AVCRC`@CZEh@?FGv@?BALC^Cf@Ef@Er@InAAXCXAZEr@AZANATG`AAZGlAAXAZAXAXEr@AZAXA^Ch@?NAXAZAXAXAP?XAF?PAXAZAZAX?XAZAXA\\?ZAVAX?ZCx@An@CrA?VAPCzACr@?XAZAX?XCt@?VAX?XAX?XAXAZ?VAX?XAXAZ?XAXAZ?XAX?XAXAZ?X?XAZAX?XAX?ZAXCdBA\\AZ?ZAX?ZAXAX?ZAZAx@?JAh@Cj@?V?B?DAX?ZAXAZ?VAZ?XAXAZ?XAX?XAXAZ?XAX?XAZAX?XAX?ZCp@?ZAX?XAX?XAXAZ?XAX?XAXAX?XAZ?XAZAX?XAX?T?DAXAXChBAZ?XAX?ZAr@CnAAX?ZAX?t@AX?XAr@AZAr@?XAXAX?ZAZ?XEfBIfCCt@ChBAZ?XAv@?X?XAX?XAt@?XAXAt@AVAX?XAT?DAXAXAZAXAX?ZAXAX?ZAt@AXAZ?XAX?XAZAX?XAt@At@Cr@?ZAZ?VCbA?JAh@A^AhAC|@?XAt@IjECbBAt@Cz@Aj@At@AXAfACpAAT?JARAjAG|DExBAX?ZAXAX?XAX?XAXAX?ZAVAt@?XA^ChAEhDIzEChAAj@ClAChBIlFAl@Cx@?b@G|CCnBChAG|CE~CAh@AZAXAlAAZAVArAChAGzCApACbAGhDAt@AX?XCfAAz@AX?XE`BEhBAnAEdCAlAAj@CvAEdCCjAEnBAn@Ar@AXAX?ZAV?ZAX?ZAXAX?XAX?ZAX?ZCr@?XAV?B?XAXAZ?XAX?XAZAXAr@At@AX?XAZ?XAr@CnAAX?X?@AX?XAXAXChB?H?NAr@C~@AbAC`AEtB?VAXCfBAZ?XAX?XAXAX?XAXAX?ZAXAVAZ?XAXAXA^AXAT?LAL?VAXAN?HAZAXAVAZAZCXAXAZAVAZAXAXCXIjBCt@Ep@GrACXAVCZAXCXAXEr@Er@CZAL?HC\\CTAXCXCVAZCVCXCXCZCXAVCXCXCXCXAFAPCXCXCXCXGr@CTC\\Gl@Iv@CXCXCXEZCTCZOtAIv@AFOzAIr@EXCXEXGd@?BCTEVCTEZEXCZETE\\CTEVCVG\\CVGZCNIl@Gd@EXEXEVEVEXEXKp@Mx@Ij@SjAEVEVQbAGb@Mp@Mp@ShAOv@i@vC?@_@jBQ|@UhAQr@Ml@Ov@GX]vAUfAADMl@On@Ol@Or@a@~AYhAWjACFU`AWfAOl@IXWdAQr@_@~AYhAETIZCJMf@a@~AOr@Ol@Qn@[pAKb@ABQx@Md@Or@GTGVQp@Ol@Qr@I\\Mf@Op@YfA?@On@Qp@I^_@zAEPQt@_@xACJWfAc@jBCJGPEPOr@GTGTi@vBOr@IVYnAq@rCe@jBK^CJe@pBc@jBm@`CCL]tA]zAYhAGXYfAGZOj@[pAg@pBe@nBu@`DENOn@u@xCMh@_@~AIXOn@On@_@|A[pAOj@_@|AYhAa@fB]tAYlAa@fBWdAOj@Op@On@On@K^Mf@YhAOp@Sr@WdAOn@GVIXGXK^Kf@GVe@zBWhAQp@Mj@Qr@Oj@Qp@YhAQl@GVGVQp@Qr@Ol@GXSv@EPOn@o@lCcAdEYjAGTGVGVGXYfAWhAGTYjA_@~AQn@y@lDg@vBUz@Kb@Or@WdAABOl@Op@GTOp@IXWbAk@~BQn@GVOl@GXGVGXI\\GTGVGT[|AYdAGXYfAGVq@nCQr@WdAc@dBOn@Op@YhAYnAGPETQr@Oj@WjAGTIXEVYfAGXGVYdAOp@IXMj@IZQp@ETQr@GRGVGXYfAYhAOr@GTGVQr@GVOl@Qt@WfAKd@K`@WfA[lAWbAGXGVYjAGVGTGVWdAK`@EPGV_@`BQn@aA~Dc@hB]xAQr@On@_@|Ak@~BGTU`AK^Op@Qp@Ol@GXOl@IZGVETQn@On@YjAMl@IXOn@Ol@YhAYnAOj@Op@i@vBq@pCi@xBWfAOn@i@zBOl@WhAIXERGVIXOn@ERYjAQn@GXGVQv@Mf@GVIZOn@GRI\\CJKd@GTGXIZGVi@zBIXGVIXCNOj@GVIZIZERGVGVGTkAzECLCJOn@IZOj@Op@YhAMl@IZKb@CJGVGXMn@GVGXEXEVMn@EVQhAWfBUdBIv@CZCPC\\CVE\\Cd@ALIjACZC\\CXAXCj@?B?DAXA\\Cp@?XAZ?LAh@?PAd@?r@?X?t@@r@?X?Z?V@X@r@@Z@t@Br@Br@DfB@X@ZBr@@Z@\\@T@Z@Z@X@XBt@BjA@\\@Z@T@v@@r@@Z?r@@r@?Z?t@?r@?r@Ar@?\\?VAZ?XAXAZ?XAZAXCt@A^APAXA\\Cn@AXC\\Er@Er@CZAXCXCVGr@Gv@Gp@It@CXMhAE^Il@E^EVKn@Gh@AHGXEXEXEXGVEXEXG\\SbAYbBUlASlASjASfAMr@UhAShAId@ALABET_@rBIb@If@Oz@[bB[dB[dBKp@GVMr@EVCLIb@o@pDCHIf@SjA[bBEX[bBKj@GXIh@Kf@Kn@G\\I^?@G\\Q`AWrAIb@Mt@Y~ASlAMp@GZETGXEXMp@EP}@hFShAUhASlAAHMn@Ox@Kn@UlAu@fEY`BGZEXMp@a@xBc@bCm@jDUjASjA}BlMIh@WrASdAe@lCIb@?DERGXCLAHGXCLAJGXEVCNIb@CNADGXET?@EXGZGVEVEXGVEXEVG\\]hBIb@AFEVEXGZETGVEVEXG\\Ml@EXADCNEPAFEXETGZGX?@EVEVGTEZETA@EZETCLCLGZCNAFGV?DETGVEVETGZCPABG\\ETGZEVGXABERERADGV?@GTGXIVAFENGVCDCLIXY~@IVKXGPABIVCDENKXKTGRCDIRGNAFKTCDGPMTEJCFKTA@KTKP?@MTADILMVA@KREHGHKTEDEHOVKPOVA@KPMRMNABMPMRMNCDMPOROPORSTKLOPORC@KNONOPQNOPQPONQNSRMLOLQNQPQLOLUPOJA@QNQLC@MJIFEBUNOJC@OJOJUNQJULIDGDSJOHA@UJOHC@SJSJQHUJcA`@QHSHOFE@QHEBODSHIDGBSHSHA?SJQFA?OHSHC?UJGBIBUJSHGBIBSHSHUJQFA@g@Rg@P?@WH?@ODSHA@IDIBWJEBIBq@XUHIDQFA@UHQFSJSHE@OFUHC@KDWJSHMFUHUJQFC@QHSHUHIDIB_@NGBk@TIDGBa@Ni@RSJSFCBOFSHSHC@OFUHEBKDSHUHUJMDC@SHIDIBi@RQHk@VSHSHSHSHQHUJSJSHWNc@RQJSLQJSLSLOJSLIF[TQLQLQNQLQNOLQNSPONQNMNQPONONQRMNYZEDQRORMNOTMNOROTMPMRMRORMRMTKRMTMPMVWf@KRKTYl@ITMVUj@ITUl@KXELGRGPWv@CHGTIVGVGVGVGVI\\GVGVETGXABCRMr@GZEVEXGj@ETAHE\\Gp@CZCVEZAXCXCXCXAZAVCXAZAXAZ?XA`@?PAX?X?@?vC@lC?nA?V?\\?ZBtI?jB@hA@~@?F?rC?hB@zB?H?hB@hB@jB?T?P?X@V?T?XBx@@f@?Z@XBr@?X@@@t@Bj@?F@X@XDdA?F@XDt@?@@X@XBV?H@PBZDp@@XBX@X?@BX@XBXBXBX@XBXDf@F`AHfAJtAJnAHlAL`BLnBLfBLfBBXDj@?HJnADp@Dv@@THrAJvBBj@Bl@Bp@FpABnABr@Bt@?TBx@BnA@t@@n@@rA@l@@~A?l@@p@?Z?tA?x@AxBAlAAj@Ad@?XAXAt@CnAEfBCbA?DEtAAZAVAZGnAGnA?TEt@MbCInAGt@AVCZInAGr@I~@I|@OhBIt@CXCVEZMjAMdAOrAIp@UfBEZIp@EVKv@Ip@EXCVOhAUhBOlAKr@Ir@Ip@Kr@Ir@QnAMfAUdBIh@Gf@CVKp@EZEVAPA@E^Kn@E^EVKr@In@?@Ih@WbBGf@ETKt@Kn@Mr@E\\Kn@Mt@Kn@?@EXCLCJQfAMv@EVCPIb@Kn@GXKn@ADER?DMp@Mp@SfAEZGVEZGVETc@|BMr@UfAc@~BOp@c@|BQ~@Kb@Mp@aBhI[~Aa@tBOr@q@jDA@EXGVUjAGVMr@UfAGXGVMp@GXMn@Mp@Op@UnACJIb@GVEVETGXGZGXMn@GXEVOp@EVEPADGZEVGXGVEVGZGTEXMn@GZA@CRGXGXETIZEXUfAGXEVGXGX[`BGVMp@GZ]bBMt@GTMn@GZGVEXGVGZGVI`@?@I`@G^Mn@GXGXEVGVEVGZGXGVEVGXEVGVGXMt@Ml@UjAMp@Or@Mn@GXEXGVGXMn@[`BUjAABIb@[zAKh@GXMn@ENAJGXWpACL[|As@nDWrAGTiA~F]bBSfAgAvFs@nDGZUfAUhAEVGXKj@YpAIb@Kh@[`BQx@m@xCe@~BSfAMl@Kj@]`BUlAUbA_@pBMn@Mj@Mn@s@pDSfAMn@SdAQz@Kj@GTk@vCq@lDa@pBSfAMj@Q~@Q~@[|AABQ~@Q|@_@lBo@~CaA~EcAlFMh@]fBOv@u@tDi@pCYxAWnAu@tDCJShAUhAENI`@i@tCOp@Kj@Ov@Or@EVGXGXEXGVUhAMp@GXETGZOp@Mr@Kf@I^GXGXMp@Mr@GVGXMp@GVEXc@zBGVGZETGXGXCNWrAGVGXEVGVGXEXGVGX[`BMn@Or@Mn@GZGVMl@Mr@Or@I^Kj@Mp@GVKh@I`@Op@Mp@Op@Mp@EVI\\ERGXEVGXGXEVGXGVCLI`@Mr@GVGVGZCPI\\GZSfAI\\Ml@Mp@Mp@Mn@UhAI\\Kl@Or@Mn@Or@Q`AIb@Mp@Op@Mn@Mr@Op@Mn@UjAETGZMr@Mn@Or@Mp@GVEVCHCNEVOp@EXGVQ`AIb@GVGXI`@CNGXMp@GVGXKl@Ml@Qx@_@rB_@hBADGVEV[~AoAtGiAtF]hBMn@Mh@G`@Op@GZQ~@a@pBGVQ~@Kh@ET]bBw@`EOt@k@nCKf@Q~@YxACLSbAWnAa@rBAJCHSdAI^WpAQ~@c@zBo@fD{@lEAB{AxHAFMl@UlAe@~BWrAADOt@Op@ALYpAEX]bBc@xBMp@WpASfAABq@hD_@jBIf@I`@GVGXMp@]bBGXId@CLGVMp@Mp@GXGXEVKd@Kb@Mr@Mp@Mn@Op@GZETOr@Mn@Mr@GVGXMp@Mp@Op@Mn@GZMn@GXEVGV?BMj@G\\GVMp@Mp@Or@Mp@GVGXc@zBADMl@EXOp@Mp@Mp@Op@UlAUhAERADMp@GXMp@Mp@GXGVEXGVMp@Op@Mr@Mp@Op@EXGVGXMp@GXGVEXGVGXEXGVMp@GXGXGVEVGXGXEVOp@Kh@I`@GVMp@GXMp@Op@Op@EXGVGXGVEXGXGVGXEVOr@GXMp@GXMp@GVMr@GXGVEXOp@Mp@Mp@Or@EVGXGVGXEXGVMp@Mp@GXiBvJKh@w@xDo@zCMp@_@`BMp@WjAGVOn@[xAYlAKd@a@dBK^_AzDeAhESx@q@rCI^wBxICJs@rCa@`BAFi@tBGX]tACLQr@ETk@~BI^gApEWhAk@`COl@K`@e@nB{@nDMd@Qx@_AxDMf@GXIZERCHCNIVWfACLCJGVGVIZGRETKb@GRENKb@CJI^On@Ol@I^GVGZGVGTGZGVMh@AFWjAGXOr@EVGVGZGVI\\ETGVGZSdAQt@Mn@Mp@Op@Mr@Q~@Q|@Ml@Kl@Ib@GXY`BMl@G`@Mn@ETEXGZKr@Mp@Mt@Kl@Ih@Id@EXG\\Kl@Ij@G`@Mt@Il@EZYhBKp@ANAHWfBOhAQpAQlAIn@Il@K|@Kr@Ir@Il@Gb@Gl@Ip@ABEb@Gb@E\\CVE^CVSfBM`AE`@CZSfBC\\Eb@Gh@CXIt@Gl@ADCZGt@KfAABATIt@?BE\\IjACRC^KbACd@CXKfAS`CEd@C`@Gn@C\\?@OhBGp@?FEh@E\\CXAXCXKhAC\\C\\KhAATADCXGt@En@?DADC^AHGr@]jEG|@]hEADIhAKlAGt@IjAKjAKhACb@MxAW`D?HGv@Gr@KlAKnAIjAKlAOhBCZCVCZCZGp@?FEh@Gp@E^Q|BCZGr@Gt@C\\Q~BCXKlAGt@CZEp@W|CIdAGl@G~@Gt@Gp@C\\Gr@CTEp@Ed@ABw@`KAVCXEb@Ej@Eh@KhACVCb@AHCVAXCZCVCPCb@CXCXCZCXCVAFEh@C\\ALAJATE\\CVCZCXAXCVCV?DGr@CXCXCZCXCXCXEr@CXAHAPCVCZCXE`@APCXCXCZCXCVAVCXC\\Gl@C^Ef@AJCXCXCXCZCVAXABAPC^Gr@CVCZCXGp@CZC^CVCXAVEZAZCTCXCXGt@Gr@CXC`@ANE\\AVGt@CXCXCXCVCXCZCVCZCZAXCXCXCXCXCXARAFCXCXCZCXEn@CXCXC\\CTCXCZC\\CXCVEp@EZAVC\\CXCTC^CVAVCZCT?DAVCVCZEv@ATC\\AXAZATCZAXAXAXAXAZAZAVAXAZAVAZAZ?VATA`@?XAZ?J?HAZ?VA^?XAp@?XAX?P?H?Z?r@AZ?V?X?\\?RAlA?hA?LCrDAlAC|@ClACtAAh@C`AGzAC^AXEv@Cn@AJ?NGfAAHGjAEf@Ej@Eh@El@AJC\\OdBQpBUvBMjACLQxAKx@Ip@i@dEg@tDIj@CTQrAQrAM~@Kt@CLIt@Gd@QjAE`@Ih@Il@CVCNEZAJId@K|@AFQrAALGZKx@MdASzAOdAE\\CTCRG`@QtASxAEZCVG\\ALGb@Kt@Ip@EZEVEXEXIp@EXEXCXEXKr@EVIt@EVMbA_@jCE\\WtBYvBGb@w@bG]hCAPETEZEXCXAFCNEXEXEXCZET?@EXEVCXEZETEXIp@EZEVE\\CV?@EVEXCVEXKr@EZCVEXEV?@EXIr@EXEXEVCZEXEXEVEXCXEZEVEXCXEXEVEZCVEXCNAHAFCNEXCZEXEXEXCVCPGb@EVEXCZEXEXEVIp@EZEXEXCXKn@EZEZIn@E\\EXCXEVEXCTG\\CVEXCVEXEZIn@Kt@EVEZCTEZE\\EVCTEZEZEVCVEXEXIt@EVEXCXEVEZCZETCXEZEXCVEXGp@EZEVIt@CZIn@CZIp@Ir@Gp@EZIv@Gp@CXA@CXCTGt@Ir@CXKlACVC\\U|BC\\CXCZCVCVCZKtACVCTEl@KlACZG~@Ef@KrAGbAANARCZCXAXE^ALA\\C`@CXObCEn@A\\En@CZAXAVC\\Ex@ANEt@GhA?FAPGx@QzDSxDGpACb@ANM`CAPANAVI|ACb@C\\WdF?H?FADCr@QjDGhAAPEv@KjBEt@[dGIbBKnBc@zIAPCXCr@Er@C^Cr@C\\Cn@CZAVCZAZCn@Ep@?BC^AXEp@Er@AXAVCZAVCZCr@CZAXAXA?AX?JALAVC^AXCXAZEr@Et@AXCXGnAAXEp@C\\AZCVARA`@Er@AZCVAZCVAZEr@A\\CXAXAR?DCXAXAXCZAVEr@AXCXAXCZAXAXCXAZAXCXAZCXCp@Et@Et@Er@Ex@AVEp@A^ALAJ?PEv@CVAXKhBGlAGnAIhBInAEbAKfBI|AARAVC`@GfAi@hKCb@Cr@MdCCf@ItAEbAAJ?FKdBO`DQjDMzBIvACh@InACVCZEr@QdCEr@En@CZGn@CZ?DCVGr@AVGt@EZEp@CVE^Gr@KjAGv@Gr@CVGr@Gn@?HGl@]zDM`B[tDCXCZC\\[pDGp@Gp@C\\Gt@EZIlAQfBEn@MrAGt@CXCVGx@Gl@Ep@ADCVARWpCM|AGr@CXEf@Ed@CZCZCVKlAEd@K`AKlACZCXCVKnACXOfBGt@CVCZCZIt@CXAZIp@KrAOjBStCGt@Er@AVC`@Ev@AZ?@?NATA\\C|@Aj@AbAA\\?`@?dA?z@@V?@?X@P?f@@f@?F@X@X?X@X?@@F?PBX@Z@V@Z@R?BBX?B@VBZBXBZBX@TBV?DBTBXBZ@RD`@BXDn@Dl@@H@VBRBZ@XBXBXBXBZ@N@FNlB@RBZ@D@PB\\@LDh@BTBZDp@BXBZ@J@NFt@BVB\\@VBZBVFr@BZBZ@VBZD\\Dp@BRB^BZBVFdABT@TF|@B^@Z@R@\\BZ@Z?T@Z@\\@R?Z@X?^@p@?V?N?J?V?Z?Z?X?XA\\?N?D?ZA\\?VAXAZAZAXAVA\\AVAXAVAZC\\ATAXAZC\\ATA\\AXCXAZAZATAZCXAXAPA`@CZAVAZAVCZAZAVAZCXAXAXAZCXAXAZAVCZAXAXAZEt@?FQrDAVARCj@Ct@C^GvAGlACr@E~@AVI~AAb@KzB?DAVE~@EbAATOzC?NIvAAVCb@?FCj@Cr@MhC?BK`CAP?DCj@E~@Cd@KfCCb@M|CEbAKnBCv@AFQbEQbEQxDYpGWtGO~C]bISzECj@AR]bIGjAAXAZCXAXAXAXCXAZCr@CZAXAVAXCZAV?BEt@AXEp@Cp@A^CXCr@AZWxFCj@ARAZCXA\\Cn@CZAXAXAXAXCXAZAXAZAXCXAZCp@CZAV?@AXAZCXA\\Cn@CZAXAXAXC\\AVAXGlACZC\\GlAAXCTEr@Et@CZAXGt@CXAXCZCVCXAVC\\CXCXC\\CTCXCZC\\ARGt@ADARCXGv@CXGp@OfBMhA?DKlACXE\\UzBOnAIr@MlAQnACTEXEXCVERE^OlAQjAEXE\\Kl@EZKn@YhBAHCL_@~BEXMt@SnAETETEZCFCNEXKj@G\\EVGXGZERG\\ETGVMp@EVGZMn@GZGXGTGZMn@ENAHETIXGXGXGXETOr@GTGXGZGRGZGTGVGXIZGXEPGTK`@EVGTIXGVIXETIXGVGTIZGTGVGVIXGTIXIVGXGTGTIXGTIZGTKZGTGTMd@Qr@CJQl@GTIZGTIXGVIVGXGRIZGTIZGTGVIXGVGTIZIZOj@GXGTIVGTIXGXIVGTGVGTABGTGTIXK`@a@zAGPGZIVGVENCHGVCDEPGTQn@AFUz@IVCJGVIVGXITGVGVIXOl@ELCHIXGXEN?@KZGXQn@IVOn@IXQl@K\\GVIVIXGTIXGVGVGVIXIX?@GTI\\YbAGVWbAI\\Qn@GRCDMf@ITU~@YbAOj@s@jCaAtDK\\Mh@GRABIZGVIZGRIZGRABGTGVABGTENAHIVGXIVGTCLK`@IXGVIVGVGTIVGXIXQl@IZYdAQn@GXIVI\\GTGTIVIXc@bBGVIVGTGVABGTGVIZGTIXGR?BA@GVGTIXGVIXGVIVGXIVGTGVIXGVIVGVQn@Sr@Qr@Ql@Qp@GTGVIXQn@Sr@Ol@K\\k@xBIZGTIXGVGTIVm@~BIVGVGVIXGTGVIXIVGVIVI\\GTIXGVIVIXGTGXGTK\\ERITI\\Qn@YhAIVGTGVIXGVIVI\\IVGVGVITGXIXGVIVGVIVGVGVIVGVABGRGVADGVIVGVIVGVIVGVIXGXIVGVGTIZGTIXIXGRIZGVGVIVGTI\\IVGR?BGTQl@_@rA_C|Ik@vBMf@]nAk@vB{ExQMh@yIl\\uEfQENg@hBQt@c@|Ac@dBYbAU~@Ux@St@WbASp@On@Qp@Qp@Qn@Qp@Qn@Qn@Qp@Qn@Qp@K\\Oj@GVIVIXOn@Qn@Qp@[hAQp@GTIZQn@K^Mf@KZIZGTGVIXGVGTIXIXGVGTIZIVGTGTIZGVIVIXGVIXGTGVIXIVGVIVGXGRIXGVIXGXIVIZIVGVGVIVIXGVGVIVGTGXIXIVGTa@~AM`@?@EPIVGTGXIVGVIVGXGTIVIXGVIXGXGTIXIXGVIVGTGVKZGVIXGTGVIVGXIVGVGVIXGTIXGVIVGVIXGVIXIVGVGVIXIVGVGVIVIXERABGTCHELIXGVGVIXIVGVGVIVIZGVGTIXGVIVGXITGXIXIXGTGVIVGVGVIXIVGXITETABIVGXIVGVIXGVGVIVIVGVIXGVIVGTGVIZGVIVGVIVGVADGRGRADGTGVIXGVITGXQp@IVGVK^ENIXw@rCGVIVGVIXGVIVGV?@GVGVIXGTIXGTIZGVIVGTIZGVGRGVCFEPIZGRGVIZGTIVIZGRGXIXIXGVGTIVGTIZGP?@IZIXGTIZGTIXGVIVGXGRI\\ITGVIXGVGVIXQl@Qr@K^o@~BQt@IVe@dBENU|@GTIZGRI\\GPGXIVKb@Oh@GTGVSp@Qp@IZe@fBEL?BIVOl@GVCHENGVGXIVKh@I\\Ov@Or@EX?BEPADCREZETCRAJCREXCZE\\AREZCVAZCXCXAZC\\A\\Cl@A\\AXAXAd@?d@Ar@?b@@r@?J?J?X@X@ZBz@?F@b@@XBZ@XBXBd@HdADXB^BRDZDZBXDV?BDRDXDXDVFZDVFZFVDTFXFVFVFZHVDTHXFVHXHVHVFVHXFRHZFTBHFPFVHVHXFVFRHVHXFTHZHVFTDLLd@ZhARp@Tv@Pr@f@dBRp@Pn@FRHXb@~AZhAZfAPp@XhA^bBLp@Lr@Jp@Jt@DVHt@LjAJnAFnAFlAFjB@dC?nACnAEpAEnAInACZKjAIt@Ir@EXEXEXEVEZMr@EVGTCNCNOl@Qr@Mh@Sv@Qn@_@pAa@tA]hAMf@CF[dAo@vBe@~Ae@~Aa@rAMf@A?c@|A[dAy@rC[fA[dAQn@Sp@Qh@K^CFMf@]hAe@~ASl@e@`B[fASn@Qn@[hA_@lAEPIT]hAc@~ASp@]fAW~@M^AFOf@Sn@[hA{@xCA?g@hB]fAu@jCABSn@Qn@Sp@[fASn@[fAe@`By@nCAHY|@y@pCYdAABQj@Sp@YbAABQn@w@jCAD[bAw@nCcAfDiA~Dy@nCMb@Md@e@|Ae@~A[fASn@GXSn@Ql@IVSn@Qp@Sn@Qn@Sn@Ql@Sp@Qn@IVSp@e@~AIVQp@Sl@Qn@Sn@m@vB[fAKZABOf@IXGVe@~Ae@~A}@zCWz@aAfDSp@iA~D]fAGVSn@[hAe@|Ae@~Ae@`BQh@Sr@o@vB[fAo@xB[fAe@~ASn@Oj@]jAg@`BIXGTELUx@Y~@AFIXo@vBw@nCo@vBcAhDw@nCSp@K\\Oh@cAhD[fAw@pCo@vBiBhGaAfDe@~Ag@~Ae@~AQp@e@|ASp@Qn@y@pC[fA[fAe@`BSl@[hAM`@W|@]hAe@~A[fAo@xBe@~A[fASr@GRIXIVIXITQp@GRIVIVIZGRIVIXIVGTIXIVIVIVGVIVIXIVIVGVIVIXGRIVIXIXCFGRGRK^Od@IXSp@GTIVGVIVIVCJEJGTABGVIVGTIXIVIVIVGTIVIXIVGVIXIXGRKZIVGRIVIXIXIVGTGTADGRIXQj@IXIVIVGVIVIVIXIVIXGVITIVGVIVIVIVGVIXIXITIXGRIXIVGTIXITIXGVIVIVIVIXGT?@KXGVIVGTIVGTIXIVIXQl@IVIX?@ITIVIVGRIXIVGVKZGRIVIXGVIXIVITGTKXIXGRIXIXITIXGTIVIXITITSt@ITIVIXITIVIVGVIVIVITIXIXIRSr@GPKZIVIVGTIXITIXKXEPKZGRKXIVIXIVIVGTIVGTKXGRIVIVGRIVGTITIXITGTITGVITITGVITIVGTIVIVITIXIVUt@IRSp@IVIXKXIXSn@KXGVKZIVIVKZGVIVIXITIXKXGVITIXIVIVITIVGTIXIVIXIVSj@IXGTKVGVKXGTIVIVITIXIVIVENGPMd@EJENGRIVITIXGTITIXIVIXITIVITK\\GRIVIVIVIVIVGTIVIXITIVGTKZIVIXCHCHIVIXITIVIXGTKXITIXGTITIXKXGVIVKVGTIVIXIVIVIVENA?IZKZITGVGNK^IVITIXGTIVIVITENIXIVK\\c@tAIZITA@IXIXIXGNIZKVK\\IXKXSp@IZITIZIVIXITKZGTIVA@IVIXIVIZIVITIZGTK^GVIT?@IXGVGZIXGVGZGZOr@AHCLI^EVEVG\\EVEXGZEXEVEZCVEZEXCVE\\EZKfACXEZC\\CTCZARC\\CXAZAXCZAXAZCXAXAZAZAX?XAZAZ?XAV?ZAZ?X?T?\\?X?Z?R?D?Z@X?Z@X?V@^?V@Z@X@\\@V@X@F?PBX@Z@VBZ?B@TBZBX@XBVBZBZ@VBZDZB^TvCNhBH`ADh@Db@BZBTB\\DZBV@LDd@BTB\\BXD^BZBPLnA?HHp@Fl@B\\BTB\\BV@XB\\@Z@VBZ@V@Z@\\?T@Z@X?X@X?Z?Z@Z?V?Z?X?X?X?Z?ZAX?Z?VAZ?\\?VAX?Z?XAX?ZAV?X?ZAV?Z?ZAX?ZAX?V?\\AX?Z?XAX?Z?XA\\?RA`@?V?VAZ?XAZ?V?XA\\?ZAV?XAX?\\?XAX?X?XA\\?VAZ?V?XAZ?Z?ZAX?ZAX?X?VA\\?V?XAZ?X?ZAZ?XAX?Z?VA\\At@?VA\\?p@A\\?V?\\AX?XAX?JAh@?X?XA\\?VAX?\\?VA\\?T?\\AV?X?ZAX?ZAX?Z?VAX?Z?ZAV?ZAX?V?ZAZ?X?XAZ?ZAV?Z?XAX?ZAV?Z?ZAXAr@?ZAj@?b@A\\?TAx@?XAX?ZAX?X?XAX?Z?XA\\?T?ZAX?XAZ?Z?VA\\?T?XAV?^AR?Z?VA\\?XAZ?\\AX?X?XAZ?V?^AT?`@AX?^?VAV?`@?VAX?^AV?ZAV?\\?VA\\?TA\\?Z?XA^?Z?TA\\AdA?V?NAN?P?P?PAL?P?P?NAP?N?P?NAP?P?JEzDCbD?NA\\?V?\\AZ?VA\\?VAX?^?D?PAZ?\\AV?^?XAZ?\\?VAX?ZA\\?V?\\AZ?XA\\?T?\\AV?\\A\\?XAZ?XAZ?\\AV?Z?VAZ?ZAZ?XAZAZ?XAV?XAZA\\?ZAV?X?ZAX?XAnA?Z?\\?VAZ?X?nA?r@AX?Z?X?Z?V@Z?Z@Z?X@X@Z@V@X@XBZ?J@RBZBT@TB\\BVBVBXDZBVDZBX@L@HD\\BVDXBXDVBZDZBVDXBXBZDZBVBX?HBPBX@VBZBX@P?HBX?D@RBZ@X@X@X@X@X@Z@X@^@V?X@Z?T?@?X@Z?X?^?V?Z?X?X?Z?FAl@AZAp@Ar@?BAXCr@Ad@Ez@Ep@?HGz@Cb@I|@Gr@KlAEVIv@Eb@Gj@EVCZE\\Gl@EVCZE\\Il@CZEXMjAALShBUjBEb@K`ACNAHCRGn@CREXCXEXCZEVCXEVCXIl@?FEXCRE`@CVEXCXEXCXCRABCXAJCNCVEZAPAFCXAFCPCVIj@Ed@EXCXEVCXEXCXEXCXEXCZEVCXCXEXCXEXCXEXCXEXCZEVCXEXCXEXCXEZCXEXCVEXCZEVCXEXCVEZCXEXCZEVCZCXEVCZEVCZEXCVEZCVCVEZALAHG`@ANEZCXEZCVE\\CVEVE\\CTCVEZEZCVEXCXEZCVEXCZEZCTCXEZEXCVCZEXCVEXCXE\\?@CXEXCXMlACVCZEXCZCXCXCZGr@CXCXCXAXCZCXAXCV?@CXAXCXAXAXCXAZAVCXAZIjBCr@AVCZAXAZAXCXAZAXCXAXAZAXAXAVCXAZAXAXCVA\\?HANAZCXATAZAXAXCXAZCXAZCVAXCXAZCXCXAXCXCZCXCXCXCZAXCXCXEZCZCVCXCXEVCZEXCZKx@CXEXEXCXEXEXCVEZEXEXCPG`@EXAFKt@U|AE\\ERKr@Kr@EXEXEXEVEXEZEVEZEVCPAFEXEZEXGXEXEXEZETEXEXEVEZEXEXEXEXEXEZEXEVCNAJEVEXEXEVEZEVEXEXEZEVEXEXEXEXG\\QhAEXOlAEVMt@EXEXEXGd@O`AYjBKr@Kr@QlAKr@ETE\\CPYnBEVGZIn@G\\Gf@UzAABa@vCKp@CP_@dC?@WdBUxAYrBWdBQhACNYpBQjAEXSpACTQnASlAQlAE^QhAQjAQpAMr@Ip@QjAMv@QnAQjAWfBCR_@bCMz@In@M|@M~@Kr@QlAQpAUbBKt@EZEZUdBUfBSzAGh@CJ[hCa@|C_@tCQvAIl@?@Gh@Kr@Ir@EXEZIp@G\\Ip@Ip@E\\]fCEXOnAKt@OnAQnAEXCNE`@EXKr@ANGd@EXIl@CPIt@G^EXEXE^CREXEZAJQvAEXEZEXCVIp@CLALG`@CRQ|AGb@EZCVEXCXEVIv@CXCXK|@Eh@CREh@E\\Eh@CXGt@Gr@CXKbBKvAEl@Ev@CZIvAI~AA`@?@AD?LCZEpACt@Cr@AZAZAXAXAZAZAXAv@Ar@AXAZ?ZAXAr@?ZAt@?XAv@?jBAt@?r@?X?v@@tB@lBAj@@R?`@@Z@pA@r@Br@@X@^@r@DfA?RBh@Bh@DtAFnAD`ADdADv@BZDp@Bj@Fz@HrADr@BTBd@PrBF|@H`ALrA@FB\\Hz@Db@Fn@BRFl@DVBRJj@D\\PtA?@DVBN^pC@JZrB@HJp@Lp@@N@FFXHh@Nv@X`B@BRfAHb@d@bCd@vBZ~AT~@FVR|@H\\Nl@T~@DNFTXdADNJ`@Pp@Pl@\\hAFTRr@HVHTFPJ`@Rj@^lA`@jAPf@FT^dAr@pBL\\JT^bA`@dAJVVn@HRBHRd@BFFL`@dAJRb@dALVHRN\\FNVj@dAxB`BbDlA`C|@|ADHNXJRJRZf@rAxB?@V`@DHbBlC\\f@Zf@V^V`@x@jAz@nA\\d@Zd@^j@\\h@tBxC@@`ClDBBNRDDtArBLNl@|@X^j@|@~A|B`AtAj@x@r@dAhA~ApC`EX^vAtB`@j@n@~@~@rAHLn@~@BBl@z@LRZb@fBhCfA~A`B~BV^V^hA~AfA~AbE`GV^@@n@~@X`@bGtIhA`Bz@pAX`@fA|AbAxALNXb@HJrAlB\\h@l@~@\\j@f@v@b@t@l@bAl@`Ax@|Ah@bAh@`Af@dAx@bBd@`AVj@|@tBd@dAJX@@N`@BPHRRh@P`@`@dAXr@p@|Ax@vB`@dAb@dAZv@Pb@l@xAl@vAn@|ATn@z@xBRd@Pb@Rb@d@dAx@fB^t@^r@DJf@~@HLTb@DDPZ\\l@f@t@Xb@Xd@p@`AxApBBBfAvA`@b@TZXZp@r@f@h@HHRR~@~@dA`At@p@d@`@r@j@RNDD^Vd@^NJhAx@d@Xv@h@x@j@v@h@v@l@b@\\RLPN`@\\l@f@j@h@`@^\\Zb@d@RRJJt@z@d@h@r@z@X\\t@`ADHNR^h@LPNTJL^j@@BPXJPd@t@FLT^LXNXLTJRLTN\\BBRb@Vh@JVJTVl@Xr@HTTj@Tn@JXRj@HTL`@L^Tv@L`@J\\BHDRRx@VdAT~@F\\Px@F^Nt@PfAHf@Jl@L~@Hj@LfAFj@",
                      },
                    "start_location":
                      { "lat": 35.0978089, "lng": -106.7231231 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "191 mi", "value": 307547 },
                    "duration": { "text": "2 hours 43 mins", "value": 9757 },
                    "end_location": { "lat": 34.7245921, "lng": -114.4155694 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-40 W</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "}otuEjenhT@RFl@Fj@B^BTDf@Dr@Dr@Bl@Bb@Bt@D~@@t@@h@@p@@p@?j@@h@?t@At@?b@Av@An@Cz@Cv@Cv@GpAEv@El@C`@El@Iv@KjAC\\E\\EZCZIj@OfASrAMv@O|@ERMp@S~@On@Ml@_@zAQr@Sp@Sl@Mf@Q^Ob@Yx@KXSh@ABy@zB]~@q@jBc@lAYt@Y`AQb@Qf@Yv@[x@Sh@_@fAc@jAUn@M\\CHo@dBITUn@_@fAY|@_@jAQj@Mb@Qj@Mb@Of@Ol@[hAOf@I\\Qp@Ol@[pAWhAYrAA?If@GTI\\Kh@G^Kh@Kf@WrAIh@Y`BGZIh@Ih@Ih@Kr@Kt@CTEZCLGb@EZ_@tCQrAGj@Gh@Il@OhAQrAOtAQrA]nCKn@SfBKz@QtAWpBIh@CLShBg@tDUfBOjAUjBCXGb@M~@K~@Ih@SbBCLKv@QtAKx@S`B_@rCQvAGj@YxBe@rDIj@E^Ij@OjAQzAKz@Il@Ih@K~@MbAG^K~@CPIl@E\\G^Gj@Kr@Gf@SpAWbBW`BG\\CJMp@EXOr@Mr@ETGVGZIb@S|@?BOl@EXIZGZGX?@CJUbAKf@Op@ADEPGXGVGXGXAHELEXGVGXGXIXEVGVGVGXMp@IZGVGXEVGVGVCLCLI\\EVMf@ABGZOr@On@Mn@GVGZCLCHOp@GVEXGXGVGXELKf@Mn@Qt@EVGX_@`BGZI\\U`A[~AOl@AJMf@[vA]~AMl@y@xDGZKb@ERCJI^I^I`@Kh@Kb@Ot@I\\I`@Kb@ETEPS|@EXSx@GVMp@Qt@Mj@e@xBIZKd@c@rBo@zCI^Op@Qt@o@`D]`B_@hBUdAYpAI\\Sz@Kh@Or@I\\e@vBCJOt@UdACHETGVS`AMh@CPa@jBMl@U`AAFUdACJUfAS`ACLYpAEROn@i@hCMj@Qx@GX_@dBIb@K`@YrAGTCJM`@IZKZGRKXO`@Qf@_@|@a@z@KTINQZINg@x@KRCBm@bAMPMRILCFMRQVMRKRKPMTMRMVMPKRMVKTINEHKREHOZSb@c@dAMZKTCH[v@ENM\\M`@Ur@Of@KZMd@CHOl@Md@?@Qt@Kh@Kf@ABCPQz@Kl@Mv@Kx@YzBIz@Eh@Gt@CZCXCn@ANAPCXAZEp@A^ARALAZMzCGfACt@GfAEjAC\\Cb@AVEl@Cb@GfAC\\AJAJIv@KfACXGj@Gb@Gh@AFGb@If@Gf@GZIj@UlAMn@Kh@Ov@ENGXOl@UbAI^e@zBYpAg@tBwAtGa@fBSz@mAtFK^Qx@}@`Eo@pCc@tBMh@Oh@Qr@Md@Mb@GXGPUr@KVIVIRKXWl@Wn@Sb@Ub@S`@Wf@OT[h@[d@U`@UXOTm@v@aAfAON_@b@c@`@QPSN]Zk@b@]VQNc@Zi@ZMHe@Xk@Zi@Vw@`@_Af@_@Rg@XUJ_Af@w@b@w@d@QJSLOJQNUPa@Z_@\\UPSTWVUTWX]^[`@k@x@W^OV[h@Wd@Yj@Yn@[t@Qd@Qd@IXKVOh@M`@GROl@]tAGVWdAWhA_AdEWfAUbAc@pBQr@U`A]zAc@jBMh@Mj@YjA[hA[hAOb@Md@Yz@Qd@KVGNM\\Ob@MXa@bAO\\IPGPMXWf@OZMVKTKRMRKROXMRWf@]j@]h@KPOTABe@r@QVSX[`@MPOR_@f@Y`@_@d@]b@a@h@MPQVk@t@]d@ORiA~A[f@gA`B[b@s@hAo@dAi@|@i@z@mBlDs@pA{@|AS^Q\\KRYj@Q^Q^Q\\MVYl@o@tAMZSb@Yn@Uh@]v@Uj@M\\IPSd@Yv@Q`@_@`Aa@hA[v@Yv@o@dBsArDu@nBg@pAKZIVSd@Yv@i@vAs@lBUp@MXc@jA[z@}@`CQf@a@fAq@fBi@xAu@pBk@|AYt@KXO`@Ul@O`@Yv@oAfD]~@_BhESh@c@jAM\\e@pAuArDoEtL_AfCITEJITq@fBM\\ADCHCDAD[z@Wp@g@rAITITQb@ITIRKZQ`@o@hBQd@o@bBITUn@[v@qAnDYt@CHITc@hA_@dA_@~@mAdDUl@Un@y@zB}@`Ca@dA[|@MZMZ_@fAc@hAQd@M^GLITKTAFa@dAGPM^Uj@ELSf@CHSh@Qd@[x@Ul@e@pA[z@k@|As@lBe@lAM^Yv@[z@EJCDOb@KXSh@IRKVKZ_@bAm@~AWp@_@`A_BlEi@xAWr@i@tAWr@k@xAi@zAw@vBSl@ITGPITaAvCSn@ITSp@Qh@GVW|@Ob@GTYdAIXk@tBSt@On@Sz@Mf@a@dBOp@Kd@U`A_@dBQ`AYxAc@`CKh@Kf@G\\Kr@CNMv@QjASnAObAAHG`@CTIl@UbBKx@Kt@CTMlAOtAE`@Eb@KfAGr@MpAARCTGl@IdAKvAInACb@Et@Gx@AL?NEt@C\\Cp@AVC^Cp@AVAZCXAXCv@AV?XAZAZAD?VEjA?XAD?VAX?XAD?TAZ?VAX?X?DAT?D?`@?DAD?D?T?ZAX?X?V?D?T?F?RAX?Z?Z?V?Z?D?P?B?V?Z?p@@l@?d@?r@@Z?D?T@r@?\\@l@?HBlA@p@@r@@F@l@@r@DpA@R@^?JBh@@X@X@Z@XBZ@Z@VBX@Z@XBXDv@Bp@BZDr@?BDj@@HB`@Bh@D^Dl@B\\LdBBXBXD\\BV@T@BBZBVBXDXBXBXJ`A@LBN@FBXDZB\\Ff@@JHn@?FBRDXBXDXHn@D^BVBXDX@LBLBXBVDXBZDXBXDVBXDZBVDZDZBVBXDXBXDXBXDZBVDXBXDZ?BFl@Ht@DXBXBXBXBXBZBX?H@N@D@R?FBR?D@P?@@D@R?D@T?D@T?@@@@T?B@T?D@T?B@L?D?F@R?D@V?V@D?R?D@R?D?T?D?J@H?B?T?B?V?B?T?D@P?F?T?BAT?D?R?D?V?@?T?D?VA@?T?@?BAX?X?@AT?ZAV?DAR?DAV?BATA\\AVABAVAZAVCZAVABAVCVCZAXCZCVCPAJCXCXCXEXCXEXCXEXCRADCTABEX?@EVCVGXCPAFEVEXGVETG\\EVOr@GVGVERADGVCNCFGXGVGRADEPADGVABGRGRABGT?BGPADIVIVIVIVITKXITIVEHAFCDIVKVGNADCHGLGPABKTKXABGPKTKVGPADKTIVIRABKTKVITKTKVGRADKRGPABKVIVSf@ABA@IVINADGPADGNCFGPABIVGPABKXGTITCLGNMb@K^Mb@I\\K^I\\Mb@?@Mf@Kf@On@Ot@Ib@Id@Id@Id@Kn@In@Kp@Gh@Ij@Gr@EVGt@Gp@Gl@Eh@?BEh@Ep@AXATAZCXAd@Cf@A`@AXA`@A\\A\\Ad@?`@ExBCvAEzACx@Ap@Cf@A\\I~AC`@Ev@CXALCd@AJCVEj@Gp@Gt@Eb@Eb@ANCPE\\E`@Ij@K~@Kv@Mt@ObAQfAG^Kp@W~AUxAe@tC_@bCWxAO`AUxAIj@GZKn@Ih@CHk@rDERO~@]vBOdAABKn@a@lC{@nFWxAO`AM|@Kr@QdAQlAMbAGb@Ip@Gj@Eb@Gl@Gv@Gp@El@Gt@Er@Er@AJAj@ADAb@Cj@CrAAx@A\\?f@AbA?l@?l@?f@?d@@h@?@@p@BlA@r@Bh@Bf@?@Bj@Bt@Fx@Bj@BZB`@BVJlANtALhAJx@Hp@F\\Jr@T`BRlARzAJn@Lr@Hn@Lt@VdBV~ABPFb@Lr@Hl@F\\Fd@PfA^bCV~AJt@DX^bC`@jCb@tCXhBN|@Hh@RrALv@Fb@BRPjALx@VfBTjBDZDXJt@Hn@@LVpBJx@NdAL`AHp@Lz@Fd@DXL~@?@FZLz@N`ANbAJx@Hb@TzAL~@RjADXJn@^dC|@bGb@lC\\`CTtARtATzATxA@BNdAXhBr@tE`@lC\\|BZlBPjA@JLv@RpAJn@Jr@@BNhAN~@PhAJj@Hf@@HPfARtATzAL|@Jr@NrAHl@Fl@Fh@Hr@Db@@JDf@Fp@H|@Fn@Fl@?@Dp@HdAJfBF~@H|A@HBd@Bn@Bf@DbABhAD|@@`@?\\DpA?P@j@@^BbB@|@@jA?`A?~@?fA?`AAr@?r@AX?z@Cx@A~@Ad@CbAClAEtAGpAElAGlAIrAEv@Ex@Gz@QvBALMdBKjAQ`BEb@CTK`AGf@CTM~@ABKz@CTIf@?@Ih@?BGf@O~@CLEZId@ABCVGZG`@EPKp@Ml@AHKf@Kj@CNGXIb@Ml@ENS~@Mj@AFOn@Qt@Qv@Oj@Ol@Uz@AFQn@WhAYdACHc@hBUv@GXe@hBI\\Sr@[nAI\\Mf@Mf@WbASt@EPWdAOh@Op@Sz@S~@Qv@Ib@CJGZI\\If@S~@UrAQ`AMx@Mv@Mv@Mt@Mx@E\\WbBSrAW|AE\\Kr@Ib@Gf@Kp@SnAO`ACLM~@Kl@OdASpA]vBG`@Ih@CNIl@SpAG^CPIh@Gb@Kp@Mt@QjAIh@Mv@Kv@Kj@ALIh@ABKr@EZG^Mr@EXWdBEZMv@Ih@Gb@AD]~BCLYjB?Bi@jD]zB?DSlAG`@Mx@QhAIl@AD[tBUvAAHG^Kp@OdAADOfAO`AW~AStAU|AAHQdAMv@?DKr@SpAM|@UrAObAQhAQhAQhAOdASvACPEVKh@ANGXOdACNO`A?@StAABOdAMr@WjBCHQnAKl@Ij@WbBG`@Kr@QfAObAEXUzAIh@EZEVKr@EREXER?DUxAUzAMx@O~@WhBo@hEWzASzAUvA[rBStAKp@QjAO`AMx@Kt@Kp@Mv@Mx@OdAQdAKr@Mz@Mx@Kr@QdAGd@ObAId@UxAOfAEXQlAETQhAKt@Mx@M`AE\\CLGh@CVCNE^EXMlAIt@Gr@Gr@ANEb@Gt@Ef@AJIhA?BEr@InACZEt@Er@Cr@AV?BAX?@Cr@Cr@AX?ZAXCr@Ar@Ar@Ar@Ap@At@?x@?p@?jA@|@@h@?j@@t@?Z@n@@\\@Z?XBt@@r@Bt@Br@Bt@?@Dp@Bp@Dr@Br@Dr@Ft@Dr@Ft@Fp@Ft@Fr@Ft@Fr@DZFd@Dd@D`@BPDXBXDVDZBVDXDXDZJp@BXFXPlALp@Jr@Lp@Lp@Lr@FVDVNp@FXBLJb@FXNp@Nn@Nr@Pn@FVFXDJBJPp@FVHVFVHVHVPp@Rn@Rn@Rn@@@Pj@Rn@Tl@Rn@Tl@HVHVTn@Tl@Xx@L`@JXJXHTFRJXJVHTRn@Rj@JX^dARn@Tl@HVJVHVHTRn@HVHVHVFT@@HXFRFXFRJZPr@DRXlANr@DVNp@Lp@DZFXDVDXDXJr@DX?BDTBXDXDVFr@Ht@BZHp@@ZBXBXBXBZ@XBX@Z@XBV@Z@Z@X@X@Z@X?Z@X?Z@X?H?N@Z?X?X?Z?X?X?Z?XAt@?XAZ?XAZ?XAZAV?ZA\\Ap@Ar@Cv@Ar@At@Ct@At@Ar@Ar@Av@Cr@At@Ar@Av@Cr@At@?XAXAZ?ZAXAX?ZAX?XChAA`@?XAXAZ?XAZ?XAZAX?XAXAt@At@Ar@AZAj@Ab@Ar@At@Cr@?d@AN?XClA?`A?x@?r@@nA?\\?x@?jA?B@bB@xB?|A?\\?x@@vA?jA@zA?F?nA?r@@z@?pA?@@jA?lB@jB?v@?lA?@@tA?hA?lA@n@?xC@|@?vA?lA@nA?lB@~B@rA?nA?v@@dA?rA?fA@d@?rA?dB@lB@bB?D?tA?|@@`B?`@?hA@fB?z@?l@@dA?lA?f@@dA?~@?V?^?J@f@?pA?lA@v@?nA?t@@nA?t@?nA?Z@lA?pA@nA?nA@rA?lA@hB?t@?t@?t@?t@@t@?t@?r@@t@?Z?X?X?t@?F@l@?`A?Z?p@@bA?r@?x@@nA?r@?t@?dA@|@?t@?b@?P@t@?Z?X?v@?p@?t@@Z?V?j@?~@@t@?r@?l@?F?t@@t@?t@?X?t@?X@X?Z?X?X?Z?X?Z?X@X?Z?X?Z?X?X?Z?X@X?X?Z?X?Z?X@Z?X?Z?V?Z?X?ZAX?Z?X?ZAX?ZAXAXAZAXAXAXAZAXAZCXAXAZCVCZC\\CXCXCZCXC\\CXIr@It@Iv@E\\E\\EVEVEVCVEVEVEVETABCRGVEXGZEPGXGVGXGVADEPGVGXGVIVGVGRADGVIVGXQn@IVGVIXGTENCHIVGVGVIXGVIVGVIVGVIVGXGRIZIZSr@GRGVGTIXGVIVGVIVGVIVGVK^GVIVGVIVGVIXIXIXGVGVIXIVCHCNIVGVENCFGVIXGTIXGVIXITGXIVGVIVGXIVGVIXGTAHGNGTGXIVGXMd@K`@GXMd@CLMn@Kf@CNGVEVMp@EXEZGXEVEZKp@It@QvAGr@ADEd@CVGt@?BCPGx@Ch@APMdCAL?RC~@AVA\\?LCtA?BAh@?b@?rA?J?@?v@?R?f@?X@bA?hA?h@?b@@Z?f@?l@@r@?t@?t@@r@?`@?T?r@@t@?t@?t@@t@?t@?r@@t@?r@@`@?t@?t@@r@?t@?j@?^?^@\\?Z?X?X?X?X?B@V?X?Z?J?D?H?X@X?Z?Z?L?J?X@t@?t@?r@?T@^?t@?r@@pA?t@?r@@pA?r@@v@?x@@d@?b@B`B@`@@X@Z@X@X@XB^@XBXBVBZ@XBXBZBVDZHt@BXDXBVDXDXDXDVDXDXDXFVDXFVFZDV@DDRFVFVFXHVXjAHVPn@Rn@HVJ\\f@tAHTHTLZHTVn@Tj@Tl@Tj@Tl@Vl@JVHVLXRh@Tj@JVJVHTJVVl@Vl@j@zAFLL^Tj@Vl@Tl@Tl@Vl@Tl@Vl@Tl@d@jAFPLVTl@Tl@Tl@Vn@`@`ATl@Pd@N`@Vj@Tl@HTJTTl@JTJVHTJVHTVl@?@Rd@@DTl@Vl@`@bAd@pAZt@@BJTHVJTN`@Rd@Th@Tl@HTJVJVJTHVJTHTJVJTJVLZFPJVTj@Tl@Tl@Vj@L\\FPJTJTJVHTJVJTJTJT?@JRJVJTBBHPHP@BJTFHRb@JRLTJRJTFHDHLTLRHP@BLRLRLTLRLRJRNTLTLPNRJRNRLPLRBBJNLRNRLPNRLR\\d@Zd@PR\\d@\\f@@@Zb@\\d@NRLP\\f@HJRVNT\\d@\\f@^d@b@n@TXZb@@@\\f@NR\\d@NRRZVZNT\\d@\\d@\\d@\\f@\\d@@@\\d@\\d@\\d@NR\\f@\\b@`@f@\\b@^d@^d@^b@^`@^`@b@b@PPLLb@`@r@n@NLRPPNb@^PLPNPLl@b@HFx@h@t@h@x@h@b@Xd@Xf@\\b@Xd@Zd@Xb@XRNTLLHRLPNRLPLRLPLPLPNRNPNPNFDHFNNRPNN`@`@\\^PR^b@NPLP^d@NRPRFJRXZd@NTLRLRf@x@Vf@LRJTJTLTJVLT@BHRJTHTLXHTJTHVJVFR@BHVRl@HXRn@Rn@Rn@Rl@Rp@Rl@Pf@r@zBRp@pA`EPl@HTHTHXJVHVJVHVHTJVJTHVJTJVJTJTVn@Td@Zn@Vh@Xf@JTLTLTLRJTLRLTNRLRLRLTNRLRLRNRLRNRNPNRLRNPPT^d@VXb@h@RRFHVVNPRPNN^`@r@p@d@`@p@l@b@\\d@\\b@\\b@Zf@\\b@Xd@ZnAt@bCxAf@Xd@Xv@f@d@\\FDZVd@^`@^BB^\\`@b@^`@^b@n@x@\\f@LRLTZf@^p@P\\Xl@P^Pb@Tl@Rj@Tr@JZDNPl@Lh@Lh@Ll@Hb@Jj@Hf@Ff@Hj@Fj@Dl@Dh@HvA@H@`@@h@Bj@?d@@`@?h@Ap@Ap@AZA^Ev@Ep@Ev@AHEd@Gj@I~@Ix@Gn@Gh@?FE\\CZCTC\\Gp@Ex@Ch@Cd@Aj@?@Af@Az@?x@?j@Bp@@`@?RDx@Dl@Bf@Dh@D\\J~@Jx@@FJn@Jl@Jh@Jf@Nl@Pp@Tz@Ld@Lb@@@Nj@Nl@Lf@Nl@BJF\\H`@H\\Lz@F^BJHr@Hl@Fh@Fr@Ft@JfBB|@HbCDzBBl@D|AFbCBjADxABfA@VDtAFdCFlBDhBDfB?\\DfC@@?jB@rBAdA?h@?f@Ap@Av@Av@ApAAnA?XA`@@t@?dA@d@@b@@n@Bt@Bn@Dr@Dj@?BDd@Fl@Df@Db@F^Fn@Hj@BNF\\Jn@DXH`@H\\BJLj@Jb@J`@J`@?BJ`@Tt@Nd@@FTp@FTHVRp@`@xANd@Lb@BHNf@BHH\\Pp@Lf@H\\R~@BLFZJl@L|@@BHl@Fn@Ff@D^Ft@Bb@Dd@D|@Bv@@h@@^@`@?t@@r@An@An@Ax@Cx@C`@AZEn@Gt@En@KdAGf@Gd@Mx@G`@CLCNYzAm@jCETMf@?@Mf@g@xBMf@Mh@Mf@ETMd@[vA[rASx@GXQ~@Mt@Mr@Ip@Kz@ALGj@Ix@IvAEz@Cf@A\\CbB?v@?n@@|@@x@Dz@D`AB\\B`@Fp@Bd@Jz@Jx@Lz@Lr@Jp@XpABLPv@BJLd@?@Pv@Rt@Nl@ZvAFTTdATdANx@Hh@NhALdAFh@@PJnAH~@FlAF~ABpA@jA?fAA`AC|@Ap@?HGlA?@Cn@ADEp@CZC^I|@Gb@AJGj@Kv@[|BK|@Ih@a@xCCRIh@OjAWnBQnAYvBS|AM`AOhAMz@G^u@vFuAhKKx@SrAUfBKr@In@Ij@Kt@M~@E`@QrAIp@Iv@G|@KlACh@Ev@Ct@A`@Cp@Ax@?t@?p@?v@@l@Bv@FjBFrAH`AHjAPdBd@lFR|BJjALpAZbDN|ARzAPhARjALl@Nr@R~@V`AT~@HTb@zAb@pATl@Rj@Vj@^|@\\v@Zp@`@`A\\z@\\|@Rl@\\bA^rAZjAJd@J`@FXVjANx@Jr@Lx@LbAFd@LfAFt@Jz@R~BRzBTxBNfB^|DZhDRpBFl@Dd@L|@Jr@T~ADRRdALp@Ll@Ld@Lj@Rz@FRX`Ar@~Bp@zBJ\\Nh@Vz@Lf@Np@Rz@TdAJl@N|@Lv@T~ALfALdAFr@BXBZDh@FhAFrADjA@t@Br@?X?h@@hAAdAAnACxAEnAEr@?FCf@Et@Ed@IhAGj@E`@Ip@Kt@Kx@UxAYvBUxAKx@AFETU~AQhAMbAQlASlAWhBKp@Kr@M~@WhBQvAA@Gj@KbAEd@En@CXC\\Ch@C`@A^Cn@An@AR?V?RA\\?lA?z@@x@B~@@PBv@B^@XDp@@RDh@Dz@@HF`AF`AHdAB`@Dr@F`AH~@@XJtAHvABZNfCFz@@N@XDl@FnADx@DbABt@?FD`ABjAD`B@j@?N@Z@j@?j@@j@?J@j@?P@L?j@@V?R@vA@v@?^@J?j@@xABfB@dA?V@R?j@@nA@^@j@@~@?V?vA@N?B?j@?V?H?J?TAP?x@Cv@AVARC~@ARCl@ALC\\El@QlBCPUpBGb@Gh@CTEVQjBKjAI`AMvBGnBA`AAhA?dA?R@V?h@@t@DjA@BD`AJdBL|ABNBXNrA?@Hh@BRDTF^@JJf@Jh@RdA`@`BXlANf@J\\X|@\\fAZfANd@Ph@r@zBJ^d@zAj@tBXfAFVFZNr@Nx@Lt@VbBFl@LbA@DFp@D^Fv@Dv@Bh@B\\@N@d@Bp@?BBr@@x@?j@?B?t@?v@?ZAt@Cr@Ab@CdAAD?NA^Ch@AJEnACf@GzACp@EfAEt@Cf@IxBMpCA`@A`@]xIIhBKrCGxAEz@GhBIpBAXGxAKtCElAGvBCvA?^?FAb@Ah@AV?ZG`DCrBC`BCfB?T?HChAAtAAdAEnAEbA?DAHCt@CXAZAHANAXCXCXCZCXCXCZEVCXCXEXIr@EXCXEV?@EXEXGXEVEXGXEVGXMr@GVGXEVS|@AJCH[zAENI`@WpAe@zBCJ]dBWnAQz@Ot@iBxI[|AKf@e@vBG^Op@g@bC[~AUfAGXSjAGVEXGV?@EVCNAF?@GXEXEVEXGXEVEXEXEVEXEXEXEXCVEXEV?BEVCXEXEXCVEXCXEXCVEZCXEXCXADARCXCXEXCZCXCVCXAXCXCXCXCXANAHANAHAZGr@Er@AZCXAVAZCX?DAJ?FAXCZAXAXAXAZAXAXAVAZAZ?FAh@EjBCjA?J?DC~@?n@ALC`B?f@AVGdE?XAf@?L?JAt@C~AAt@?BG`CAl@Cv@A\\Cp@Cd@A\\EdAATEn@?DEv@GhAEv@APALEj@?@Gr@MhB?@Gp@KnAK~@?FIv@It@Ir@ShBE\\SbBIj@UrBAJGh@?@MfACPMlAIr@CZIjAGt@Cf@ALCv@GlAAr@Ab@Ad@?d@Aj@?z@?^@hA@z@Bx@Bp@@h@D|@Bj@B\\BVBXHlAHr@Ht@Hr@DX@LHj@@DPlALx@Np@Jh@Nv@Lh@DRDRJh@XtAHZFZJb@PbAH`@Jl@Lz@F\\DXT|A@LDT?DBPFh@Lx@Hp@Df@Fd@LjAJfAN|ADz@Ft@@JB^@T@TDj@Bh@@L@b@@XBb@@L@H@p@Bn@DtA@V?RBfA?PBdA?bA@`@?L?d@?FAb@?z@?d@Al@?VA\\?PA|@ARAjAEdACrAAVI`BAPA\\OhCIlAKpAEb@IdAMnAIx@SdBCXKz@UtBADMjAE\\MlAC`@Gl@[jDGz@G`AKdBItAEj@Cr@KtBAV?@MxD?\\Cv@At@Ar@CpAAjA?Z?BAr@AZApAAt@A|@?H?F?F?j@A\\?b@C|BAp@?\\?Z?FAj@?ZAt@AZ?r@ApAC~BAz@?BCfB?dAAfAAv@Aj@AhBAjB?j@?|@Ar@?Z?Z?t@?t@?zD?hB?nA?v@?nA?D?j@?B?nA?nA?nA?~@?j@AjA?x@?tA?^?`A?lA?D?nA?xA?N?xA?p@?R?nA?z@?b@?T?`A?x@?t@?R?z@ArB?L?z@?lC?hA?lA?jB?n@?^?p@?nA?v@?fC?r@?dC?`E?`@?d@An@?vA?T?d@?J?\\?z@?\\?Z?B?f@?N?P?pA?|@?X?^?H?~B?h@?L?X?`@?bA?T?d@?L?tB?T?`A?N?p@?rB?HA~A?B?^?t@?lA?Z?jA?ZAr@?F?j@?X?j@?jA?dA?TAfB?|@Ch@?`@Ch@A^ABATCh@Ch@En@Gt@Gn@ADIp@CZIv@QvAGf@Kx@UrBAFUfBQzAAHIt@SfBS`BADK`AM~@a@rD_@vCCXAB?HA?C\\A@AHGj@]zCIr@OnAOlASfBET?@MjAAJ]nCe@`EAJGf@E\\ADGn@[lC_AbIOnAIp@g@lEc@tDqCbVQtAIt@CPAL[hCOrACRAJe@|DEZIt@CRe@|Dg@hEGl@E^i@rEAHABIt@YdCADKz@OvAs@~FE\\]|CIj@K|@Q|ASfBCRYbCY`CCXk@|EEZMjAWnBAJYzBGh@QtA?@Gf@Gj@Il@AJOpAE`@Ir@OjAALGd@OjACVMfAKx@SfBGj@AFAHCVAFAHQfBAFKdAMnAIx@Gl@CVE^KdA?DOhBQdBG~@QnCGv@IrA?@Er@CZCf@CZCj@Gv@Er@Et@?@Gv@Ev@IpAEt@Ev@G|@Ep@Ev@InAIrAEt@Et@Et@Ez@InAEr@IpAEr@GnAEr@Et@K`BEx@Gt@Et@Er@MdCInAObCKhBKfBInAMdCObCQ~CI|AItAEr@C\\GhAC^C`@CZOhCM~BUxDUxDSxDUvDOdCGjAEt@IpAIlACp@C\\IjAGpAEr@Et@Er@Et@Gt@Er@Cf@GbAAZEr@IlAGlAC\\Er@AXO`CE|@El@CZGjAEv@QvC?FCVKpBCZCXGnA[hF?@a@nHWdEA\\Eh@C\\]hGiBr[YxE]dG]dGa@nH]dGSdD?FEp@O|BA^Gr@A^CTAXCXAZCXCXAVCZCXAZCXCXEp@CZCZCXAXCXCXCRC^CZGr@CZCVEr@Ir@CZKlACXGr@CZEXCXGr@CTE^ARE^CXEXCXCXEXCXCVCNAJCXCVGd@?BAJIr@Ir@E\\MfAEZEXKz@CPCXEXEXCXEVIr@EZEXEXCTEXEZWhBEVEXCVEXKr@EVEZWdBMp@EVEZEXG`@CNKp@GXEXYdBEXGXSjAEXMr@Mn@EXSjAGXEVABKl@GVEZGTGZUjAEVGXGXEVGXGVI^CPo@vCEXOn@GXOp@GVGXGXETIZETGXIVWhAGXGXGTEPETK^ABYlAMh@YjAQn@]vAcAxDa@|AGPc@bBIVaHxWaApDYdAe@hBaApDMf@m@xBwAnFuB~HsNpi@eCjJwApFuHjYcChJQn@kBdHYhAw@rCQn@On@IXoAzEIVaKz_@c@dBoEpPETe@`Bo@zByAvESn@}@jCk@|AWn@Ul@Uj@o@~AUh@KTKVKTKVk@nA]r@Wl@g@`A[n@GLYj@KRg@~@U`@EJYf@[h@[j@u@lAGJo@dAe@t@o@bA}@pAk@v@i@t@c@n@i@p@_@f@c@h@k@r@]b@k@n@uA`BMLoAxAaCnC_ClCa@d@y@~@u@~@e@n@W^i@v@ILW^[d@c@r@_@r@c@t@[l@O\\INKRMXe@bAc@`Ao@|ASh@Qd@Sl@[|@GRIXSn@M^Kb@ABK`@W~@U|@Qx@Qz@YrAO|@Ov@G`@ETCRM~@G\\EZCZIh@?FMlACNIbA?BKtAKxAEt@A\\GnAC`A?@?j@CnBGzEAhBA`A?l@A|BA`E?FAbCAfBAvCAr@?TApCAnDAt@CzD?`A?j@A`B?HArAArBAv@?p@?b@?NAv@ArAA`A?^At@AR?JAr@Ad@?LATA^CfAA@Aj@AHA`@?JC^?BCf@?@Cx@IzAGdAGbACf@IhAGx@CZEh@E`@MrACZEh@Gj@APCXIn@K~@AHCTOjAGh@Kx@EVEb@AFa@lCKl@G^QfAMp@If@Ov@[dBMp@]bBSfA]fBQx@ER[`Ba@`CMl@GXOr@?@UhAc@bCa@zBw@fESbAsBnKG`@]bB[dBc@~BWnA[bBMn@Mt@Mn@GVWpA[dB[dB]`Bm@jDk@vCa@xB]hBgA|F[|AWrAi@vCUjAaA`F_@pBCNi@vCi@nC_@nBe@dC[`BWtAUfAMr@[fB_@tBMt@Mp@Mn@SjAUhAKp@Kf@Qz@Op@UjAEPMn@e@|BgAzFk@vCKl@Y|Ak@zCw@~DQ|@Y~Aq@lDQ~@c@|BUnAMl@Mp@cAnFKh@Ml@Mr@UfA[fBc@zBEXOr@GZEVMp@Op@i@xCOr@q@lDi@vC[bBOr@UlAGXEXGXGVEXGVETGZGXMp@GVKj@I^GVGXOp@G^Mf@GXGXGXENI^Ol@Or@Qn@On@Kb@Mj@GVGVIVGXGTWdASr@Qp@Qn@Ol@IZIVOj@K\\GVCJEJSr@Oj@CHOf@ITEPITENOf@Ql@Sl@IXIVENM\\IVIVIVK^Qd@IVIVWt@K\\Ob@IVITIVIRSl@M\\Wt@[z@Ul@Un@M^MZO^IVIRKXKTGPKVUj@Uj@KVUn@KTKVWl@Wl@Uh@KVKTMZSd@KTWj@KXWh@Q`@Q^KTKVKTKTKTKRMXKTMTKTKTMTKTKRKRKVMTKTGLQ\\KTMVIRMTKTQ^Ub@Wh@KTKTKRIPOZWh@MTMZMVUb@KRKVKTMTKTKTS^Q^KRKRKVQZKVKRUd@KTOZINIPOXWj@[p@Ud@KTMVOZWf@Yj@Wj@IRS^GJUh@Ud@INSb@MVUf@Yj@Wh@MVc@~@MTc@`AWh@Yh@Wh@Yl@Wj@MTQ`@Ub@Sd@[l@KTUd@]r@Sb@_@v@}@hBUd@Wj@a@x@i@jAYh@_ApBq@tAe@`Ae@bAq@vAq@rAWh@Wh@Yl@ABWh@Wh@Yj@Ud@Yn@Ud@OZWh@MVWh@Yl@[n@w@`BGNiA`CkBxD[n@o@tAq@rAYl@c@~@e@`AWh@Yj@e@bAMTWj@Yj@Wh@Wj@Wh@KTMTWl@Yj@Uh@Wj@Q`@GPm@vAQd@O^Yr@]~@A@Sl@Sh@KZOb@CDKZELEJGRi@~A[bAKZOj@KVQp@Ql@K^ENIVIZIXGVGREPI\\I\\Oj@I^Oh@ADEPAFEPOp@I\\GXETI^EROp@Mn@Mr@Mp@I`@If@Mr@Kn@Q~@M`AMt@Kt@MbAIj@K~@Kv@Kz@MhAE\\Gh@E\\Ir@MlACTEX?DSbBIn@MrAOlAEb@AJIt@OpACVEVAPUpBMjAOpAEVGp@Ir@Kx@Iz@CLMnAIn@MfAGj@ALIt@Ir@ADGl@CNI|@QzAGd@Ir@Ir@Ir@MnAIt@It@MhAWtBMjA_@lDIr@MhAKx@CZCPIv@K~@K`AMdAOpAE\\i@bFKx@CRK~@Gj@K`AK|@CRIl@Gj@ShBWzBCVGh@Gj@K~@OpAKbACTIv@EXIr@Gn@Kx@I|@G`@EXGp@[pCOrAAPIt@Kv@Gj@Gh@Gj@OtA[bDWrCKhAQ`BCXEb@GbAO~BIfAC^KhBM~BEf@KvBOpCEr@Ch@?JEv@E|@E`AEt@ATA^Cj@?DCd@E~@AV?HC`@?PAXCj@AL?PAJATAZAXAl@Cz@Ct@AZCh@?PCj@?XCt@A`@ARAZAh@CtAAT?TEvA?ZANCvA?LA\\?j@?DElCA\\?h@?@Aj@CbCAj@?BAnBAv@?n@?`@ArB?z@ApB?fA?bC?z@@rB?l@?z@@lC@`B@r@@bCFzE?XHfFDhCBvABjAHzCBjA?R@VBj@Bz@?D@`@@\\@V@P@b@@X@\\@T@T@^@Z@X@P?F@X@ZDt@@X@X@X@ZB^Bn@@Z@R@\\BZ@XB^@ZBl@Dv@@VB`@Bd@Bb@@X@NBb@BX@ZBX@XBZ@XBX@ZBX@XBXBX@ZBX@TB\\BZB\\HhABZ@XBXBXB`@Dl@BRB^@XBXBZBRB^?@BVBXBd@BNBXFt@BX@PBRDf@B^BRBXBZBX@FBVDd@Dd@BV@HDh@D\\BVBXB\\Hr@D`@Fj@Dh@BV@HFf@Db@DX@PD`@BND`@D\\BXDXBXBT@BBX@JDV@NDXBXDXBXDXDX@PF`@DXBXDXDXBXDXDXBXDXDXDXBT?BDXDXDX?BDXDVF`@Hl@Hn@DVDX?@F\\Hl@DXDT?BDXDXJr@DVDTBNDZHd@DZJr@FXFb@F\\BLVbBH`@D\\Hb@F\\Fb@Nz@FXLt@Lp@DXFVDXDVNr@DXBN@HFZFXDTFXDV?@FVDXFXFVF`@DRDTFXFXDTFXFZDTFVF\\FVFXFVDVFXFXFXDTFXFVFV@HDRFTDVNl@R~@BNFTDTH\\FVHZFVH^Jb@F\\HXFXNl@FXPr@H^DNFXHXFXFTFXHXH\\FVFVLf@H\\FVJ\\DPHXFVFVH\\FTFVHXFVFVJ^BLHZFTFXHXFVHXFVFXHVNl@BHDPFVDR@BHXFVFVFTHXFXFTFV@DFTFVHVH\\DNJ`@Nn@FVHVFVH^DPFTFVXbA@DFVFVHZNj@Pr@FXHXFVNl@HZPn@Nn@Pp@Nh@F\\HVPp@VdAVbARz@Nl@Pr@@BLf@HZDLBNFVHVFVFVFVHV?@FXFRH\\FRFVFVHZFV@DBJLf@DPFTHXFXFRHZFVHXFVFVNn@FTHZFTHZFVFVHVFVFVNn@Pr@J\\DPFT?BNj@J\\FTFVFXFVHXFXHVFVHXFVNj@FXPn@HZDPHZPp@Nn@Pp@FXPn@Pp@J`@Lh@Pn@FXHVFVFXFRPp@BJDNFXLd@BJFVDNPr@Pp@Pp@Pp@Nn@J^Lh@Lf@J`@HZNn@Pp@Nn@Pr@Nl@FXPp@FVLf@Tz@Nn@@BDRNl@HXHZLj@Pp@HXH\\BL@@FZHVFVFVDPBJBJH^HVFZFTNn@Lp@Np@H^DRJh@BHDVFVRbAHd@FZVzANz@RvAF\\@FF^@HDVBR@HDX@DBRJp@Hp@DZ@P@FDVHr@BXD\\BRBXDZB\\BL?FBXHt@BX@N@HBXBTB\\BX?F@F?HBZBXBXBZ?J@LBXBX@VB^?H@RBT@ZB\\Bb@Br@FvADrAFfBDpB@p@?TBt@@nABjB@j@?JD~C?B@j@@j@@b@@bADhDDhBBpAD`ABh@?@Bh@Bf@Dl@N|B@DR~B@@Dj@Hh@LdAJx@Hh@Hd@Jl@PbALt@Ll@Lf@Jj@Ld@Lh@Jb@Nj@Rr@h@hBFTXx@Pd@DNZz@v@pBRd@Tf@b@~@Th@h@dATb@\\n@b@v@RXZf@T`@`AvARZNVj@x@NTNTJNLRPT\\f@RZd@p@^h@^j@V^X`@h@v@V`@Zb@Zd@l@z@T\\V^Vb@PVLRRZPXFLFJNVJPLVJRJTLVJRLVRd@N^JVFPLXHTL`@N`@J^Ph@Tx@Np@BJHZBJLn@Ll@Jj@H`@F^BNFb@Fd@D\\Ff@Fj@Hr@F~@Dp@Bb@B^@b@Bb@@h@@h@@b@?J?R@V?L?\\?@?X?N?R@V?L?\\?D?f@?B?d@?@?T@T?@?b@?D?L?\\?b@?Z?V@F?`@?V?^?`@?@@d@?B?h@?Z?d@?j@@r@?^?b@?b@@j@?bA?n@@b@?b@?b@?n@@|@?nA?b@@r@?\\?l@?p@@vA@lA?X?z@?@?j@?^@z@?l@?d@?D?f@@t@?j@?t@@T?B?rA?l@@`C@jC?X?N?J?X@X?P?D?d@?D?f@?B@j@?d@?D?f@?B?V?R?B@v@?Z?X?X?Z@lA?x@?B?j@@Z?X?\\?X?Z?X@X?V?\\?V?X?^@X?Z?P?B?lA?D?V@R?D?d@?L?t@?^@J?bA?R?D?V?L?N@X?Z?R?D?d@?N?X?X@R?F?nA?r@@Z?F?fA?z@@T?r@?x@?p@@V?\\?fA?`@@nA?r@@bC@pA?Z?jA@pA?Z?X?X?Z?X?D?T@Z?Z?^?R?Z?P?F?V@v@?Z?V?Z?Z@V?Z?X?Z?Z@fB?D?V?X?X@nA?X?V?V?Z@D?T?l@?`@@t@?t@@nA?hA@tA@pA?X?T?B@X?Z@Z?X@Z@X?X@X?@@V?Z@Z@X@X@Z@X@X?F@P@Z@X@XBZ@X@X@Z@J@J@ZBZ@XBXDt@?@@VBZBXBV@\\BV@P@FBZBTB\\BVB\\BVBZBT?DHr@Fn@B\\DXHt@BVBXDXDZBVDXDZDXBTDZDZFd@Hf@DTDZDVDZDVDVDXFZDVDVFZDXLr@FT@FBPFZFXDTFZFVDXFVFXFZFVDRFZHXFVDVHZFVFTHZFVFVPn@FVHXFVFXHVFTJZFTHVFXHTHXHTHXFTHXHVHVHTHXHTJXFRJXHTHVJVHTHVJVHVHTJVHTJVJTHVJTDLPd@HPFRBDHTJTHRJZJVHRHTJVHXJVHTHTHVHVHXFVHZFTFVFXFZDTFX@HBPDTBLBLBXDZDVBZBX@HFh@@V@N@R@FBt@@D?D@h@?@@J?H?D@Z?T@t@?B?N?H?RAN?R?N?JCp@?B?F?DAL?B?BATGdACVAZA@Ed@ARAJEX?BALGb@ANCJANCTCJ?@AFALCPCTALE\\Kx@Gd@CRAL?BG`@E^UjBGj@CRAFANCPKv@AHE^It@Ir@OjACRAHCVEZCVIv@EVCXEVIt@EXCXEXCZKt@Gn@EZEXCZGh@?FIt@Er@Gx@El@AZCZAVA\\AXAVA\\?V?BATAXAx@?X?r@AX?Z?Z@Z?V?X?Z@X@Z?Z@Z@V@Z@ZBt@@VBZ@VB\\@ZDn@Ft@BXBZBXD^DZBXDVBVD\\DXBVFZBVDXFXDXDVFXBRH\\@JDPDVFVFTLn@HZFTHZFVFVHXFTHXHTHZHVHTHTHXHTJXHVFTDHJXJZ@BRl@\\~@Pd@FNh@pATd@N^Xn@f@bAd@|@z@|AP\\V^Xf@RXV^RZX`@RVRXTXVZ^f@\\`@JLf@j@HHDD`@b@`@`@|@~@\\\\z@|@b@b@XZTTDFX\\XZ@@V\\f@n@\\b@n@|@NTNTRXT^NT\\h@Xf@LTJPVf@t@tAR`@Tf@Vh@Vj@LXn@xAdCtFN\\j@rAf@dA|ApDZn@\\x@lAnCRd@Zp@j@tAj@lA|@rBRd@v@fBd@fAn@tADLXl@LX?@Rb@Xn@fAdC@@d@fALVHTrAxCz@nBnArCVh@N^n@vALXJRJXJTJRHTLVJTHRXl@JTJVJRJVHRLXJTVj@JTJVJRJVLTJTJTJVJTJTHTLTVl@JRHTLVJTVj@JVJTVj@JTJTJVJTLVHRLVTh@JVJTLVHRJTLVHTJTXl@JTJTHTLTJTn@zAJTJTJRn@xAVl@LV`@~@hAfCHRJTLVJTVl@JTHRLVJTJVJTJTJTJTJTJVJTLVTf@LXJTHTNXHPJTJVJTJTJTJTJTJTJVHRLVJTJRJVJTVl@JR@BHPLXHRJVLTNZ\\z@JTLVHRJVLTHRJVJTJTLVJVJRJTJVJRJXJTDHBHLVJRHTLTHTLVHRLXJRJVHRLVJTJRJVJTJTJVJRJTJVJTJTVl@JTVj@JVJRJVJTLVHRLVJTTj@LVJTVj@JTHRLXXn@HRn@vAb@`AVj@Vl@d@bAHNN\\HPJVVj@JVJRb@bAn@xAVj@JTVj@JVb@`Ad@bAn@vAXn@Rf@@BJR`@~@@BJTJR@BHRz@nBVj@b@bADFDJVl@JTP^P`@JTJTJVJRJVLV`@~@JTDHDLVj@b@`AfAdCn@vAJTLXfAdCFJN\\Vl@JTFLh@jAn@xA`@`ALVJTJVn@vANXd@fA^x@v@fBbA|Bv@hBf@dAb@dAp@xAbBvD`AxBbIxQJVZp@Zr@HR`@|@HRJRn@xA\\t@\\v@l@vALTj@rANZh@lAd@dAP`@h@lAz@lBb@dAz@lBd@bAJTHR?@Rb@Vl@~@rBJR?@Rb@FLVj@l@vAb@`AJTJVRb@bAzBJTFNJRbA|BFNTh@HNf@hAn@vAfAfCfAbChAfCdA`CJVf@hAn@vAb@bAhAfC|@pBVj@`@|@FNRb@@DZr@dAbCf@lAVn@\\~@h@vAn@hBRj@\\dAJX\\fAZdA\\fANj@Tt@Ld@\\pAFRPt@Nj@XlAbAbELf@Jd@Lh@vAzFVfA^zAT~@VbANr@HXf@rBFXJ^VfAPn@Lj@H\\FTNl@H\\HXLj@Nn@`@`BPp@Pr@FTXlANn@FVPn@Rx@f@tBf@tBXlA`@~AXhAPv@^xAz@zCRz@pAzFR|@\\vA|@pD^|A|@lDNl@Pp@Jb@^tAXdARp@Rp@n@pBTp@\\dA^fA\\bATl@j@xAPd@N^LXTj@Tj@Tj@d@bA|@rB|AjD|AhD`BrDn@vA`BpDx@lBXj@JTVj@`BtDb@`Az@lBlGjNlBfETh@rAxCVj@~@rBFPp@vAd@dAfA`CVj@JTx@lBXl@|C|G`CnFb@`AzAdDLVdDrH`ClFNZbCnFZr@dA~Bp@zAPd@N\\Rj@FNBDZ|@Tt@Rn@Pl@T|@Nj@T`ADNP~@H\\Hd@N|@FZBTJj@BVDZFd@?@LbAD`@Df@HjA@NDf@BZDt@DfADpA@f@@h@?V@v@?bA?HAlAAj@?p@Cp@EbACn@C\\AZCZATInAEt@CTIhAEl@Cf@InAIlACVGlAUtDEh@Cf@EdAAP?@Ad@Ev@C`AAd@?TA^?LAd@?j@?NA~AAd@?^@p@?`ABjB@jAD`B@`@@R@\\B`@Bp@@XFhAB^Bl@JrAFr@BX@J@LBXFn@Fn@Fl@Ff@Hr@Fn@Jp@Hr@Jp@Jn@Hj@Nx@Lr@Hb@Hb@F\\DRFZFTNr@Nr@H^DNFTFVLh@J^FVFTRr@HXZdAHVXbADLHRNb@^fARj@Rj@Vn@JVJV?@^|@Xp@Vh@HRJTLV\\r@Rb@f@`AFJFN@@Tb@l@fAx@vAZf@d@t@l@~@n@|@n@z@d@p@LNJLDFnA|A\\`@fAnAj@l@l@l@Z\\dA`AfAbAl@h@lA`ANLVTbAx@NLt@j@fBzAb@\\xCbCjEpD\\XhA|@TTNJNLdAz@PNZV?@j@d@NLfA|@b@^`@\\PP\\ZVTZZZZb@d@RTPRJJPT^b@V\\FHLNDFRXPVHJBDNTNTLRNTBFT^Xd@R^HLJTFJLTBDTh@NXNZDHFNLZLX@BTj@HRDJBHJXJXL^HT@DJXHZHTHXBHDJFXHXHXHZ?@Ld@Np@FXDVFX@DLj@Jp@Lv@DXBR@FHf@D\\DZHt@Fn@B\\Df@Dh@Dl@?@Dn@@\\Dn@Bv@@r@@r@@P?J?R@d@?bA?p@AZ?n@AFAp@Ar@A^Cl@Ch@C`@Cf@G~@CXCb@ALEb@CXGj@Iv@Gl@ABGf@Q~AMnAEd@E\\MjAK`AI|@K`AAJC^Gv@MdBGn@AZCV?@Er@IlAGpAGhAC~@A@Cn@CbACh@A^Af@AT?FAVCnAAt@?VCnAAvA?l@?V?r@?bA?`A?nA?r@?x@?~@@fB?fB?T@n@?hB?v@@dB?|@?j@@rA?nA?lA?d@@j@?z@?d@?l@@z@?B?d@?@?b@?d@?V?Z@Z?bC?lA@p@?fA?nA@tA?dB@x@@rD@bE?l@?hC@fB?lA@tB?~@@fC?xC@lD?bA@vC?\\@jB?tB?F@tF@|C?lA@v@?jB?n@?Z?T@vA?`B?T@vB?L@hC?X?^?`C@X?v@?r@?T@jB?t@?\\?V@n@?j@?bA?T?Z?b@@T?T?jB@nA?p@?zA@fD@jF?vA@t@?pA@tD?xB@z@@bD?xD@r@?\\?V?pA?X?Z@bB?lB@zB@nC?L?\\?L@pI@pC?\\?j@@~@?V?j@?j@@j@?N?J?V?j@?T@V?pA?t@@Z?l@?|A?z@?b@@\\?j@?j@?|@@tA?fA?j@?^@Z?rA?pA@hA?^?jA@vB?N?fA@bC?b@?V?fA@hB?dA?j@@N?|@?H?|BAp@?j@AN?@AdAChA?LANGdBCn@AVA\\Cp@Cb@E|@KbBEj@Gt@Gr@ObBK`AKx@MjAKt@MbAMx@O|@O|@Mv@Op@Mt@Mj@Qx@Qr@UdAQr@Md@Qr@Ux@Uv@Uv@Sp@Y~@EJK`@Sn@c@xAM`@M\\Uv@Md@y@nCOf@Uv@W~@Mb@A@Qt@GZMl@Kd@Gb@If@ADAREXCRCZCb@Cb@A`@A`@AZ?@?b@?b@@b@B~@Bd@Dr@Fp@Hr@Ff@F^Jh@Jd@XfARl@Nd@?@Vl@Xl@P`@`@t@Xd@\\h@^j@^h@^h@f@t@`@l@bClDHLbAzAZb@b@l@T^PVNXLRR\\P\\NXNZHPDJDLJVJVJ\\FPFRJ\\J`@Jf@H\\DZDVFZBRFh@Df@B^BX@VBx@@l@?`@?b@?`@Ah@Cx@Cn@Ep@Cd@G~@AXM|BCTItAEr@?BCd@Cd@Eh@A\\CXGjAC\\G~@?FALAXUxDAH?@ItAAPGbAARCj@AJ?HEl@APCVCb@I|AGz@?BCj@CX?HIhAC\\GjAAZEv@C\\C\\?LALCZA\\EdAG`AC`AAl@?\\A`A?R?H?dABtABv@@Z?@?BBd@@h@?@Dh@BX?D@HBZDd@BZ@R@H@FFj@Hp@F`@DP^`CBNFXFZBNNl@BHFVH\\FTZdANj@BDLb@L`@DNBFFPVt@Tr@Vt@DNJX^hAl@hBj@dBJXNd@DN`@jAL^Rp@N`@JZDJNf@Pf@L^JXHVL\\HVFRFTN`@FPFPFTN`@FRFPDNPh@Vt@FRFRLb@DPFRDN@@Ld@?@J^HVHZLd@Nn@Pr@DRHZPv@Jd@Nx@Lj@F^Nt@Lp@Lp@BNDZJh@@JVfBVfBR`BJz@D\\BVLlAL~AH|@Bb@B`@FbADd@Bf@Bn@B^Bh@Bh@Bt@DbBB|@Bz@@`A@d@@vA?j@?\\?f@@d@?z@?LAn@?X?NCfA?H?^Aj@A@Ax@A\\AbAARA`AAT?B?b@?d@?f@?L@f@@b@Bb@Fv@?DFj@Hv@FZHl@H`@@BJd@Lf@@BRt@L`@LZ?@Xt@Tj@P^HRHNFNN\\HRLZLVLXHR|@tBFNLZLZBFPb@f@rANf@L\\\\fATp@^lAPl@Pn@Rt@\\rAJ^FVDRLf@Jd@Ln@BHJl@HZHb@Hb@TlARlABN?BPfAJv@Jx@F^D^@JD^@BFj@?@Df@Fl@LlAFf@?BJ~@J`ADh@@BD`@Fl@Fr@Jz@Ff@Dh@J`ABVVdC@PD^Fx@Ft@Bp@Dr@FxABdA@dA?J?^?B@R?R?B?^?f@Ab@?f@Ad@?f@?FA\\?ZAZAdAG~G?RAf@?b@Ah@?h@At@Al@Ax@?\\Ar@?n@?b@?h@?b@Bn@@V@\\@X@LBVFn@Db@F`@@HBR?@DVH\\Jf@Np@@@DNJ`@Rl@JXRh@JVLVTf@Zn@NV~AdDTd@P\\NX@@l@pAVf@Xj@LX`@t@Tf@DJnAfCXh@Rb@NXR^NZTf@LXb@fAJZN^Rp@Lb@FTDTFXDRDVDVFXDZBZDXBXB\\BXBL@VBXDh@@LBVDX@PDVBXBR@JBN@JDVBLBPHf@DRHZFTHZJ^HT@BFRHTL\\LXP`@LVR`@HLFLHPNVLTP\\R\\FLHNDHFLP\\P^HPP^FPN`@N^JZL`@@DHXFTFVFVFTF^H`@FZHj@BNBXBL@LBXBVDb@@PBT@R@^B\\?V@b@@T?T?V?TAR?Z?VAVA\\C^APAZCXALANAPC\\ETCXCV?BANEZE`@Ef@CZCXCTC\\APCTA^C\\Cd@Cr@?P?HAb@Ah@?l@@Z?T@h@@\\?F@R@`@@XBZBX@P@P@NBV?FBJBZBVFb@Fb@DVDXDXBLHb@DRDRDNDVHZFRHZ@BHX@FBJHVFPNb@JVFNJXJXN\\P\\LXR`@BDXf@Vd@JRHNHL@BHLNXPZNTJRT`@BDTb@lArBR`@HLDFn@hAlAxBpAbCTb@LVb@`AN\\Td@Tj@Zr@Tj@L\\FNBFHTTf@JXHP@BRh@Vl@LVDLHNFNNZFLJTLTLTJP@@@DV`@DDJPLRJLDHTXX`@X\\RXHJbAnADD`ApAZb@DDV`@^l@^p@BDh@dAb@bA@D\\x@Tn@Nf@BDHVFVFVHVFXFVFXFTFZDVLp@DX@DBPD\\Fd@@HDf@Df@Dj@HnADbA@r@@x@@`B?p@?l@?`@?T?t@@l@?|@?h@?h@@X?bA@d@?Z@J@^@f@DdADjADp@@Z@NB`@Df@Fz@Dd@BVBTHz@LbAZjC^~CPrA@LBV@DBLDZFh@BRBVHh@Fh@Fj@Hh@Fd@Fl@Hj@Fh@Fh@BNDXD\\@PF^Hp@Fj@Hh@BVF`@BZBPJr@BVDZFd@@PBJBXLz@J~@LfADTD`@BVF^D\\J~@Fn@Fp@Fv@@VB\\Dp@@NDr@Bb@@\\@\\Bf@Bp@@d@@d@?j@BvA?j@?X?|@?TA`AAN?ZAj@Cb@E~AA`@?JGpAEd@?PIdAMvAEh@ABALAPADCRCVE^AJGf@CREV?@EVCNGb@?DOz@EZG\\ERG\\I^I`@CJGb@SdAgBxJCFgAnGM|@CNKx@Y`BQlAIp@U|ACV?@_@dDShB?FK`AGv@I|@KtAIz@C\\Cf@CPCl@Ej@AFCb@CXAVCf@ARCZ?LC\\IbBEdAAj@Cp@Cb@Aj@A\\AX?XCv@CfBCpAAp@?x@AtAAbB?d@?xB@pA?t@@X?t@@t@DbCBpADnA@XFvBJvCTvG@LFhBJzCDnA@F@j@J`CDtARdGBX?TBh@JfCHnCD|@F~ABn@Br@FjBDvAJlCH~BJfC@`@LlD?HHxBFvA@TDrADpADfAFvADrADfABt@B|@DdA@d@Bn@DxADxADtA@x@Bv@BhABhABbBDlB@~@@T?T@J?R?L?R@V@nA?D@h@@f@?D@|@?R?D@x@?V?D@~@?P?T?n@@P?bA?@?P@j@?R?D?P?V?R?tA@v@?N?z@?xA?|@?r@?P?bC@dA?|@?z@?t@?F?fD@tC?`C?N?rB@xA?h@?bB?@?J?P?hE@nD?hC?d@?N?v@?v@?V@bA?xF?\\?\\@fB?f@?`D?j@?P?X?P?x@?N?lA@`F?hB@dN?n@@~@?xB?~A?|A?h@?r@?Z?X@Z?X?P?H?X?F?P?t@?V?\\?D?R?V?@?nA@vA?R?Z?J?Z?L?V?p@?z@?fA@J?fA?B?|A?d@?j@?P?B?`A@|@?X?P?B?bC?R?V?t@ArAA|@?RA`@CnACzAANC`AEfAGlAGpAIvAEp@C^AHKpAM|AMpAE`@EZK~@OlAIt@G`@M`AYjBEV?BGf@WdBG^Gd@EXGb@M|@CTE^E^A@?@?BGd@Gh@Ix@Gh@CXGn@C^Ej@Gl@Er@KxAK`BEz@GlAI`C?FGpBA\\?HAj@AXAr@CbB?PA|@?zA?vA@jA?B?t@@R@v@?r@Bv@BdA?@BpA@PBz@@\\@LBf@Bv@H`BFnAHhA?THpAD`ANpC@L@ZBX?H@F?HD|@Dn@@HDx@Bj@Bh@Dj@@V@R?BB\\Dt@Bj@Dz@BXBr@BZ?F@P@XHnAFtAH~A@DFjALnCHlA?NDf@Bf@PnDFjAd@hJPfD?FPvCX|FP`DFnARtDPlD@RR`EDn@TxEPjDHzABh@VbFB^RbE@NDv@Dr@Bf@DbA@PDfAF|A?JBvABvA?T@jA?dB?DAnBCnBCv@?VARCt@AZCx@Cj@Cb@KtBMxAGv@Iv@UfCIfAGl@KhA?HE`@AHW`D_@jEY`DMzAKnAGr@Gr@Gt@StBKlAQ~AC^Gh@CXAH?@KvAGh@Eh@Gj@KtAGj@Ej@MtAKtAEf@Gl@S`CSdCWnCk@~GMtAm@hH]zD[nDYfDC\\Eb@Gz@QhBGx@YfDUjCAJ[hDS`CAPM|AOdBCRGn@CXI~@OfBEh@AHQzBS|BIbAE`@I`AMzAMxA[jDMtAKvAIr@]lEE^KjAQjBC`@MtAM~AGj@e@nFIbAO`BKrAE`@?FA@C^AHC`@WpCCXa@`FQtBm@~G{@|Jo@tH{@|Ja@vEOjBg@~FWxCWzCy@jJW`Do@jHYhDs@fIIdAGp@s@lIKpAo@rHEh@WjC?D]`ECVQzBGt@Gn@C\\QfBCd@A?Ed@?DEh@CRKlAKjAANKhAALMzAKhACXI~@KnAI`ACPWzCIr@UvCMnAATM`BGh@Ep@Gd@K`AY~BAHQxAKp@QnAG\\]bCKn@Kj@UrAMr@G\\ETUjAEPQ~@ERMl@Op@GTGZQr@Mj@Op@Oj@[nAGTg@fBCHq@~BK\\Sn@GRGR[|@Qf@Od@CRCHMZCHQf@ITENQd@Qh@Ob@m@fBCFc@nAAB_@dAIVYz@O^s@tBUn@_@bASp@Ul@Yv@EL_AnCM\\O`@_@hACFM`@KZKX]~@Yz@M\\M\\KZw@zBe@tAm@dBQd@_@fA]~@GTSl@a@jAm@bBIT]bAk@~AsA|Dy@~BKZo@jBg@vA}@hC_@fAi@|AEJe@rA{ApEEJo@fBi@~A}@hCy@`CyAfEa@hAWt@GRMf@IPOf@Qd@k@~Am@dBELQd@?@Od@cAvCITCFIVo@bBQh@{@dCa@hAiAdDM\\GPUp@IRg@zAGPYx@ELa@jAk@zACH[`AIR_@fAKZSj@Ob@[|@Un@g@vAa@jAKZQf@]`Ak@bBSl@A@]`AIVK\\Qf@_@fAm@hBM\\Qf@a@rAQl@Sn@Sn@?@Sr@c@~AQr@GR?@Ql@Qt@Qt@EPOr@Op@Kb@CLWhAWpAERMp@Mn@Kl@?@Or@G\\CTA@CRMv@GXCPEVCNObAAJSzAKp@M|@Gj@CNE^E\\KbAK|@CZCTGr@Ir@Gv@KlAUxCCb@GdAADCr@En@Ch@E~@?BItBA`@EtAE`BIjDEbCI|CCnAElBE`CAh@IjDEbCEzA?BAh@ClAAt@CpAABCbBEhBI|D?DAd@A`@ClAAx@EdBG~CGdCIzDCnAKxEGvD]xO?Dc@pUCdAClACt@Cr@EjBCnACjBEhBAt@AN?H]hQ?JExBEnAQzICr@ChBGzCA^CnAAX?ZAXApAClAAt@AXCr@?XAZCr@AXAZ?XEnAAt@Ct@Ar@?NAf@AVAZ?RKpECxAKrECnACjBAPAd@C|A?@A^G~CCv@?XAXAZ?XCv@AVEdCCvAA@Al@Al@IlEAHGpCEbCE~AC|ACrAEbBAt@M|FIzECp@AZEfCAX?XCt@AZ?V?@Ad@Aj@EhBCpACjACt@An@A`@MbHEjBCnAAXAX?Z?BE~A?DEfBAr@Al@ExAAt@CnACpACx@A`@?HIlDAdAA\\Cp@?PAZA~@E|ACbAA~@ABC`B?DE`BA`@An@CrAAZGrCShKAj@Ad@?DAj@Cp@EnCAj@A^EbBEpB?PCv@ErB?BA`ACr@Af@ANCnAElA?BGnAIhBIlBKhBCXMjB_@bEGj@CXQhBIr@W`CWpBCP]~Bc@zCy@fFc@tCqAnIwBlN]|B_@|BIh@Ih@Ij@Ih@CJi@nDc@rCUtAQjA[lB]vBU~AG^i@rDSlAk@pD}BbOqAtIo@dEKr@YdBKp@e@xCQlAqAnIc@rCKr@m@tDYjBiE|XIj@CJKt@YhBW|AEZAJCLCNGXAN[nBMx@e@tCOdAaAjGE\\WbB]xBEPcAvGa@lCm@~DUxAgAbH]|BW~AiAlHo@bEKv@EXEXEXGXEVKr@Kr@EXEVGZEXEVEZKr@EVEPyApJEXKr@QhAKt@SfAaAvGSnAUvAO~@Mx@U`BKh@CNk@zDKn@EVwAjJ]vBy@nFk@rDEZQfA_@~Bc@vCs@rEc@pCUxAMx@Ij@]|BIh@SrA_@zB?@]~BIh@Ih@Kn@Gb@E\\Mz@In@ANEVMfAMfA?BKv@C\\CRGj@Gt@O`BI`AEv@E`@Ef@Ex@InAGpAE|@Ez@GnACx@ARIbCCpBCtAAv@Ar@AlA?x@AL?D@N?H?F?FArA@n@?v@?`@?P?\\B|C?F?p@@X?P?F?Z?V@t@?X?Z@pA?r@@p@?`@?p@@nA@tA@l@?@?`B@lA?p@@fA@fA?\\?^B`C?V@`DB`D?p@@jB@t@?`@?P@v@?V?\\@T?^?X@r@?|@@l@?\\@hB?v@?X@pA@bC@rA?T@nA?TBzD?b@@r@?Z?V?X@^?t@?T@v@?Z?Z?N?H@@?V?t@@X?\\?p@@\\?r@?Z?Z@t@?V?Z?Z?V?Z?X?Z?XAZ?x@?RAZ?ZAXAv@?^Ad@Aj@?LA\\AXAT?ZAXAZAXAZAXAZCt@AXAZ?XAXAXAZAXAZAZAXAZCr@?ZAVOxE?TAZAZAV?\\AVA\\?XAV?\\?XAX?Z?Z?X?X?X?X?Z?Z?X@X?Z?X@X?X?H@P?Z@R?F@V@Z?X@X@X@ZBZ@X@X@\\BZ@P?FJdBBd@BX@TBVBXBZBXBZBXDZBXBVBZD\\BTDXHr@DXBXDXDXBX@@BXJp@Hr@DVJt@BVDZDZDXDXHp@Jp@BPFd@\\nCFd@DXDZBTDXDZDV@J@LDZJp@DVBTD\\DXBLBLDXDXDTDXDZFXDVDVDZFXDVFXDXFVFZDTFXDXFVFXFZDTFXFVFXFVFZFTFZFVFVFVHXFVFVHXDPPr@FVFRHXFTFVPl@FTZbAHTFVHTDH@JHVRn@JVRn@^fAHTHVRl@Vl@HVTn@HTJTJVTl@JTHTJVJTVl@JVJRJVJTJVJRn@vAd@bAJRZj@Xh@LVLRJRZj@NRLRLRLRLR\\f@LR\\f@^d@\\d@n@x@|@fAr@t@NPPPNPPNr@r@PNRRPLFHb@`@PNJFTTb@^PNPNb@^PPb@^b@^PNNNd@^`@^xAnA`@\\fA`APNJHBBRPNNRNb@^b@^`@^d@b@RNFDBDRNn@h@hA`ABDt@p@vAjAPPb@\\PNb@\\v@j@PLRLd@Vf@Xf@TRJf@Th@Pf@PTHRFh@NB?PDTFh@JTDh@FnBPnAFxABfCDfB@lABtABjBB`@?fEDzBBt@?J@J?D?T@T@V?h@@`A@V?T@R?H?D?@?F?H@J?R?H?J?HAH@P?T?h@@j@@V?vADT?P@XBV@R@TBT@TBL@\\DTBTDTBTBRDVDRBTDTFj@Jh@Lh@LVFPFPBVJJDHBTFRHRFRHRFVJPHLDRHFBRHJDh@TXPRJRJf@VPJd@Xd@ZRLPLRLPLPLHDFHRLPNfA|@b@\\b@^PNPLPPPNPLPLPPzBlBRNPNPNPLNNRNPNPNPNPNJHBBRPPLPNb@Zd@^RLPLd@ZRLPLRLd@VPJRLRHRLRJRJRJf@TTJf@Rh@RRHRFTHTFl@RrA\\|@RtAVTDTBTDTBTD~@Jj@Fb@F^BR?TBV@tADV?~@Bd@@p@Aj@Al@AR?VAh@CVCRAVCTATCTCRCl@ITCTETCTGJC\\EVERETETETETEREj@Ij@MTETC~@QRETEJCHAj@Kh@Kj@KTCTGRCTE`AOTCj@GTCTATATAl@AR@T?V@T@T@TBTB\\F`@Fj@JRFTFh@Ph@Rx@^RJRJRL^Tn@d@d@`@\\\\NPPN\\b@RTLP\\f@Zh@LTXj@Vj@`@bATn@Tn@HTJVFVJXFRTn@Rj@HVRj@HVJTBFBHJZHTTj@^dAj@tAJTHTBBFRJVTf@Vl@JTHTVh@Vh@JVHPLVJRJTJTJRJRXj@Vf@LVJRLRXh@d@z@f@~@d@v@d@x@Zh@LRh@|@Zd@LRLPLRLR\\d@Zb@h@v@\\f@\\b@Zd@RTJNFFFHLP\\d@NNLRRTX\\?@XZBDPRBBHJNPPPHJBBNRDDVX@@LLLNJJNNNPHHPRHHDDNNDDHHLNB@NN^^^^@B^ZPN^^^\\RR^\\p@j@JJTPr@l@d@\\`@\\r@h@b@^PJHFDDB@LJNJBB`@Zd@ZNHRPNJv@f@b@Xb@XTNxA~@b@VTNNHLHTNv@f@t@d@RLb@VRLNJPJh@ZdAp@t@d@z@j@vInF^TzCjB|A`AB@t@d@`BdATNn@^hAt@RJj@^b@XFDnBlAZR@@FBvA|@^Vr@b@f@ZZRB@p@b@VNd@ZHFb@VXRt@b@\\T@?HF^T~CnB\\R\\R@@\\R~BxAvAz@lAx@hAp@B@zCjB`@Xn@^`@XRLTLp@b@x@f@^Tf@ZTNTLPLPJp@`@TN`Aj@~@h@BBb@Tv@d@b@Vb@Vf@Xt@`@v@b@x@b@v@`@jAn@lDfB|Av@h@VjAj@v@\\h@V~Ar@fCfANFnAh@xB|@RH`Bp@PF|@\\RHTHFB\\LnAd@h@RpAb@l@R\\LtAd@PFpAb@tAd@nBj@z@XD@PFnA\\z@VnA\\`AV`Cp@dEbANDNDRDNBPFVFlBb@v@P@?`@HPDLBxBf@tAVd@Hj@JnATz@PnARfARhBXxATrARb@FdANb@Fb@FB?dBTb@DVDF@B?v@HrAPlCZ|@HXDRBD?~@J@?xANp@Hb@DXDpANb@D|AP`AJlCZl@FTBtEh@RBR@bEb@xBTxAP`@Db@D|AP@?d@FtEd@xDb@vD`@fCX~I~@vAPhBR|BTNBZBnANzAPL@zAPd@D`@F`AJzANzAPN@NBB?dD\\lANf@F`@D@@dBPjD^h@Fh@FdCXB?b@DlCXB?|C\\|APfCXpD^@?`@DVDH@b@DdBRnCXrCZ@?z@J`AJ`PdB`@DjALz@JrFj@n@Hb@DdAL`@DzEh@nAL`CVvAPnANzBTzBVtCZj@F|@HnCZpBTtCZbAJt@H`CVPB`CVd@FH@bAJpAN`BPxBTbEd@pBR^DPB|@JP@RBVDP@TBTBRBTBl@Fh@Fh@Fb@Fh@FXBd@DTDR@JBH?RDZB@?`@DVDRBRBf@DVBRBTBTDR@TBRBRBTBRBTBRBTBRBRBTBTBTBh@FRBR@TBTBRBTBRBTBTBRBVBRBRBRBT@TBRBXDN@TDR@RBRBTBTBTBRBTBTBTBR@RDT@TBRBTBRBTBRBTBRBVDRBRBTBR@TBRBRBTBRBTBTBRBTDTBRBR@RBTDT@RBVBVDP@h@FF@r@HVBPBRBZBNBRBF?p@H@?RBLB@?@?RBVBbAJPBt@Hb@DTDd@Db@FB?b@D^Dt@HL@|@Jd@Db@Fl@FTBj@Fb@FfAJPBd@DD@PBn@Fb@FH@N@d@Fj@FF@\\DTBTBf@FZB@?t@Hj@HlAL\\DRBB?NBjBR~BVL@xANr@Hd@FlALB@h@Dp@HvANnBTfBPP@HBh@Ff@Dt@H^Dh@H`AHx@Jf@FF@r@Fv@Jn@Fd@Fh@FrBTtANx@HdALj@DhALj@H`D\\fD\\LBZDn@FF?nBR|BXH@\\BhALf@DhANdAL`@DdCV^DfALZBb@FjALn@F|@JlANrALVBrBT^DVDx@H`Gn@@@ZBhBRdBR~Gt@xD`@b@DhHv@jBRb@D`D^B?F@VBB?D@B?nBRz@JnCZnCXhCXXBdBRdEb@vEf@fCXrBTjGp@nANvO`BXDhFj@v@H@?x@J`BPpAL~APb@FTBfGp@|AP`AJfEb@lCZvCZrANtAN`AJNBpALB?dAJf@Fz@JD?v@Jb@D|APr@HxANxDb@lBRhD^h@D~@JvC\\r@H`AHrEh@~CZt@H|@Jl@F`@Fp@Fl@Fp@HVDdCVPBjCXr@HXBh@FfEd@b@DnBRv@JH@XBnBTxFl@b@DhALjGp@vANrBTXBrBTXD^DB?v@HfALn@Ff@FzAJfBRpAN~AN^DPBTBXDTB|APbAJhCZ|ANPB^DlBR`@D|BVh@FJ?`I|@r@HpD^t@Hb@FhEb@XDlALtD`@xAN|@Jl@FnAL^DtALRBhCTr@FRB~@Hj@FbAJR@l@FR@j@Fl@DRBTBh@DV@PBV@TBR@RBTBl@D~@Fl@Df@D~@HbCP`AHvALf@DlDZj@DTBfAJfD\\~@Hj@Fj@FPBXBh@FTBTBj@Ff@FVBPB~@JxAN~@Jj@HTBTB~@JtANfALb@DnD`@~@JtAN`AJtAN`AL~@JTBTBh@F~@JTBl@FhBRXBpAN~@Jj@FvAPTBTBf@FVBRBTBVBTBRBTBTBRBR@TDTBTBTBRBVBRBh@FB?bQlBfAJ`@FxFl@dALr@F`ALz@JB?hCXpAL`@DdALbD^dCV~Db@`D\\RBrPhBlJbAj@FvANfBP`ALD?b@F`@Dl@FPBb@Df@FVBj@FLBhAJpGn@bCV|BT`BPrBRb@Dx@HpAN@?L@NB\\BLBnAJxANd@BxAHp@DZ@f@@B?V?P@V?J?F@N?F?^?t@?x@A\\?VARAj@ARANAP?\\CXARARCTATCRATC`@CHATCTCRCTCTCREVCj@IPERCbAQREPCTETERETGREVGTGPETETGRGRGTGRGRGVIPG@?PGTIRIRGTITINGTIPIVIPIPITKRIRIRKPIRKRKJGFCb@URKTMNKRKRMd@Wf@Yf@WRMLGXQb@W`@UXOb@ULITMLIFCPKTMb@WJGHEPIRMz@c@RKNIRMXMt@]h@Wf@URIf@S|@]PGVI`@MVITITGRGRGVIPEVI@?f@ONEn@Oz@UNC^IVEn@MTE\\GFAVENC`@GDAd@Gd@GnBUl@ETCTCTARCRATATATATARAl@Cp@Cd@A`AEh@Al@CzDKhAC`@AHA|@CVAlBEnCIfAEfACLAbDIhBGhACzAGXAtAEJ?^AtAE~@Cl@Ab@CtAEhBEtBGD?|@C`AE|@Ct@A|BI@?z@CdBE~CKpACbCIx@ChFOpBGzBGTA@?@?^A@?@?|GQXAbAEtAE|AEb@ARA|@CrAE@?l@A^CJ?`ACRAj@A`AEh@Aj@Cj@Cj@Aj@CTA`ACRAT?TAtAEVA~@CRA`AC`AEvCInBG`GQ`ACj@APAXA`CGxEOl@Af@CN?~AERAxAEf@AVAl@CTAf@ATATAj@Ah@AbAEzBGdFM|AGtAEb@AvM]\\Ab@Ab@ChFM`FMf@C~BG`BEfACl@Ad@C~BEh@C`ACdAChACj@CfCIxGQx@AXAz@AVAV?~@A|@AbB?jA?bA@rA@b@?r@@h@@H@v@@b@@B?X@h@@R@f@BZ@`ABhAFV@b@Bd@Bn@Dz@FZBl@Dh@DT@j@Fh@Dj@DRBl@Fh@DTBRBVBVDP@VDRBTBVB|@LPBXBTDRBRBVDRBTDJ@D@VDTBTDTDf@HVDTD|@PTBTFRBTDTFRDTDRBTFTDj@JPDh@L`@JH@XHLBRFVFH@r@PPDVFh@LRFTFh@Nj@Nd@LTFTFTFRFTHd@Lj@PRFTHd@NTFh@PRFh@Ph@RRFTHPFRHRHVHPHRFPHVHRHRHRHRHTHPHTHRHTJPFRJRHRHRHRHRJRHRHRJTJPFRJRJTJPHRJPHTJPJRHRJTJNJTJNHTJRJPHRJRJPHTLPJRHRLRJRLPHRLPJRJRLPJRJRLPJPJJFLHTNRJPJRLPLPJTLPLPJTNNJPJRLNJRNPJRLPLPLPJRNPLPLRLPLRNNJNLRLb@\\RNRNNJRNNLPJRPPLNLRNNLTRp@h@PLPPb@\\`@\\ZXDBTRRRj@d@PPZVHHz@v@n@j@zBxBJJf@d@DF`A~@x@z@|@bAdBlBbCpCpB~BRVNPJT~ApBTXTVX^t@`A`@j@p@`A\\d@LR^h@n@|@r@fAn@bAj@x@Zf@NTb@p@b@t@hBrCvCrELR|@vAFHT\\@BhAdBl@|@x@nAl@dA@?vAxB\\j@`BfCx@lAx@nAnApBl@|@T^BDPX^l@v@lAh@x@Xd@tAvBh@x@@@Vb@LPd@t@t@jAnChE`AzA~@xAr@hAXd@p@bAzAdCRXl@`Ad@t@p@`Ah@z@j@x@hAbBj@|@hAjBLPv@lA~@xA^l@dBpCp@bARXHLnAnBFLj@x@Vb@~@vAfAbBRZ\\f@R\\@BV`@LPRZHJ@BHLRZj@~@n@~@v@nAHLJNd@r@nApBV^JNv@lAR\\BDLPzA|BVb@\\d@V`@Xd@lAjB\\h@hAdBd@t@LR\\f@rAtBn@~@f@z@tBbDnAnB\\h@l@|@r@hAf@x@JPFHLRZf@fAbB^j@l@`Ar@hAn@dA~@zAhAdBLTNTv@nAz@rAZf@j@|@n@bAf@v@\\f@z@lAjBjCtAtB\\f@Zf@jKfPj@bA^r@|@|Aj@z@z@rAV^t@fAZd@l@z@\\h@h@x@vBdD`@l@fBnCf@v@Zf@T^b@p@nApBDHHLV`@JPZh@l@dAt@lAf@z@f@~@Zj@f@z@LVj@dAh@bAZj@^t@h@bAJTb@z@jA~BJRFNR^Rd@Zn@p@xAhAdCh@lAd@hA~@tBl@xAXp@n@zA^z@b@bABFn@vAt@dB~@|BVj@fFzL~AvDP`@p@|AXp@FNLZzDdJnAtC`@`ALXVn@p@zAn@|AlArCLZr@`Bx@lBLZj@rALXDHLZBHRb@Rd@FLRd@\\z@j@rAHPP^N^hAlCN^\\t@Pb@@@nEjK`@~@JVHVj@pAxAtDN^h@vA`@dAt@tBZz@Vp@\\bATl@HVL`@Z~@Xx@Vt@JXPl@HT@Df@~ATp@Rp@DJHVHXPn@n@vBb@zAPp@FTRr@ZfAPp@Pp@Pp@HZp@nCVfAFRr@zC^dBTbA@FBFHb@^`BBJ`@pBb@xBVpAd@fCH^Hh@FZ\\nBRhADPNdA`@fCLx@Hf@Fn@T|Af@hDLt@R~AFd@Fb@ZdCNtAR`BNvAFb@B^DVBZJdALrAHp@Ft@@HF|@BXLlAHdABb@V`DVtD@HHnABb@F`A@T@DBd@Bd@Bb@FzABZDbADdADr@Bb@Bz@D`AFdBJbD@h@@`@DbA@`@Bz@@t@@r@DfB?R?NB`BBnA@hBBjB@nBBnD?p@@nA?`ABlABxC?d@@p@DlF@p@@r@@vA@n@?v@@V@p@?\\DtB@j@B~B?n@@H@jA?^@z@@x@BpB@rB@r@?D@j@DbDBzC@pA?L?FDtD?D?`@BjC@p@@dABzABzA?lA@l@@p@?l@@fB@t@@V?p@@j@@~@?h@@~@?\\FtE?T@Z@dA?v@@r@@z@@nB@`A@|@?JDhC@hC@|@@jA@R@rB@|@@z@FzF?~@DvE@r@?F@b@?F?\\@pABdCBjB@^@zA@n@?P?X@`@?H@x@BvC?F?B@rA@dABtC@`A@b@@v@@hA?\\@`@?z@@nA@l@BvBDrD@bAB|A?p@@h@?^@v@@n@?h@@x@?@@h@?LDbD@dC@X?P?b@?DBbCBjA?`@BfB@tBBjC?DJnJ@f@?dABbC@t@@lA@t@?Z@X?\\@p@@pA@n@@t@?x@@r@@jADpF@r@?r@@\\@fB?Z@X?V?\\@X?t@@v@@j@?d@@jA@nA?t@@\\?^@v@@v@@r@@V?\\BpA@fABz@@z@?T@lA@t@?@?v@@lA?Z@d@?p@@j@@h@?^BbA?`@@r@@Z@v@@t@@p@@f@@h@@\\?X@z@@l@?T@^@V?^@V@X?\\@Z@r@@V@V?^@V?Z@Z?V@^@V?X@\\?X@X?\\@V?X@`@?T@r@@\\@t@@t@@lADpCF~E@`A@X@n@?b@@n@@P@x@?^@r@@X@v@@z@?T@b@?T@p@@`@@b@?f@BrABjBBtA?X@j@?^@p@@`@BdBBtA@pABdBBpA?\\?@@l@@r@@Z?^?PB~@DzB?ZBnA@zA@z@@bB?JBjB?LBzADhB@tA@VBjB?X@P?^@Z?N?L@X@p@?t@@^?n@@b@?N@b@@bB@^@rA?T@V@z@?V@L?f@Bv@@p@?b@@p@@`@?X@^?R@hA?Z@X@z@@t@DnABv@?@B`B?JBtA?V@Z?N?V@Z?X@X?\\@Z?X@Z?X@X@Z?X@Z?X@X?V@Z?\\@X?Z@X?Z@X?X@\\?^@T?X@Z?X@X?Z@X?Z@X?Z@Z?X@t@@r@@\\@p@@x@@r@@r@@v@@v@@\\?V@X@t@?Z@XBnA?Z@X?Z@V@x@@r@@X?X@Z@z@@P?\\@Z@X@X@XBt@@t@F|ABbADpABZ@V@Z@XBZ@X@Z@VBZ@XB\\@X@XBX@Z@XBX@ZBX@ZBZBX@XBZ@ZBX@XBZ@XBXB\\@XBX@XBX@\\BZ@VBZBX@ZBX@ZBVB\\@XDp@@P@JBf@Df@@XBZ@XB\\@XBZBX@XBZ@VBZ@XBZ@V@N@JBX@XB\\Dr@@XFv@@VBX@Z@L@HDp@l@fKv@zMLbCLhBDr@Dt@Dt@HjAFjA?PFh@B^@RB`@@P@NBp@Df@B\\Bb@Bf@BZ?B@VDf@HtA",
                      },
                    "start_location":
                      { "lat": 35.1719923, "lng": -111.6528567 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "159 mi", "value": 255609 },
                    "duration": { "text": "2 hours 28 mins", "value": 8886 },
                    "end_location": { "lat": 34.8860896, "lng": -117.0130474 },
                    "html_instructions": 'Keep <b>left</b> to stay on <b>I-40 W</b><div style="font-size:0.9em">Entering California</div>',
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "uc}rEhxiyTB`@BZ@\\BV@XBZ@XDr@@PHhA?HFnAF~@@LD~@@PB`@Bn@HnABl@B^FlADd@Bh@HxA@XBX?LDb@@`@@B@NBZ?F@HBf@B`@@HBf@BZ@TBX@RBb@Fr@Dx@Ft@Fp@?LDd@BZ@XB`@Fx@Dj@Dl@@^Dj@Bd@BVBn@B\\BZBX@XBf@HdADt@?`@HlABh@BT?JBX@HDd@JhBB^B^Bb@Dl@@THvA@V@RBb@Dr@?H@HB`@Dr@@N@TBj@B\\@ZJbBBd@@RF`A@HDv@@VBZB\\@\\Df@@NDn@Dr@?B@NFz@Dv@Db@Bf@B\\B\\Dn@BXHnAFdABVJ~ABd@Bf@HnADt@Bh@NxBBj@@PFt@@Z@RHlADv@Dj@Bb@HvAFhABT?NF`A@LJ~A?JHrAB^BZ@X@?Dn@Dr@B`@J~AFhA@TFx@Dr@?BDt@Bd@Dh@Bh@F|@B`@Bl@B\\B^@PD`A@HJtBBl@F`A@HJdBDx@Dn@@\\HnA@LNfCHpAHlADfA@HDr@@TB\\HnAFnAHjAFnAHlA@JBj@Dp@Dv@Dn@Dt@BXDr@Dr@Dt@Dr@Dr@Dr@Ft@Bh@?HBXHnA@VHlAFnAHnA@THpAFpAFhADv@@JBd@Bt@FlABv@DhA@P@b@@R@^Br@Bl@@`@DdABnA@X?X@P@f@Br@BlA@R@^BpA@fA@X@d@?h@?H@r@@lA@hA?V@`@?l@?`@?fA?pA?V@f@?L?r@?Z?Z?F?L?P?F@r@@X?l@BbA@T@r@B^Bp@@^?LDx@BZ@V?@BV@ZBV@^Dp@Dv@BX@VBZ@X@T@DDp@Dt@NzB@^@RFt@HjANhCFhAVtEBXTbG@VH|C@XFjBBtAD`BJ|E?J@TBjAJvEFtC?ZB`A@Z@^?F?V@^@^?D?X?^?^?D?^AV?DAXA^A^?DCXA\\C`@C\\C^ADCVC^ADCXE\\E^ADCVE`@Eb@E^E\\OvAGb@E^E^Iv@E^E\\?DEX?DEXC\\AFCV?DCXC^Ed@CVCb@AZCd@CZA^A`@AZA^A^A^A^?d@AX?^?^?X?d@?B?Z@`@@tA?J@^@^?^@^?b@@\\@`@@|@@`@?\\@\\@`@?`@@\\@^?`@@\\?^Bx@?`@@`@@^?N?L@`@?\\@b@@`@@~@?V@b@@^?^@`@@\\?^@^?P?N@^@\\?P?N@^@^?`@@Z?^@^@b@?^B|@?`@@^@~@@b@@z@@^?\\@|@@`@@\\?^@\\@b@?\\@h@@T?\\@\\?\\@Z@`@?^@^?Z@R?N@^?Z@`@?J@R?^@\\?`@@^@X?b@@^@`@?\\@Z?b@@^@`@?^@\\?Z@F?\\@^?`@@^@`@?^@\\?@?^@\\?^@`@?^@ZDdB@z@@`@?Z@`@@Z?d@@\\@\\?b@@~@@f@?R?`@@^?^?`@A^?Z?b@A\\A^?@A\\?^C\\?JAVC|@C\\C\\Cb@Gz@Ep@KlAEXIz@ADEb@G^Kr@In@W~ASdAGZELKj@Mf@Or@GTMf@GPCLIXGPK\\Uv@IRUr@Yv@GRO^IPIRO^KXMV[r@OXMXEHIPy@dBQ^MVO\\OXMZMTMXOZO\\MVOXMXOZQ^[n@KVQ\\OZMVMXOZ_@v@Yn@c@~@Wj@MXABMTELGLMTSb@Yl@Sb@A@GNQ^MXMRAFEDIPKVQ\\MVEJINKRQb@A?MVMZKRABOZMXOXMXKRSb@GNA@Q^OZMXOXOXKRQ\\KROXQVOXSZMRY^_@j@e@l@MPY\\MNKLIHUVUTMNSRYVONCBQNSPURWRWTKHIFUPWRMLEBOLEBOLWRIFOLGFMHOL[VOJCBQLCDQJCDOLOJEDUPQNYRUPURUPUPUPEDSPUPQLSP[Te@^URWRSPUPYTIH[TOLk@b@e@^uAfAm@f@eBrAURs@j@gAz@e@^iBxAgBvA{C`CaCjBMJSPUPUPUPURWRSNi@b@YRQNk@b@QPi@`@[TuAhASNURUPUPWRSPUPURWPSPWRUPUPSPWRUPUPSPUPURUPWRSNSPWPSPURWPSPUPSPWRSPUPUPQNGD_At@SNSPUPUPk@d@UPk@b@URUPUPUPUPURUPUPUPSPURUPUPUPUPURUPSNURUPUPUPURSNURUPUPUPUPSPUPUPURUPSNURUPUPSPUPUPUPUPURSPUPUPUPUPSP[VSNSNUP_At@WRULULYLWHWLWNWLUPUNEBk@b@IHKHMHg@Z{@v@MTQTa@`@?@SVW\\UVYXUR{BfBYT_At@cAv@yMlKmB|ASPWPy@p@[VUPc@\\cAx@i@b@qAbAq@h@q@h@SPWPSPWRg@`@WRUPSPSPUNm@f@QNWRUPSNYTQNUPCB}@r@WRSNGFIHWPSPkBxAk@d@aAv@SNm@d@EDMJUNCDQJCDQLUNUPUNUPEBOLWNGDOJOJIFSLSNE@EDIDYRm@^g@XYPWNa@TKFWLWNMF_@Re@V_@PA?ULo@ZaAb@]N]NWLcA`@WJ[LWJQFGBWJUHWHUHa@Ng@NUJa@Ls@RA?gA\\YHWFYHODQD{@T_@HYFYFYFWFYFYFYFYFYHWDIBODYFWFYFYFq@Ns@Nq@NYFYFYFoE`AcGpAeATeATaMlCYFUD[F_@HQDYFWFs@P[FWFYFYFWFYFYFYFWFYFYFYFWF[FWFs@NWFYFYFYFYFWFWFu@NWF[FWFYFYHYDWFgB`@YFUDo@NsAXWFYFYFYFWF[FWHYFYFYFs@NWFYFYFUD]HWFMBKBWFC?WF[FUFOBIBYFYFYF[FE@QD[HYFYFYFWFYFYFYFYFYFs@Nq@NYFs@PYFYFOBuAZYFYFYFq@NWFUDy@Pq@N_@HSDWFG@QDWFYFuDx@_B\\q@NYFWF[FWFYFYFWFYFYHYFYFYFYFYFYFYFWFYFYF[HWFYFYFYFYFWFYFWFYFYFYFWFWDYHYDYHq@NYDWFYFq@NWFs@NWFYFWFYFYFq@NYFiAVG@k@LYFc@HMDSD]HYFOBIBWDeATQDKB[FKB_ARWFODI@YFWFYFQDG@WFYFYFUFC@q@LeAVw@PYFYFYF_@HQDq@NWDWF}Bf@[HWFYFWFeB^q@PMBe@JWFYHWFs@Ps@NWFq@Po@Ng@Jc@JE@o@NWFYFYHWFYFYFWFYHYFYFWFYHYFYFYHUDA@YFWFYFWF[HI@ODWFWF[FKDaCh@iAVaB^a@LMB[FODmAX_B^gAV[HQBC@kAXYF[HUFOBc@Ja@Jg@LUH_AZC@y@V[LYLUHUJYLULWLYL?@UJIFKDUNWNULUPWNUNGDKFWNm@`@UNk@\\WPOJqBpAmAv@OHwA~@}@l@ULEDWNSNUNWPUNUNa@ZGDWTYTONURQR[ZMLKLA@WZSTILg@p@GFQVQVOXOTOTGJWf@]p@O\\OZMXABITKT]|@a@hAEJkA|Cq@jBQb@Yp@MXOZOZKTILEH]l@?@W^MROVQTQVA?ORSVQTQR_@`@m@n@CBSPSPWTg@`@QNc@ZQJc@XWNSJ[RYLSJ[NMDMFSHWHCBi@Pc@PMDWH]LSHA?UH]LOFE@o@TA@]Lo@RQH[JWJUHWJ]LQF}Bv@GBq@V{@Zs@VYJODm@TSFOFWJSF]L]LGBsCbAkBp@cA^C@_A\\KDWJUJYLQJ[PWNWNIHMHa@XIHe@`@EDg@h@QPQTUVEHGHSVKNCFOVQXEF?@ILa@v@GJEFADKPQ^OVWf@U`@Wf@g@|@?BQXABOXEHINMT}@bBQ\\OV_@t@]n@OXMTCDGJGJMVMV_@p@o@nAOXOXOV_@r@MVS\\MV}@bBGLILMVOXaAdBOXKPEHOVo@jAQVOXOTS\\EHsCxEi@~@_A~AS\\CDMRMTQXOVQX_@l@OXGJILOVa@p@U`@[f@u@lA[h@OVOTi@~@{@tAYd@i@|@GJYd@]j@S\\QXeAdB_@l@OTS^MROVOVQXOVQVOVa@p@MTQVS\\q@fAOXOVQVe@v@{@vAm@bAQXW`@MTYf@W`@QVOXS\\MPq@hAQXINABQXSZMTQZMPs@jAW`@INOV]h@cCbECDeCbEgGbKW`@ABmB`DaA`BaA~AeBtCgCfEOVqAvBcAdBg@v@iAnBuA`CqCvEiCjEcAdBm@dA_@n@OVo@dAABQXaAbBOTeAfBqAxBEH[f@_A~Aa@p@o@hAQV_@p@OVc@r@q@hA_@n@eAfB_@n@y@vAu@nAu@pAoAtBMPYf@Yd@a@r@QZsEzHcAbBU^m@bAo@dAo@fAcAdBs@lAe@|@e@z@_@r@Ud@OXg@bACFWj@y@fB]t@Yt@MZw@jBKZM\\g@rAc@nAM\\Wv@K\\Wv@Wx@KXK`@K\\KZ]pAUx@Sv@K^[rAMd@Qt@o@nCS|@o@pCg@zBs@`Du@hD}B`KuAjGsA~F}@~DGXSz@mArFuBdJSz@[tA[zA]zAYpAI^I\\IZ]zA]zAGXU`AGZ]xA_BdHUfAMf@AD[vAUdAg@xBEPQ~@UrAAHG^Kr@G^E`@E`@CVEb@C\\C^IbAA^CZAb@AZA^C~@?ZAbA@`@?~@@\\@b@?\\@^B`@@Z@^B`@B^B\\D^H|@J|@Db@Lx@RtAHf@Px@F\\l@tCLp@Lf@XvAhArFj@pCPx@b@rBZzA|@jEJh@XpA~@rEd@zB|@nE\\`BZxA@FJh@@@Jd@FXBNBNHZ@BJh@Jf@Jh@@?Jf@Jh@F\\BJJf@BHTfA@BVlADRTnAZtAP|@Pv@P`A@@Nx@DVVnAJj@VxAH`@^|BJh@RpA^~BHj@\\xBPtAHb@XvBN~@LfAHj@L~@F`@Lx@D^T|AD\\NdARvAJz@Lz@F^PnANhAXrBPnAPtALx@Hh@BTFb@Ff@l@dEZ|BFb@L`AZzBRvAPlANhARzAHh@Jt@D`@F\\Hf@h@~DLbA@BD\\F\\D^F\\D^F\\D\\F^D^BR@HF\\D^FZD^F^DZF`@D\\F^D\\D\\F^D^F\\D\\F^D\\F^D\\D\\F\\?@D\\F^D\\F\\D^D\\F^F\\D^D\\F\\D^DXFb@F\\D^F^D\\F^DZF^D\\D^F\\D^DZF^F^D\\D\\F^D\\F\\D^F\\D^F^DZF`@D\\D\\F^@LBNF^F`@D\\D^F^D\\BPHh@D\\F`@F^D\\F^@LBPDZF`@F\\D\\F^D\\F^D\\D\\D^D^D\\D^B\\D^B\\B^B^B^B^@^B\\@^D~@@^@^@\\?`@@\\?`@?\\?^?`@?\\?^A^?^A\\E~AA^C^A`@CZCb@C^AZE`@C^E\\C\\E^E^C^E\\G\\E^EXKn@EVUxAI\\ShACLKl@ERs@rDYzAKf@UrAKd@WrAKh@WpACLG^Ib@WrA[|AWtAGXY|ASfAWlAWvAc@zBQz@[fB]hBQ|@Qx@WvAETI^ERSnAOx@Oz@QdA]fCS~AE`@Gd@?@MnASzBIhAOnBEv@GhAIxBG`BA\\A`@E~BCxC?bD?z@@`@?\\@|@B`AD~ADzAF~AH~A@PDp@BTB\\B^B^B\\D^B\\B\\D^H|@D`@D^D^D\\Lz@D^D\\F\\D\\F^DZD^F^FZF\\V`BF\\FXH\\H^BLFVNr@F\\ZxAFZH\\H\\H`@FVF\\J`@H\\F\\H\\H\\FZH^HZF\\HZDTJd@H^FXH\\F\\H\\H\\H\\FZH\\F\\Rz@H`@HZH^FZZxAH\\FZDNLj@F\\HZH^r@dDNr@Nr@VfA^hBPz@J`@FZH^H\\D\\T~@j@jCx@vDt@lD@@Pz@XrAR|@R`A^bBVhANv@v@nDt@jDPz@Nn@DLH`@t@jDXrAT`AtB~JFTn@xCb@rBv@nDv@rDh@dCbAvEhAlFl@rCb@nBBF`B|HLh@VjANx@Pz@P~@Lz@Jz@ZzCTzBLtAN|ALpAPpBJzAFt@Fp@JhAN|AJx@NpAHn@Jv@F`@Lv@R`Ah@jCh@tBBNX`AL`@^vATt@Lb@\\lATx@Tt@T~@Rt@H\\FVJh@FXDVF`@D\\F^J~@Fl@Fj@JtADbADxAB`BBxAB~@B|ABr@@x@@b@B~@@bABfAFnC@nABp@?DB~AB`@D|A@\\B`@?B@TB`@H`AD\\Hr@Fh@Lx@Hj@Nr@Hb@Nn@Rv@HZJ^J^Vr@Xx@Zt@Pb@Vj@z@bBx@`BR^Zl@p@rAx@~AzAtC|@fBXf@Rb@LTPZLV\\p@^r@P^p@rAHNj@fA|@bBx@fB^x@h@lAL`@`@jAd@rA\\hAl@vB\\xAb@tBNv@Lp@DPF`@Jp@RtADd@DZLrAP|AFt@BNBZFl@Fn@J|@Hv@ZzC^tDZ~CNxARxBDf@Dp@HrADjA@\\?^@\\@fA@pC@dA?^@jABdC@fA@x@@hA@`ABbADnAFvAHxABb@B\\Dp@JrAFt@Hv@Hr@NhAX|BV`BNx@Nx@Lv@Px@Jb@Px@VdAH^H\\HZH\\H\\Lh@DLH\\H\\H\\HZJ\\HZH\\H\\H\\HZJ^FZHZH\\HZH\\J\\HZH^HZH\\HZH\\BHDRF\\H\\Jf@F\\Hp@H\\F\\F^D\\D\\D^D\\D^B\\D\\B^B^B\\B^B^@Z@`@@\\@^@^@^@\\?^?`@?\\?b@?\\?\\A^?^A^A\\Ab@CZ?LAPA^C^C\\A^C\\APANC^A^C\\C`@A^C^C\\A^I`BC\\AJAPA^C^C^A\\C^C^A\\C^C^C^A\\C^A^C\\C^A^C^C\\A^C^E|@Cb@C^C`@AZC`@C^C^A^C\\C^A^C^C\\A^C^C^A\\C^C\\A^C^C^A\\C^C^A\\C^Cb@AZC`@C^C`@A^C\\A^CXAb@C^C\\C^A^G|@A^C^E|@C^C^Cd@AZMxBA\\G~@I|AA\\C^KbBAZC^C`@A\\C^C`@A\\C`@A\\C`@G|@A^C^M~BG~@A^C^C^E~@AVCf@C^C^A^C^C^A`@C`@c@tIC\\Cd@CZE|@A^IzAC^C^A\\C`@C^A\\C^C^C`@A\\C\\Ab@CZCv@EdAA^A`@?\\A^?\\?`@A^?\\?^?\\@b@?\\@^@~@@^@^B^@^@\\B^@^B^B\\B\\B`@B\\D^B^D^D\\B\\D^F^J|@DZF^F\\D\\F\\H^FZF\\F^FZF^XzAFZFZF\\@FDPj@|C`@vBf@tCr@tDhAlGVpAz@zEp@rDjAnGh@vC`@vB`@vB`@tB^xBh@vCh@rCbArFF\\FZF\\FZH\\F\\F`@VvAH\\F\\h@vCH^DZH\\FZF^h@tCF\\F\\F^Pz@F\\FZF^H\\FZF`@FZFZF^FZH\\F`@FXr@zDNx@h@rCh@vCJh@BPH\\F\\N|@H\\n@nDjAnG`@tBF^F^FZF\\F\\H\\F^F\\Nx@FZF\\\\bBDTF^F\\FZH^F\\F\\F\\F\\H\\F\\F\\F\\F\\Pz@D\\Pz@F\\H^FZDXFX?Bl@`DLr@H\\F\\F\\H`@DXF\\@DBLdAvFj@zCHj@J`@`@zB\\jBTnAFZN~@H\\H`@DXF\\Hb@@BBPFVHh@FXH`@FZF`@FVF\\@HDRF^BHBNFX?@BHDZF\\FVH^F\\DXFZXzAP`ABNVpATnAH^X~ADPBRDPBJBVFVH^VxAh@rCH`@?DFTFZF`@FXFZPdAJh@Jh@H^F\\BR@FH\\BNBPFXH^Hb@DTLt@BH@HDR@F@@@J@FBJ@FtCxOF^H^FXF^F^jAlGNx@@DDV@DFZF\\P|@Nz@F\\H^F\\F\\Jd@xAfIF\\F\\F\\Pz@F\\Nz@F\\H^`@vBF\\Nv@Hb@F\\h@vCH^FZNz@H^F\\XzAD^FZJj@BRBPHd@F\\H\\F\\P|@F\\FZF^H^F\\Nx@Pz@F\\N|@F\\Px@@DDTDP@D?DJd@j@|CLn@`@|B?DJh@R`AXbBf@jC\\lBRbAPdARdAVpAhDbRXzALp@Lp@P|@VvAP`AF\\RbATnAVxA^nBRbAN|@BHVvARdAJj@Jh@`AnFNx@ThATpAVpA@DHd@^rBX|AH`@FZXbBJh@F^TlAH^P`ANt@Lr@P`ATjAJh@ZdBRfAJh@Ll@d@jCd@fCNv@F\\H\\F\\DTBRLl@p@rDVtAN|@F\\Jh@Jn@N`AFb@Hr@LjAN|ADj@Bd@LjBDpAF~A?ZBv@?`@?t@?bA?`@?p@Ah@Al@Ax@Cp@Cv@Cr@Ch@AZ?@Cf@GbBAd@mAr]Ad@aA|XEjAQnECbACj@Ch@Cj@E~AGzAAXIvD?r@ApB@z@?N@\\@hABf@@p@@XFdA@TDx@F`AL|AHt@N~ARvABX`@fDNfA?Bf@hEDXD`@D^BNTrBJfA`@zCNx@PrAJ~@LhAT|BDd@Hp@HjAH|@FbAH~@F~@Dp@@R@TDX@PJ~AB^B^B`@B\\BZBb@F|@B`@B^`@lG@PB`@B^Dz@Dd@B^B\\L`CB\\B^B\\@^B^B^B\\J~AD^B^B^B^@XDb@@\\B^BZBb@B\\B\\Dp@@ZDh@Bd@B\\@D@VB\\D`@B\\B\\@\\B^Dh@FdA@RB\\B\\B\\B^B^B^B^B\\BXB`@@XLfBB\\B^@^B^BZN|BB`@B\\Bb@BZB`@B\\Dz@B^B\\B^B\\JzAF~@B^B\\PpCBf@B`@Ft@Bh@BXB^H|AVzDB`@B^B\\B\\B^B\\B^B\\B\\B^B^B\\B`@B^B\\B\\B^D~@Fx@Bb@BXB^@^B\\B^B^B^B\\F~@B`@BZB^B^BZ@\\B^B^D^@\\B`@B^BZBZB`@B^B^B^B\\@\\Db@Bf@Ft@B\\@\\B^D`@Bd@Dt@B\\B^B^B`@B\\F~@B\\B`@B\\@PXjEF`APvCR~CN~BNvBTzDNdCd@vHV|DN|BB`@N~BJ`BN~BDj@LjBBb@@ZDj@Dn@JtABj@JtAN`CVdERvCVfEd@lHBb@TnDHzAJ`BZzEJrABl@HfA\\pFv@hMR|Ch@bIP`D~@~N|@tNlBlZrArTNzBZzEb@`HR`DNxBJfBB\\B^x@rMb@`H`@pGJhBj@xITzDb@bHv@zLVzDV~Df@vHB`@F`ALnBBd@HbAHnAHrARzCR~CT`DFz@L|BVvEHxAJvAFbADr@Dj@JxAF`AB\\Dx@R~CV~DFv@Bf@NzBB^JxA?DRvCRbDHrADh@Dt@PfCDv@JbBHlA?FPfCJ|AF~@Dt@FfA@DDj@?DZdFn@vJF`AXtEV|DDl@HvAR~CL`BF~@PxCRbDd@lHV|DRbDHrA@L?BBXBj@l@xIBn@Dh@JvARbDNbCH`AH`BR~CFx@BXHrA?FLjBH~Ab@zHRlDFnABj@FrA@LHdBB^HzAFpA?JN`DP|DFzA@b@B\\H~BB^F|AHfCFxABj@XlHHxBHxBJjCHbC@HDnAZfI@\\DdAFxAF~AJjCHlBBr@^fKZpI@TJfCJfCLlDDnA@ZJ`Cd@rLZ|IDdAHvBDjA@^HlBPpEF~AL|CH~BL`DL|CD~@HbC@\\LvCL`DRxFNvD?TPhEBf@DjADhAnBxg@@j@FhAF`B@`@Bt@Bj@f@|M@LFfBNtD@b@N|D@NFdBFbBB`@RjFLhDHzBDv@B~@D`AF~AJ|BP|ETxFDlA`@fKJxCJpCd@zLRtFXzGF~AH`CDz@R|FP|EL~CFtANdEDhAFtABn@RhF\\|ILhD@Z@XDfAB\\@Z@\\@^BX?D@^@\\@RBj@XpHVtG@X@^@\\B^@\\B`@?R@H@\\@ZB^@`@@ZB\\@b@@\\Bd@Bv@@R@P@^Dv@Bf@@Z@^B\\@\\@^?B@XB^@^@VBh@@`@@\\@\\B^@^@\\B^@^@^B\\@b@?@B^?H@R@V?DBX@d@B^@Z@`@@H@R@^Bd@@\\@^@T?FB^@\\F~A@^B\\@^@`@B\\@V?HFxA@`@B^?F@V@^Bb@@^@X@ZB^D~@@`@@\\@V@F@^@^Bf@@VBb@Dz@@^@\\B^@b@@\\B^@\\@\\B`@@^@^B\\@b@@ZB\\@`@@\\B`@@\\@^@^B^@R?JB`@@`@@T?BB`@@\\@ZBf@@X@^B^@`@Bn@?JBf@@VB^@^@`@BZ@b@@\\@L@V@VBf@@V@b@@XB`@DbA@T@X?JDz@D~@@f@@VB^B~@Dt@?J@\\B\\@^@XDhAFvAHlBD`BBr@BbA@^@X?^B|@?^@x@?J@^?~@@^?^?^?Z?D?tA?f@?X?^?d@?^A\\?^AX?^A\\?Z?DA^A`@?\\Ab@Ab@A`@A^C~@AH?LAFA^A^A^AXCd@?BCZA^AVEf@A^C\\A^CVA^AFANCf@A^C\\AZABAb@ABEf@MbC?LAXCd@AX?HC\\AXCZC`@A\\AFAVCd@AXC\\Cf@A^CVA\\Gz@Cb@A\\C^Cd@Ex@Cd@Ex@C^I|AE|@E|@GrAEh@G|AG~@E~@C\\A^C^C\\?JGpAC^C^I|AG|AC^IzAE~@C^AX?DC\\C^A^C\\C^A^C^C^A^C\\C^A^C^Cb@?HAPC\\C^A^C^A^C\\C`@Cd@AVA^C\\C^A^C^APCj@E~@A^A^C^A\\C^A^A^A^C^A\\Ab@C\\A^?@A\\A^A`@A^Ab@AXA^A\\A`@A`@AZA^A^Ab@A^?@AXA^A^A`@?\\A\\A`@Ar@Aj@AbAAz@A~@?b@AZ?^A^?`@AZ?F?XA`@?^?^A^?`@?\\?^?ZAj@?x@?|@?`A?~@A~@?z@?`@?^?N?TAV@`@?d@?v@?`@?`@?z@?b@?x@?`A@|@?`@?\\?|@?b@?V?@?b@?`@?^?|@?`A?t@?n@?x@?`@@b@?X?j@AR@~B?tA?H?^?`@?b@?X?^?@?^?\\?b@?Z?`@?\\?^?`@?\\@`A?b@?R?J?v@@`A@`AB`A@^@v@Bd@@\\Bx@B`AD~@F`AFz@B^@PLlAHz@NxADb@B\\BLFj@D\\D^D\\F`@Hx@F`@F`@DZN|@Hh@Lp@F^F\\BLRfAP~@BHDRR|@FZLh@Nn@H\\T|@Pv@HZH\\J^FZJ\\H^HZH\\H^HXH^HZH\\J^HZH\\H\\J`@H^Pt@H\\J^H^FVJ\\H^H\\HZH\\J^FXH\\T|@XjALj@FXNp@Lh@H\\H\\F^VjALn@Nv@Pz@N|@F\\F\\?@F\\F^H\\F^DXHb@N~@ZxBF\\D`@FZBT@HF\\Db@DXF`@DZD^F`@Ht@Ff@D\\F^D^D^F^DZD^D^D^F^D^D`@F^BXF^D\\D`@F\\Db@DZ@@D\\@LHj@D^F\\D\\D^D^DZD\\D^D^D\\DZD^DX?DD\\D^D\\J~@F`@BXF^@JBRD\\D\\F`@D\\D\\BP@JD^F`@Jz@D`@D\\F`@D`@BRFd@F^D^D^D^F`@@JBND^D^Fd@DXD^D^F^BR@NDVD^F`@D`@DXD^D^F^D\\@LBPD`@DXF`@D^D\\D^DZD^F\\Dd@Jt@D\\D\\F`@BZF`@DZD\\D`@DZD^D\\F^D\\D\\D^D\\D^F^D^DZD^D\\D^D\\F\\D^D^DZF^DZD`@F\\DR@FF^F\\F\\F\\F\\F\\H^DRBHH\\H\\H\\H\\HZJ^HZJ\\J\\J\\JZJZJ\\JZLZ@FHRLXJZLZ?@LVL^LVLZLVNZNXLVLV^r@n@jA`@p@T`@Xf@^n@NVNVLTPXLVPXNVNVNXNVPXLVPVLVLRT`@LTLVPZNXNXLXNXNZLXNX\\t@NZLXLXN\\NZJXNZLZLZLZJX@@JTL^L\\LZLZJZLZJXXx@JZJZJ\\LZ@FHTJ\\JZTv@J\\HZJ\\H^@@Tx@HZHZJ^Rx@H\\HZDPNl@H\\H\\Lh@DRRz@T|@Px@V~@Pv@V~@J\\Pt@Tx@H\\HXRx@H\\HZH\\J^H\\FZJ\\?@H^HXH`@HXH\\H^HZJ`@Pv@HZVbAFVPx@Px@Rz@R|@H\\H\\HZTz@Rz@J\\H\\H\\Pv@T|@H`@HZT~@Pr@FZ@?Hb@Rt@H\\Pr@@HJ^Jb@Pn@H^Tx@Rz@H\\J^Pv@FZH\\H^Rz@Tz@T|@Rx@Jd@Lh@Ld@FVJb@HZH\\Jd@FVT|@FXJ\\Px@Tz@H\\HZH^T|@H\\FZJb@Rr@H`@J^FTH^H^J\\FXH\\J^H^H\\HXRz@H\\H\\J^H^HZH^DLJd@J^H\\H\\H\\J^FXT`AFVJ\\H\\H\\T~@H^FTH\\J^H\\H\\H^J^FVDNBLJ^FZLb@DTJ^H^H^HZH^HZH^J\\H^FVH^HZJ\\H\\H^Rx@HXH^HZH^HZH\\J`@J^FVH^J^FXH\\J\\H\\Jb@FVJb@HXH^HX@DHZFXH\\H\\J\\H^H\\H\\H\\H\\J^Jb@DTBDFVH\\H\\\\xATz@HZH\\H\\FT@FJ`@J^H\\H\\Nd@Pp@HVLb@JZFVJZLb@HXJVJ\\JZN`@?BHRJXL\\JZDJDNN^JZJVLZLZBFFRLZLX@@JXN\\LXLXLZLXJRBFP^LZJRBFLVNZNXLXJTBDJRNXDFJRLVR^JRBDJRNXNZNVNZR\\DJDFNXNXNZNTNXLXPZPZJTPZLVBDJRR^Zl@PZLVNXNZ@@LTLXNXXd@x@~AfAtB`AhBr@rAjAzB|BjEpAfChAvB`AjB~@hBPXf@bA`@x@NV\\t@f@dA\\t@d@fAh@nAZt@N^Xr@FPJXXv@N`@Xz@L^JZd@rAb@vA`@tA`@tAV~@j@vBFRTx@Nh@DPL`@X`ADR`@tA`@zATx@bAtDz@~CLd@|@~CvB|HnBhHbBfGhA`E^tA`@xAfAzDhP|l@Ld@bN`g@J\\vBzHrMve@JZV~@d@fBl@xBp@`CbArDl@xBl@xBl@xB`@vAh@nB`@xAh@nBv@rCj@rBb@|An@~Bf@fBf@lB`@tAt@pCb@~An@zB^tAt@nCr@hCn@|Bb@zA\\pAj@rBTz@`@vA^tAT|@f@fBb@~Al@vB`@vA`@vARr@VbA^rA^pAV~@r@fCd@fB`@vAHXJ^FTlAnElAlE~@hDr@fCNf@xAnF\\lAtEtPjAjEv@pCV`A^tARx@Ll@Lf@ZxAH\\F^Pz@VrAX`BPdALt@Jp@VjBJ|@NlA@FDb@D\\NrANhBLxAB^HbADz@D`@@ZB^FbBDdAF~AFzBFpFFtBDzBDpC@~@B`BB~AD|BBpABnA@~@BdA@`@BvA@~@@dADvBBbADzCD~BFbED~BP~J@^DzAB|@B|@B\\DbAFzAD`ADdAD|@LtBDd@N~BT`DBVFz@B^JzADf@Ft@Dh@Fv@TxC@DDh@PpCP~BPvBDd@BX@N@PBb@PxBJ|AFr@HhAJvAJvALbBF|@LzATbDT~CL|ANzBTrCHlAVxCLhBPfCPxBNvBZdELjBHbAFx@P|BBd@LvAFz@HhADd@RtCH~@F|@TxCF`ADd@PfCJjAHfAF|@Ft@NjBF|@F~@PbCRbCDr@H~@TbDFv@Fp@Dn@B\\@LFx@XrDBZLfBPzBJxAP|BHhAJrAHbAJvANzBRnCNfBJrAP~BN|BPvBDd@LdBJvAJtARpCLfBLhBJtALfBJpA`@dFR`C\\zENrBB^RtCJnAL~Ar@~JN~BNxBFnADpAJbCFvCBpABjB@lA?T?^?X?L?r@?xA?ZAp@Aj@AxBIdE?f@IbFEbDUxPG|EExDCz@A`BAt@?n@A|@@h@?r@B|@?^DzADbADr@FhAH~@B^Hx@Dd@JdA\\xCHn@BLBZJ|@Hp@Ht@Jt@J`AJx@Hr@LpAJfAJpALzAF~@J~AFbA@XHbBBb@D`A@\\H`CB^DfAHtBFbBBl@F|AHnBBdAL|CFxAN~DJ`CFbBLdDD|@Bd@Bf@Bj@?@Bv@Dp@@d@Dj@DlAFjABh@Bj@RxEBj@FtABj@FtAFvADx@@RF`A@h@FrAF|B?@FzAB^FxBJbCFrBHlBPrGJvDHbD@x@BbA@^FxBB~@F~BJxE@b@B|@B`ADtAHfC?P@NFjBB`AJrCFhBDdB@b@@V@`@FjBBn@B~@JpC@r@FxABdAD`AB|@BbADnABj@F~BD`A@`@FjBRhH@P@`@JzCRvG@b@B~@FnBBh@?VD~@FpBB|@D`A@^D`BDzALzD@\\PxFR`GB`AD`AL`EB|@@`@@\\B|@B^FbCH~B@^D|@@`@D|@@^B|@B^Bz@DbADzABt@B`@DvAFtBFrA@TB|@Bt@@XBt@Bx@DlADbBDnADlABr@Br@DpA@\\DjAFhBBv@BdAJrCFtBBz@DtABx@j@tSNvF\\|LF~AB`ADx@FbCFdB@\\B~@H~CD`C@^@bA@j@BbA?ZBrA?Z@vB?jB?lA?lC?jCA`@EbLG~HAhAA~CCzD?`@AbBA`AA~BA~BC`DA`CC`IA~@?~@A|@AbAC`EE`IC`EC~CC`HC`EE~HEbHE`GGxEG~BE|@G|AE~@K`BI~AKvAQ|BWzC]xDYxCYxC_@zD]tD[|CUbC_@xD]rDW|CQ~BUvCMxBKdBGzAI~AEz@EzAGbBG|BExAEbCG~CIxEIzEE~BE|BE~BC|AC|ACbBIvECbACxAC~AC`AAx@EbBGxBG`BKxBSbDKxAK|AMzAU~BQ|A]rCS~AUzAc@vCkAjGm@vCe@tBo@lCg@vBy@pD[xA]vAy@pDkAhF{@rDaAjE{@tDcCrKy@lDo@rCI`@IZ[tA[xAOz@Qx@GZGb@Q|@UrAGb@Mx@G`@G\\EXE`@G\\Gb@EXE\\E\\EZE`@K|@C\\QzAE`@Gx@I|@I~@C\\Eb@CZI`AIx@Iz@QzBS~BMxAS|BO~AM`BMvAY|CQxBSzBM|AWxCO`BS|BSxBM|A]zDMxAO`B]fEMpAYdDYfDIdAgAjMq@zHW|CEb@MxAO~AKfAANI`AGx@E`@CZI`AWtCEb@ADoAhOI~@WpCGr@KjAAPKbAGx@WzCA@Eh@?BSzBC^It@KrAI|@APE\\CTEj@CZC\\A@?BCRS`CC`@E`@OfBIt@KjAIhAAHCTC^E\\ALE^Eh@Eb@E\\E^CRGh@E^CR?BABM~@E^EVQtAKl@EXStAI`@Mx@ADOv@Mn@AJc@|BOp@Q~@G\\Q~@ENEVMh@Kl@UlACJI^Kl@GXOp@G\\CLG^a@`CW`BOfAAHUhBKx@SpBMnACb@Cd@CZC\\G|@C\\Gv@EfAE~@ANARG|ACx@?RAN?\\AXAb@?^A^?VA`A?V?R?T?T?dB?T@r@?^?L@f@B~AF|B@^B^@X@b@@NBl@J|A@VBf@BZH`A@TNfBBRVfCBTNnANdAFb@Jr@Hl@Lz@RlA^rB`@nBFX\\zAFVR|@|@fDl@rBLd@l@xBtAxETx@Nf@d@hBTv@Rv@J^ZbADNDPBHTz@HZFRJb@Jb@HXFZPp@T`ABLFRDRH\\Lh@VhALn@FVFTNv@R`AH^ZxADVR~@FZLp@PdAP|@FZF\\F\\FZHh@b@jCHb@PhAJr@Jn@Nt@PbAF^DZDV^xB`@hCfAvGP`An@|DHb@b@nCF^F^D\\Jx@Fb@@HJx@Jt@LfALpAB^Ft@Dd@BTBf@B\\@TBp@@VB`@Bt@D|@@\\DlABrA@zA@jA?`@?h@?n@?rBA~@?j@?|B?tA?hA?VAX?n@?z@?xB?d@Az@?tB?rA@jB@nB?n@DjD@zAFjDBvAFzBDpADtADbAJrCH`BBf@D|@Dt@HbBJlBBVF|@Dz@HdADl@J`BJbBVtDR~CRzCDd@B^TlDJdB@FBb@@LNvBJ|AFhAD`@@RJzAR|C@N@XRvCLjBBb@@NF|@LpBVtDHvABZJrALpBTfDPlCTtDX~DB^N|BDn@B`@XpEDl@\\|E`@pGNzBHdALvB^xFZvEHdADp@FdADd@XnENvBRnCF~@B^B`@LjBThDDb@BXB^B^B\\B^B^B\\B\\B`@B^Bf@LrBF|@N~B@?Bj@LfBBX`@dG@Z`@|FXnEj@~IBRBh@Dj@j@xIDh@B^VxDDf@@R@XBND~@Dp@@TBT@^@TJtBHxCDbBDlC@jBBvBBjA?d@?DB~B@XBnC@p@BhCDlC@x@@bB@|@@hA?V?Z?n@?p@AT?TATA\\?B?FARAl@Cf@Ez@CXEd@?DI~@CTAHC\\In@Gf@ADIl@Il@G\\GZId@EVI^ERK`@Kf@WlAQr@Kd@ETMf@Mn@Qr@]~AGXMl@I\\G\\Mn@If@EPIf@E`@G\\APAFM~@I`AE\\Er@Gt@Et@Cl@Ct@ClAAh@?PAd@?xA?h@@n@BlABp@D`ABb@Dr@JpABXFj@Db@DXDb@Jn@BVF`@@DLp@F\\Jf@F\\DPDPDRFXJ^FXJ`@DLLd@`@xA?@HZ`@tAZfAh@pBZjAZhA|@fDd@`BV`AT|@r@hCt@jC^xAx@zCPj@Rx@JZH\\Tx@J\\FXVz@HZNn@Lf@FXJb@Nv@H`@FXF^BNLt@BRF\\D^Fd@Hl@Fd@BVFh@BZD`@HbADn@Dx@B\\Bh@@X@`@DtA@Z@n@@pB?dB?b@A^?RAh@A\\C`AARCj@A^Cd@I`BM`BQ`CM|A[zDM`CCb@A\\C^ATAh@Ax@AR?l@?P?l@?^?~@?^@^B|AD|@@Z@`@Dr@Dr@Dv@Fn@HfALhAFd@RzAZvBJp@F\\?BBLPbAL|@DTJh@Lz@DV@BF^DVNbAPdALv@p@dEPdAF\\F^F\\@LHd@?BFb@D\\D\\D\\Db@Ht@NxBHnAJlB@n@FnB@bA?vB?lACnAC`BGlBANCZEx@?@C`@AFG`ACR?FE\\E\\CTAHEXE^CPAJG^E\\AHERE^G\\?@GZG^GZG\\G\\G\\A@GZG\\G\\G\\I\\G\\G\\G\\G\\I\\G\\G^GZG^I\\CNCLG\\G\\G\\I\\G\\G\\G\\EVADG\\G\\EPCJG\\G\\G\\G\\I^G\\G\\GX?@G\\G\\G^GZI\\EXABG\\GZG\\G\\G\\I\\G\\EVADG\\G\\G\\GZI\\GZG\\G\\AFGVG\\G\\YxAG\\?@GZOt@ADG\\ADEVG^GZA?G\\AHERETADEVAFIZ?BGXI`@GZCLENGV?BI\\ADGVEPCJI\\GZCHEPK\\I\\IZCNELIZ_@vAKZIXGRCLIVK^KXK\\KZELCLMZIXKZABGNCFK\\KZMZITADKZMZKXKX?BMZKXK\\KXM\\KVM`@KTKZGNCJM\\KZKXMZKZM\\KXMZK\\KXKXKXITEJKXKZMZKZKXM\\KZKXKZMZK\\MXK\\KXMZKXK\\o@jBMZK\\MXKZKXMZKXM\\KZKVKZM\\MZKZKXKZKZMZKZKZK\\IVM^ABIXIZKZI^IVIZI`@IZIZGZIb@GXG\\G^G\\G^GZG\\EZE\\E\\ADEZEZE`@E^E\\C\\E`@CZC^C^C\\C`@C\\A^C^A^A\\A`@A\\A\\C`AAz@Ad@?Z?~A?T@h@?Z?b@?\\?\\?^@b@?^?\\@^?^@^?^@\\?X@jA?~@@n@@dC@z@?\\?^@`@?R@fA?`@?^@\\?^?\\?b@@|@?\\@^?b@?\\@^?^?\\@^?^?^?^@\\?^?`@@b@?X?^@`@?^?\\@\\?^?^@b@?Z?^@^?\\?^?^@^?\\?^@^?^?\\@`@?\\?`@?\\@\\?`@?`@@Z?`@?Z@`@?\\?^@^?^?\\@^?^?`@@\\?\\?^@\\?b@?\\@^?Z?`@@^?\\?b@@z@?^?\\@`@?\\?b@@Z?b@@x@?`@?^@\\?`@@|@?^@`A?\\?^?^@b@?\\?`@@Z?^?`@?Z@^?^?^@^?\\?^@^?b@?\\@Z?^?`@@^?\\?`@@\\?`@?\\@^?^?^@\\?\\?`@?\\@\\?`@?Z@^?`@?^@Z?`@?\\@b@?f@?n@@^?N?N?^@X?B?^?\\@^?F?V?^?L@P?\\?^?T?H@^?\\@f@?bA?R@b@?X?`@@\\?F?V?^?\\@??^?^?^@\\?^?^?N@N?d@?X@^?^?\\?^@`@?b@?Z@Z?T?H?^@^?Z?`@@^?\\?B?Z@`@?b@?X@`@?\\?^?`@@^?^?^@`@?\\?P?L?`@@^?`@?D@`A@`A@t@?^?^@^?^?\\@^?\\?^?N?L@^?\\?H?N?D?Z?H@V?\\?^?\\?D?X@^?^@~@?\\@|A?^@^?^?^?\\@^?`@@\\?\\?@?^@^?^@X?D?^?f@@T?X?F?\\@^?\\?^?^@^?^?^@\\?L?N?^?V?H@^?\\?^@n@?N?\\@X?D?^?H?T@^?^?F?T?`@@H?R?^?^@\\?B?Z?`@@P@rA?~@@~@?|@@^?^@~@?T?f@@~@@~@?~@@~@@|@@~A@zB?`@@~@?\\@`@?^@^@|@?V@f@@z@@b@@\\@^?^@\\@^?@@\\@|@@`@@^?^@N?N@^@^?^@^@^?^@Z@T?^DfB@`ABp@?L@~@@~@D~B@^@^@~@@^@~@@n@@|A@h@@|AB|@@t@@l@DfCDdBLlGBjBHbDNjID~BB~A@|@@f@@^BhA@t@?B@Z?^B~A@F?T@^@^DrCBjBB~@@`ABt@BxA?D?^@R?JD~B@j@@T@~@B~@?^?F@X@~@D~BDhB?ZBz@?@B|A@^@v@?FDzB?D@^@|@@^@^?X?D@^@^@~@@XBhB@b@@~@Bx@?D@~@@\\@T@bA?DFxC?DF~CD~C@^@^B~A@~@@^B~@?X@d@B~@@~@@X?d@DbC@X@^@z@@b@@^?\\@@?^@N?N@^@^@`AH~E@V@`AD~A?`@@Z?NBp@@~@B|AB~@?`@Bh@@pA@D?XB~@BtA?H@~@BbABzA@dABx@@`AF|B?`@D`B@|@@b@@h@?X@`@@Z?d@@b@?Z@Z@Z?X@f@@^?^@`@@x@@d@@r@@N?\\Br@?V@hA?b@@\\?b@?\\?Z?n@?n@?l@?\\AZ?Z?DA\\?XAz@Al@AZA^A^EtAAf@A`@A\\A`@Ax@AHAb@Ar@IxBIrDA\\Ap@A`@Ab@AP?`@C`@AbAGnCEfCAd@IfDGdDE`Cg@nVMlGWbMM|FQnIU~JAh@OnHg@rVAh@UxK]xNAx@EvAAb@A|@C~@AXAb@A^AdAEzAC|@A`@AbAE~ACz@?^Cl@Al@A`@Ar@Af@A`@Ab@AZ?\\A`@A\\A^A`@A\\?\\A`@A`@Ab@Cv@?^A^A^A^G|CAd@AXC`BIpCE`BEfAA^GzAA`@C`@G~AIzAEbAG~@I`BGx@AZG|@E|@C^Ed@Ex@MzBARMtBGv@Ez@IvAIhAQzCEz@KbBMzBIpAIlAC^MxBG|@GdAOjC?Hk@jJGfAMnBUpDUvDKjBGfAIpAWhEWlEMzBKdBIzAIdASzCI|AM|BObCWpEMtBKpBO|BGbAG~@E|@Ep@GhAMhBI~AKfBIdAIjAIvAGl@C^KlAIt@KdAE`@In@MhAQvAKx@EZM|@QfA?BKv@U|AQnAUxAM|@Kp@SzA[zB_@hCQjAU`BKp@M`ASxAO|@M`AM~@Kp@If@Ih@e@hDKv@G\\SzA]|B[|BQjAKv@Kr@[zBSrA?BObAMv@M|@SvAIp@M|@Kp@EZYrBO`AEVGf@u@hFc@|C?@[rBCPWlBIf@StAGb@Il@Kp@Mz@SxAM~@QhAKr@k@dEOfAG^OhAKj@CPCTKt@Mz@Id@Eb@CHAFGb@Kt@Gf@EVCJEXM~@WdBOjAWfBObACNa@pCYvBUxAMv@O|@SlAKf@CP[|AMn@GXEPYtASz@Ol@I\\Sx@Ol@W~@GVMd@Sr@K^AF[~@Ut@Of@Wt@Up@c@nA]bASf@Qf@c@fAs@fBk@tA_@`ASb@[v@Uh@Uh@[r@Ul@qA|Cc@fA_AzBWn@kBnEc@bAABa@bAUh@[t@e@jAwAjDUj@Sb@o@`BGJk@xAWl@]v@[x@Uh@cA`CYr@Wj@Yr@O\\Qb@IRCHUh@c@dAi@nAUj@Uh@CHSf@[r@Yr@Yr@]t@Ul@AB[r@Wp@Yr@[t@Uh@]x@[v@Yn@Wn@Yp@_@|@a@`A[t@Wn@ADYp@Uf@Yp@e@bAQ`@]r@k@jAUb@MTKTYf@]n@Wd@q@jAs@jAgAdBYb@q@fA_@f@W^SZMPU^_@h@u@dAo@`Am@z@gA`Ba@l@[d@w@jA}@pAKNe@r@m@|@yAvBg@t@q@bAc@n@a@l@g@r@s@dAg@t@k@z@SZSXQVMRMNSZSZSXSZc@n@KNo@~@s@dAgA~Ai@x@_ChDU\\i@v@g@v@}@pAg@t@aClDKNiBnCgBhCeA|AU\\oAhBiAbBkAfBiA`BoAjBgA`BmAfBmAhBEDk@z@a@l@c@n@[d@[d@i@v@_@j@W^W^U\\Y`@S^U\\INQX]n@U`@S\\Yj@Wf@e@`Ac@bAYp@Q`@Qb@IRITSh@O`@ITITQd@GPCJGPADADM\\K`@Oh@Sn@IZIZOl@Mj@Md@GXKh@Ol@G^I`@Kh@Mr@QfASvAKt@G\\[xBGj@O|@AJKt@[xBKp@Gb@WjBOdAc@|CWdBCVaAvGIp@]|BUzAMdASrAMx@M`Aw@rFCLGh@ObAo@rE_@hCSrAi@tDm@hEMx@i@xDg@nDUbBG\\]bCWjB]~Be@hD_@dCWfBWfB]dCeApHU|A_@pCSrAIn@}@lGU~AQjAYvBs@|Eq@xEs@dF}@jGc@~CuArJ}@pGo@pEOjAo@nEYrBObAEVStAU`B]|BU|A[|B[|B]bC_@jC]~BOhAIt@Kz@Il@Ir@MpAMlAGn@Er@KlAEh@ALG`AG~@AZC\\Cb@C`@CZCb@C\\C^E~@C`@GbAC\\Gz@O~CC\\A\\C^C`@C\\AFEt@C`@A\\G~@G`AMzBK`BMvBI`BG`AG~@A\\E`@E~@C`@IxACb@G~@I|AC^C`@C^C^ATEf@A`@C\\Gx@Cf@IzAG`AG|@q@`LEz@C`@C\\C^A`@K~AEz@G~@C^C^C^E`AC^G~@CZC`@A^C^C\\G~@MfCKvAI|AG`AE|@G`AC^A\\ABA^CZC\\Q`DIzAK`BO`CU~DI~AK|AE`AOxBCj@G|@Cd@Cn@Ed@Ev@K`BEdAG`ASrDGbAEz@AJCn@InAK`BGnAOfCMtBM~BC`@E|@QvCKlBGbAGdAGz@ANC^IrAEz@IjAQdDIpAIbBIjAKjBOhCANGnAY~E?@CZALK`BGhACf@G~@OjCU|D?HARK|AE|@G~@C`@Cb@KfBCZARCb@CZCl@En@Cd@CZC`@A`@KzAIzAKbBKlB?@IpAIvAEx@G~@GjAOjCABGpACd@GhAAHC`@SpDEh@A^ALC`@InAE~@O|BCp@IjAA^C`@C\\C\\C^A^C^C\\G~@E~@C^Ez@Ef@MxBEz@Ej@Gp@C`@It@C^MhAEVE\\CTIj@Kn@AFABMx@UnAShA]lBKh@a@xBKn@CLi@|CKh@Kl@yAdI{ArIs@|DMr@Kh@Oz@aBnJgAdGq@tDWnAa@xBI`@EVIb@GVId@ETId@EVG\\Ib@G^I\\G\\EVG^Ib@G\\EVId@G\\GVIb@G\\EXI`@G\\G\\GVId@G\\GZG^I\\G\\G\\G\\EVI^G^G^GZI`@EVIb@G^EVADI^Oz@G\\GZG^EVId@GZG^G\\E^EVAFE\\CVGd@E\\C`@It@E^Gb@C^EVEf@E\\E^CZE`@E\\E^CVE\\Gd@ALAJE^U|BGn@OlAUzBIz@O~AQ|AIt@MhAEb@CXCTE^CXEZMnA[xCI|@WzBGp@MnAWdCMnA]bDCRg@~E]fDOpAGl@Gp@Q|AIr@QlBUtBE\\I|@Gd@CXE\\MtAE\\CTMpAQ~AOxAO|AQzAI|@K~@Gp@Gj@K|@Ix@Q`BGn@In@Iz@OvAQ`BK`AI|@E^K|@MnAQlBKz@U~BQ|AO~AK`AQzAGl@Gp@E\\a@xD[~C[|CMjAIr@_@|DSdBSrBSjBGn@QxAU~BQ~AWzBMpA_AdJg@`Fm@`G_ChUyB`TGh@ObBQ|AIz@K`AQ|A?FOrAEb@EZI~@QzAOxA?BK|@O~AOtAEh@E\\K~@U|BK`AK|@U|BCTU|BK|@Ix@K`AK|@O~AKz@I~@Q|AK`AIz@K~@I~@Q|AO|AQ|AI~@Q|AGn@E`@SjBQ|ACZKbAO|AQ~AO|AQ~AIz@K`AUzBQ~AANUvBOrAI|@K~@K|@Ef@It@K`AANCLg@|EgAxK_BpOsAxMKbASnBWfCQ~A_@pDWdCWjCCVk@pFWfCCTE^Eb@In@Ed@K`AAHSrBE\\QbBOzAE\\K|@Iv@Ef@Gh@e@tEE\\C\\EVIx@MlACZIr@MjAC^K|@E^OzA[vCy@`I[`DOvAIt@Gh@C\\E^W~BUzBO~AAHABE`@I~@WjCMpAE\\Ej@MhAO~AK`AY|BGd@OzAEb@K~@K~@K`A?BIz@Q|ASvBGf@[xCO|AKhAOlAGt@UrBGr@OlAGt@A@KhAIn@MvAMhA_@xDQ`BQbBMlAK~@Gn@Gl@Kv@C^E\\QbBSdBe@lEKx@E`@I|@O`BIx@I|@CX{@dIE\\O~AK~@E^E^E`@_@zDE^E^E^E\\E`@E^C\\K~@E^I|@Gl@In@I~@E^K|@E^E^E^C^CLAPE\\E\\KdAE\\OzAEb@OzAK~@C`@W|BO|AE^E^E^C^E\\E`@E\\C^E`@E\\E^C\\E`@E\\E\\C^E\\E\\E^E\\E\\Eb@K~@[`D[`DQ~AQbBGj@?DGl@Gb@q@~Gc@dEKz@C\\Gd@CZE`@E^E`@E^E\\E^K~@Gl@APE^E^K`ACTGj@K`AEZEb@C^AFCVE^E^E`@?FEVC\\E\\?BE^Ip@ALEb@EZC`@CPGh@?@E`@E`@E\\CZE`@E`@I|@E^AHCRCTEd@E`@AHCXCNGh@?@E^AHCTARGf@?BKx@CZAFC\\ABIz@CXK`ACRAJE\\Eb@Ip@KfAE`@E`@K|@E^I~@OvAADE^C^Gb@QjBCPQ`BCZCXE\\Ef@K|@Ef@It@Eb@CXE^C^C^?@Ef@KtAARIfACd@C^CXCd@C^C`@C\\C\\C^GbAG|@C^C^C\\Cb@C\\C\\GbAE^A\\C`@C\\Ej@ATC^C`@CZC`@C\\C^C^C^AFUvDC^C^C^C^C^C^C^C^C^G~@Q~BA\\C^C^G~@C^G|@C^C`@Gz@CZ?DC\\C\\G~@G~@C`@K|AC`@CZCd@E`@C\\C^A^C\\CZC^C`@?@C`@C\\C^C^C^A^C\\C^Cd@AXC^A^?@C\\A\\ARALA`@AN?FE~@EbAC`@A\\Ct@AJCz@A\\C`@?BA\\A^C^ATEhAA\\C`@ExACb@Ep@?FAb@Cb@AVAd@Cb@?LANA^C\\?HAXA^CZ?@?LAPC\\A`@AH?@?PC^A^C\\?VCb@IfBCr@E|@GzAGtAAd@A\\Cn@AJA^A`@Ez@?BGzA?@A\\E~@A^A^C^I|BCb@Cv@Cd@AXAb@O`EGjAInBCz@E`ACh@Er@Cv@IhBOxDOpDKbC?JEx@A^Cb@AXA^ANIxBAXQbEAVCv@GjAE`AAZEfAE|@A`@AXE`AAVEhAARCp@AJAd@AVCh@E~@GxAA^EbACz@APEfAEdAAl@ATGvAIzBAPCl@GzAE`AANCp@IzAE~@?NGrAEnACl@GjA?HKbCCr@Cl@C|@ADAZEjAGpAC|@Et@?DEbAK`CC|@GzAK|BC~@C`@AZC`AKbCGvAGtAEhAAREhAEx@A\\AXEhAI|BE`AG~AC`@C|@UvFKbCGxAI`CE`AIlBGjAMfDKzBIzBC`@?NATEz@GzAOfEKtC[zH?HGxAEz@Ad@GtASfFEpAGzAGlAE~@Cn@Ch@Ez@AXAb@C^C|@E`AG|AEbACv@?@E~@KjCCp@EbA?JEfAU|FYzGIdBA\\KzAC\\Ez@G|@UfD]nFu@zKi@`IYxEQdCS`DEh@a@jGA\\C\\C`@M|AG`AA\\I`AGz@G`ACd@Gr@C`@CZGbAK|AAZE`@C^AXEb@C^C^C\\C\\C`@C\\C^C^C\\C`@C\\C^Eb@AREf@C\\C\\Cb@Gz@C\\G`AGz@G~@C`@CXC`@G|@G~@C^C\\Cb@Gz@C^K~AC\\G|@G`AC\\Et@Eh@CZCb@C^C\\Gz@G`AGz@G`AG~@C\\K|AS|COzBK~AE`@Gx@C`@Gr@IfBC^C^C^A\\G|@C^G|@G|@E`@IzAEb@Ex@C^E`@A\\KzAC`@C\\G~@Gz@K`BGz@G~@Ej@Ep@Eb@CXKbBCXC^G~@C^CZC^C^ANARCXCb@C\\C^C^C^C\\ATAJCZC`@C\\C^C\\C^C^C\\C`@C\\C`@C\\C\\A^C^C\\C^CT?FC^C`@C\\C\\Cd@CXKbBCX?BCZC`@CZC`@CZC^C`@C^C^C^C\\C\\C^E^APAPC\\C\\C^Ej@ARC\\?DCVC`@?BCXC`@C^E^C^C^C^C\\?HCXC^CZC^?BCZC\\C`@C^C\\Cb@CZC`@C^C^C^C\\G~@C^C\\C`@C\\C`@C\\C^Eb@C\\C^C\\C^C\\A\\ABC^C\\C`@C\\C^C^C^C^C\\C^C^C`@AJAPC\\C^C`@C`@CZC^C^C\\C`@C\\CZC`@C^CZC`@C\\C^CZC^C\\C^Cd@CXC\\Cb@CZC\\C`@?HCPEn@q@jKC^ATGdAA@AZE`@C^C^AZGz@Eb@E|@E^A\\C^C\\?@E^A\\E^AZEb@C`@AV?BC^ADAVC^C^C^C\\C`@C^AJARC\\C\\C^C^C\\C`@C^C^CZCb@CZC\\Cb@C\\C^C^C^C^C\\C^C^C\\Cb@CZC\\C`@C^C\\C^C^C\\C`@C\\C^Cf@Gt@C^?@C`@C\\CZC`@C^C^ALAPC\\C\\C^C`@C\\?DCXC^C^ATAHC\\C^C^C^CZC^C^APANC\\C\\C^C`@CZC^C^APAHCb@C\\C`@C\\Cb@CZC\\C^Cb@C\\ATAFC\\C`@C\\C`@C\\?@C\\C\\G`AC^CZCb@C^Cb@KxAG`AATAJC\\C\\C\\?BCZC`@C^C^CZC`@C^Ep@CZAPCX?@Cj@CXC^C\\C^C^?DCXC`@C^C\\C^ARAJC^C\\Cb@CZC\\C`@ALANC\\C`@C\\Cb@CZ?@C`@CZC\\C`@C\\C`@CV?HCZC\\Eb@CZC`@C\\ABC^CZEb@C\\C\\Cb@C\\C\\E`@C\\C^GbAC\\Cd@C\\CZC\\Cb@CZCb@CXEb@EZE\\Kz@G`@EZGb@EZEZG`@G`@CVG^Eb@G\\G`@E\\G`@CVG`@E\\Gb@EZEb@E\\E^E\\EZG`@E`@E\\EZGb@EZCZG`@E\\E`@EZE\\G`@EZGb@CZG`@EZEb@E\\G`@EXEb@EZG`@E\\E\\Kx@?D_@vC_@|COpAKp@Y`COfA_BpMa@fDqBbP_@~CKr@SzA[~BSxAUpBS|AIr@Il@[rBGd@E\\I`AQvAMbAWrBw@jGa@hD{@|GWtBAJGb@UdBMdAKx@e@vDEXc@nDk@pEOpAUbBEZa@hDIj@Ir@G`@MdAMbA]pCUfBE\\_@xCUjBS~AAFWtBKz@Ih@_@|CWrBe@zDSzAEXY`CM~@QxAM~@MbAKv@Gh@Gh@OnA_@vCEXANEZGb@OpAAF?@YxBQzACNAJKt@?BM`AWxBABKx@Gj@EVQxAE\\MbAYvBMbAEZQ|ASvAEb@OjAQxAIp@YvBWxBAFKv@Ip@Gd@CPCPGh@Gb@CZCL?BOjAOnAUdB]pCSdBKx@QxAMlAGh@_@lCIt@UpBEd@Ij@Gh@QlAIj@Gh@E^SvASdBOfAIn@Y|BGf@?HOfAK`AU|AKr@M|@MdAi@rEKbAKv@QnAMdAIj@Mz@Mz@EZM|@K|@SxAQxAK|@MfAKz@G\\MlAOfAKz@Kv@CXGd@Il@Gb@?DGb@Gb@CXM|@Ip@OpAS`BQlAE^K~@Kp@WtBUjBCVUdBEZMbAE\\AJGf@Gf@S|AGd@Ed@ADGb@Eb@Kv@EZKv@ALK|@Kt@Gh@Kp@Eb@Kr@E\\ALE^If@AJE\\Ih@Kx@K~@M|@K|@Ip@If@K~@Gf@ETMdAGd@E\\EXQzAMdAEXGf@CPKx@In@Gj@Gd@AFGj@Kz@M`AIh@ANGd@EXMz@M~@ETEVCNG^Mh@ERG\\GZSz@IZa@`BM`@k@nBYx@[x@IX[v@i@nA[r@_@v@_@r@Q\\]n@_@p@_@n@SX_@j@ABUZMPILW^e@p@GH}@pAILq@~@ILMPm@z@[b@ILuAnBY`@iA`BEDQXe@n@i@t@iBjCq@~@a@j@s@dAORUZeA|ACBs@dA{@jAoAhBKLYb@]f@q@~@u@hA{@lAi@v@s@bAA@GHW^W^SXQVeAzAc@n@q@bAABQVMTa@p@_@r@OZOZS`@Wh@i@pAEJGNKZMZM`@KXO`@GVOb@YdAWdAKb@I^GZGVUpAKj@Q`ASnAKl@_@vBId@W|AUvAIb@G`@_@tBa@fC[hBQhAKh@Ih@Q|@?DOz@Ov@G^o@zDIf@SnAAFIb@GZGb@I`@Kj@Ih@Ib@Kn@Kj@Mt@Mx@CLE\\G\\G^EPAHG^GZCJ?@CNEV?@ABG`@GXG^EVAJI`@G\\E^ERO|@ERQdAGXG\\Kv@Kj@EXABAJKj@ObAO`AIf@Mz@E\\G\\QtAE^E`@CJGl@K`AC\\Eh@Ir@G|@C^IbAAVC^C^Cf@Cl@Ch@Cp@Cn@A^AXC~@Ab@A^A^A~@?z@Az@AfC?@?xB?jAAxB?^?^?@?^?`@?`@?^?\\A^?V?bC?F?X?^AT?J?`@A\\?HATAr@GtACt@Er@AXEh@?NIlACb@AXEt@?FAb@?FAj@?J?hAArA?D?^@D?\\@J?L@\\@H?L@RDf@Dd@BZ@FDd@Df@Hj@DXD^DPPfA?B@BJh@Hd@VrAHb@DXF^F\\D\\Ft@?@B^@FB`@@ZDbA@^?`@@L?P@DFJDH",
                      },
                    "start_location":
                      { "lat": 34.7245921, "lng": -114.4155694 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "57.3 mi", "value": 92197 },
                    "duration": { "text": "52 mins", "value": 3107 },
                    "end_location": { "lat": 34.2407293, "lng": -117.4308731 },
                    "html_instructions": "Merge onto <b>I-15 S</b>",
                    "maneuver": "merge",
                    "polyline":
                      {
                        "points": "au|sEpbeiUBpB@nA?bA?dA?bB?T?dA?\\?~@?\\At@?hA?|@?`@AtA?dA?xAAh@?j@?j@?h@Ax@?j@?tA?jA?j@AvA?vAA~D?|@?hA?d@AhDAjD?NApB?|A?xBAlBApH?|B?f@ApA?R?N?Z?j@Aj@?`E?N?fAAbBA~AAdA?LAt@A`A?`A?jA@bC?Z@~@?xAA`A?j@?hA?fAAX?`A?~@A~@?~@?^A`B?jCArC?D?\\?|@?xB?h@AdC?H?jA?f@?b@@pA?n@@T?TBrBD~ADlBFtA?L@D?R@BFhALtBFdADj@Fp@Dr@N`BHbAHz@Fj@@PBZPfBFn@Dp@b@vERxB@DDd@D`@H~@H|@Hz@Dh@Hx@HbADd@Fn@JpAJbAFv@?@D`@HbABX@@HbAD`@BTD`@BHBTD\\FZF^P~@H`@Jl@VbAPj@Ph@Pd@h@tA`@bAl@jA`@v@P\\T^\\h@b@n@`@h@d@l@b@f@j@p@f@j@d@j@\\b@bCtCh@l@j@p@fArAd@j@pCbDX\\|@fANPZ\\jBzB`EzErBbCTXPRDDRT@BTXLHNPr@z@d@h@Z^LNfGjHz@dAhArAnAzAlAvA^d@d@j@b@d@`@d@t@|@t@|@RT`@b@pA|AVX`AhAZ^|@dAt@v@l@l@b@`@RRJLBB\\Z^ZZVb@\\ZV^VBBXRt@f@TLVPZP\\Rd@Vh@X~@d@l@Xz@\\`@NJDNFRHZJD@h@Pf@Pj@NTFXHnAXTDNDLBbEv@f@JTDLBH@PDPDPBz@PTD|@Ph@JRDNBlDp@t@LXFXFRDv@NZFh@H^HB?^Hd@H|@PVFPBr@NlATRDtAVfB\\@?VF\\Fp@Ld@HvBb@p@LJBp@LfB\\nHtA|Bd@XHb@HpAVdHrA~Dt@ZFt@NZFZFVDRDXF\\FTDZFLBHBXDXFXFZFTDXFn@LXDrDr@dARb@Hl@LPBl@L`@Hb@HdARVDl@LZFPBdATj@JXFD?LBp@N|AXJB`@HlB\\pAVzBb@b@FxBb@~@PVDPDPDlATZF^FRDVFXDLBxAXh@JjATz@P^FvGnAvDr@TFl@JnAVXDZFn@LnHtAVFzGnArB^RDXFRD\\Fp@Lr@Lp@N@?`@H@?h@Jl@J\\HRD@?p@LHBp@JrHxAdQdDjEx@xAVfF`AxBb@x@NxB`@XFVFXD|@Pf@Jv@N`APp@LXFXFXDXFXFr@LXFVDXFXDXFXFB?TFXFPDb@JTFRF\\JRFVHXH\\LVHZJNF^NXL`@Ph@T`Ad@^R`@Tn@^|A~@RNVNj@b@ZTj@b@b@`@TPTTHFHHTRTRRRRTRRTTRTPTRTRRRVPTPTd@l@b@l@PTPVPTRVPVf@p@^f@x@dA|@lAb@l@lA|Av@fAd@j@`@f@rAdBLPb@j@Zb@^d@RXb@l@rAfBZ`@RX\\b@V^~CbEbB~Bf@p@t@dAn@z@V\\V\\r@`AFJh@r@\\d@@@\\d@\\b@nBjCX^X\\n@z@lA`Bt@`Ap@|@t@`AlCpDdArAl@x@`@h@V\\n@z@l@x@l@x@V\\FHx@jAbBzBzBzCV^@?p@~@V^X\\Zb@PTTZFHNRX^RX^b@V\\X`@V\\RTz@hAV^l@v@dDnEZ`@JPNRzC`ElA~A`@j@^f@\\b@B@v@dAJNLLPTrBlC`ElFf@p@Z`@vBpCr@`Ax@dAtCzDdDjEV\\X^h@t@X\\V^V\\@@p@|@p@|@p@~@p@|@vFrHbBzBtBrCPVZ`@JLh@t@B@h@t@RVxElGPXV\\TZfB|Bd@l@fAxAf@n@xBtCr@`ALNtRhW|N~RxCtDvAvB`ArAl@v@bApA^h@zAnB~AtBh@p@nGlIX\\|C~DjBdC~@lAp@|@\\d@|ArBNRjEzFl@v@n@z@v@dAp@|@pBlCb@j@~@pARVX\\X^PVjA|A^f@b@h@HLp@z@@@TXb@f@RV~@fALLBBlArAJJ`@`@TVNNJJ\\ZJLLJJJRPBB^^LLLJFH\\XPNNLt@p@jA`AlAhAl@f@XVBBVTBBTRDD`@\\ZXFFTPb@`@b@^b@^j@f@PPZVd@`@^\\XVt@n@~@x@`Az@RPl@h@JJtAlAtAlARRd@`@PPNLJHXTJJZXb@^JJbA|@|@t@lAfAlEzDx@r@JHzBrBRPl@f@DDTRv@r@n@h@NNx@r@lAdABBtBhBr@n@lFvE^\\HHRNVTRPRRDBNNj@d@l@h@~@x@\\Z`Az@nAhAl@f@VTf@d@z@t@VTTRj@f@XVZXjDzCXVTR`@\\?@DBnAfA\\ZPNjBbBx@r@d@`@RPl@h@x@t@l@f@LLHHPNPPl@h@HJTPd@b@RPf@b@FFBBl@f@XVPPXV\\XVTj@h@B@NJTTJJj@f@TPJJj@f@f@b@RRVRpCbCFFLJHHn@j@n@f@XVb@\\VR?@PLTPj@`@HF\\VTPNJn@d@`@Vv@j@FDLHZRZRZRZRf@Zd@XtAv@r@`@ZPZNjAl@n@Z~@d@@?NHhAd@RJDBHDlAf@XLZNrAl@D@z@^`@PJDb@RPHDBNFHDD@NFNFjAf@xB~@`Ab@`HxCDBB@VJx@^rHbD`Ab@XJj@X`@NXL~An@h@Tb@RHBXLLFZLRHHDHDNFPFRHVLLFb@RpCjAhDzA`@PpAj@rCnAJDTJb@RRJTJtB|@VLfBt@B@hBx@RHD@|@`@z@^HB|@`@h@Tb@RNFh@Tf@TPFhBv@@@^NVJ@?j@VbDrAj@Vl@V`A`@HDbA`@jAh@XJRJ^PFDD@JDJFj@TPH`@P~@d@XLVJx@\\NHFBFBr@ZZNRFn@XTJZLl@XVJVJTLXJj@Vj@VXLt@ZLFFDXJd@TZL^PPHHBB@`@P`Ab@^PZLd@RLFr@Z`@N\\NXLRJv@\\bA`@B@~Ar@f@RNFHDr@Zf@TXJJDZNNDXHJFr@TdBj@f@N\\JZHbB\\B@tARv@JHBD?PBd@Fb@Df@Dv@FT@^Bn@DL?V@l@@Z@l@?dA?nBC|@Cx@El@Eh@EfAKBAPAPCf@Gz@Md@K@?^G@A@?`@Ib@ITEJCTELCTEd@IHCZGDATE^INCTEn@Mv@QLANEt@OVEXGv@OLCr@Ot@MlAWd@IdB]`AQNE~@Qz@QNCt@On@Md@Ib@IbB]hB]VELCb@I`@ILAn@Kp@Kp@It@In@E\\Cn@E~@EH?|@Cf@A^?h@?J?X?P@Z?R?d@@p@@P@b@B@?H?P@VBv@HZBF@d@Ff@Fh@Ht@LB?p@Nf@Hl@L`ARh@JHB`@HNDr@Np@NVFtAVn@NdB\\ZHx@NZFNDl@N`@Hb@Hd@LbARJBF@j@LjAVRDF@TFh@Jp@N`@Jd@Hj@LZFd@JXDVHv@NnAVp@NPD\\Ff@Jv@NNBLDn@LTDhATb@JpAVdATLBb@J~@RrAVt@NVFlAVXFv@PRDz@PNDx@NZFPBv@Nh@JxAZj@Lf@J`ARd@JB?l@Lt@NPDNDTDXF`@Hd@Jr@NRD`@HJD\\Hb@LPDh@PbAXz@V@@f@NXJ|@\\@?RHj@Vl@Vb@T^Pj@VPJRJ~@f@vAx@LH`@T^V`@VJHZRv@h@j@`@^VHFPLh@^^Vp@d@h@`@XPx@j@r@b@pA~@v@h@RN~@l@LHdAt@f@^l@`@`@Vl@`@`@XVPf@\\XRbAp@|@n@PN~@l@ZT^V\\VNJb@V`@Zl@`@f@^t@f@p@d@h@^B@x@l@PJ\\VFDTNDDXPbAr@NJVP|@l@`@XpDdCfCfB\\T@?`Ar@r@d@tBxAbAr@PLnAz@l@b@`BjATNh@`@DB~@r@l@`@BBpA`An@d@nA~@JFjBtARN^Vx@n@TNTPJF^ZdChBp@f@hCjBr@h@XRTPLH\\Vl@b@RNVRdAt@`@VZTf@\\RN|@p@xAfAXR`Ar@\\VTPd@ZnBxAj@b@pCpBb@\\`Ar@h@^~@p@r@j@DBlAz@hAz@FFTNHFPLdBpAh@^FF^Vh@`@l@b@pCrBb@ZvB|A\\X^V\\V\\VbAv@BBVNTRl@b@ZTh@`@RLn@d@b@\\b@ZXR|@n@?@r@f@^XVPLJNJLH?@n@d@XRPLPLd@^d@ZZTTP^V\\VtCtB|@p@jBrA`@Z~DvChGpEjEbDdBlA`@Zl@b@PLp@f@XRzAhAXTRPf@\\t@j@d@Zb@\\\\Vl@b@^Xb@Z\\T?@pA~@VRhAx@@?ZV@?DBTP@@XRNLj@b@pBxAPJb@\\pBxAb@ZDBTNf@`@TPPJVRVRNHxAhALHRPdAt@t@j@VPxB~A@@FFnBtAlA|@d@\\h@`@~@p@^ZZRJHJHLHl@b@`At@bAt@NHRNRLDDf@^\\V\\TdAx@@@f@`@b@ZJHTPn@f@LJ\\XVTPLRPNJ\\ZXVd@^JJ@@FD|@v@v@r@b@^TRx@r@PNh@d@bA|@dA~@`@\\@?z@v@b@^h@d@TRx@r@n@j@PNRPXVZXVTh@d@TRzApAxBnBbEnDnAfArAjAPNb@`@p@j@BBZXNL\\Z^Zr@n@ZXBBLHz@v@ZX`DpCj@f@FDLLFDLJFFFFLJRPFDbBzA^ZVTFDHJJFPPPNBBJHLJXVLJjAdAd@`@\\XRPNNTRNLHFPPTPf@b@?@\\XPPd@`@^ZlB`Bt@n@dA|@B@bBxA`Az@NLjB|AnBbBv@p@LJ@@JJNLf@`@fA`ABBbBvAb@^XTXVPNZV^Zp@l@l@f@JJxChCLJRRn@j@rAjA`@^VTTRp@j@`@^z@r@PLp@l@jA|@xAdAZRx@f@JFv@b@LH\\Pn@\\XNrAp@hAb@hDrAFBNF\\NTHTJFBLFVJb@PvAl@nBx@hCfAPHRHTJ~B`A^Ph@Tl@V~Ap@TJPFh@Tf@Rn@XFBf@RXLVJh@TB@VLVJVNVLTLPLB@TNTNVNTRp@d@^\\XXb@`@r@t@j@r@RTPTHNFDPXT^LRRZBFR\\NXj@fALRd@|@~@fBDHNXjAxB|@hB^t@v@xAv@xAj@hAd@|@j@fAf@bAj@dA\\p@Zn@@B@B@?R`@?@x@zARd@v@tA@Db@x@LVT`@HPTb@tAlCTd@FJXj@P\\HPT`@fAvB^t@Tb@d@~@Zf@h@bABDXj@DHFHXl@BBb@z@l@fAJPl@jAh@fAJPXj@f@fAb@~@h@bAFLBFbA|Ab@n@d@l@X\\RT^^ZZLLTT`Ax@@@ZVRPPLLH^Vl@^l@\\ZPB@RJj@XNF~@^PHnAh@LD`Bp@vB~@pAh@xD~AfAd@ZLf@Rj@VHDvAl@\\Np@XzAn@RHPHn@TvAn@\\LnAh@B@|B`AbA`@b@Rr@ZrAh@r@ZdEdB~Ap@r@Zn@Vf@RdAb@`A`@fCfA~@^n@VVHr@VpC|@t@VXDlAXl@JZH^FVFD@tATlATXDr@Lp@L\\FH@v@LZFLB@?l@Jf@J^FlARvAV~@NjAT@?h@HXJJ@jARhARZFj@J^FNBtEx@pARXFRBVDB@VDPB`@HXDVD`C`@p@JXFr@LVD^F`@B`APfAPpDn@LBTDhARZDZFl@Jh@JF@h@HnATjAPF@p@LRB^Fh@Jl@JTHTDXD|@P`ANhATlAVn@Nn@PTFn@R\\JD@LBj@P\\NTHn@Vf@T^N?@x@^^TJDTLB@RLFBPHz@f@rAp@^R^R`CpApAr@h@X@?~A|@XNl@Zd@VrAr@^Rr@`@r@^\\PVN@?fCtA~@f@B@l@\\d@V\\PXNl@\\r@`@z@d@d@T`Ah@hAl@@@t@`@RJt@^~Az@VN`B|@ZNXPfCrAhAl@~Az@b@T\\R@@n@^z@`@^RXN@@lBbAhB`ARJFDpAp@r@`@jDhBNHDBVNt@`@jAn@^Pl@ZXNf@ZDBh@Vl@\\`Af@^RD@NJHD\\P@@TLHD\\PNHZPb@Tn@Zj@\\HDf@XnCxAl@\\LHz@d@FBLHp@`@d@XVNVPTNf@\\@?dAt@p@d@PLv@j@b@XNJBBXTZTfBnArA`AXRdAv@n@b@b@\\jAx@l@d@l@b@RLTP\\VPLPJVRTPl@b@`BjADBn@d@TPb@ZDBj@b@PJlDhCv@j@tCtB\\VnA~@fAt@z@n@TPr@f@LHBBLJ^V@@n@b@t@h@v@j@`@Z^\\v@h@d@\\b@Vd@ZHFj@b@XRLHPL`@XZTp@d@FDLJ@@vBzADDTP`@Xd@\\^VFDZT\\TFDb@^ZTXPXRJJ^VbAt@bAr@l@b@h@^t@h@RPh@^@?z@l@VPRPRL`@Zd@\\b@ZDDj@`@xAdA|@n@RNPLpBxAZRdBpAhAx@j@^?@bAt@RNDBHFbBnAJHJHRNVNj@`@f@^JH`@Xn@d@DBNLz@l@jAx@TP|@n@dAv@zDpC\\VZR^Xv@h@bAt@j@`@VRVRnA~@vDrClAz@x@f@`Ar@~@p@XTtBxAFDlCpBtJdHrA~@pA`ApAz@~AlAx@j@?@~CzBbAr@|@p@dBlAnBtAXTbAt@hAz@p@d@z@l@bBlAr@h@\\V\\T\\Vf@\\j@`@NLLHDDHDLJl@b@LH~@p@LHJJlAz@HFB@r@h@t@h@b@\\|@n@|AhAx@j@dD~BTPtCtBrCrB|@n@fCjBj@^TPxAfAPLb@X\\VLJ@@n@b@f@^|@n@xAdAz@n@z@l@?@vCtBn@d@RLDDRNRL^XfAt@NLx@l@ZTz@l@HFhE|CnA~@l@b@z@j@JHjE~Cz@n@^V\\TXThBpAx@n@~ElD`CbBDB~BdB|B`Bp@d@j@b@PLfChB^VTPt@h@lA|@h@^TPNJf@\\h@`@^XDBHFZTr@h@B@f@^\\VPL@@JF`Ar@HFlAz@j@`@JHjBtAp@d@bCdB?@xAdAx@l@XPd@^\\VXPZTPLNJLJNJ\\V\\Vf@^\\T@?\\V\\V\\V\\T\\VJHp@d@LJl@`@p@f@HF\\VzAdAzDrCr@h@RNn@d@^Vj@^`BlATPlAx@dAv@^Xr@f@hAx@p@d@dAv@d@\\^V`Ar@z@l@\\V\\TvCxBvA`AxAfAtA`A\\VhBrA\\T@@XXVNbFpDFF\\V\\V\\V@BhBzAbB|A`AbAHHNNHH@@xCvCJLLJ@@LJl@h@lB|AhA|@hA~@fDdCZTLJvPhM\\V\\Vh@b@|@p@z@n@z@p@xAfAx@n@\\Xz@n@\\V`BnARNjA|@l@b@dCnB\\VxAfAz@p@jPdM\\R|B~AzH|FfE~C~@r@t@h@DBrCxB@@XV\\XJHNLl@f@NNf@b@x@r@p@j@FFx@r@\\Zv@r@x@r@tAlAtBhBFHhB~AnCbCpBhBlCbCrBfBbIjH|AtAv@n@tAlApAhAdA~@dFrErBfBTT?@b@`@ZX\\ZZXhA`A`CpB\\Vz@r@ZVFDTR\\VdAt@xAdAdAv@xBxANJ|@l@TLJHvBtAnBlAfBlA\\Tj@\\PLvA|@DB`Ap@VTt@l@vAlA?@vAxAh@l@h@l@V^V^@?`@l@LPXb@NXl@`A?@FJb@x@Xn@HNBFBBDHDJDF?@BFHRr@~AHR@@z@nBRb@P`@@Bj@nABD`@t@V`@R\\FHNVr@`A?@b@h@NP?@TVZ\\@@t@v@r@t@ZZ@BHLDDzA|ATTh@l@l@r@n@x@p@bAb@t@R\\f@`Aj@rAZt@d@xAFTH\\jAlEHd@FVL|@Jr@Jp@PvAl@nE@Px@`GPvAPhBP`CDvA@L@j@?@@V@lAAzAATAn@Cd@AXAPEh@ADEd@Gh@WnBK|@Ot@EVI^ADA@Mf@ADQx@Wv@KZ[bAYx@CFa@~@_@v@IPQ`@?@A?]p@g@hAIRUb@c@z@Wh@[p@Yt@Yp@[`AQj@K\\AHSv@Qx@CFOz@Q`AMbAKv@It@Gt@G~@G`AC|@Cp@?N?~B@x@DtBD~@Df@D`@@HJhAJt@@HJv@P~@P|@Ll@Nn@Nf@Nf@BHJZX|@Pd@Rb@N`@@BRb@Rb@P\\BDR`@@?T`@LVX`@DFFH@@@BDFDFRVPTDFDFFH@@j@r@PPFFRRf@h@t@n@FF\\VTRJFh@\\BBVNZR`@TPJLFFDb@TFBJDTJ@@NFXJHBVJt@Vn@PLDTDF@^Hr@NJ@z@NH@H?f@FT@^Bp@Bt@BF?n@@x@?|@Ad@?pD?@?fAAjA?Z?@?@?`@?rDA@?b@AlCA@?pDA@?b@?zHCvCAtEAnEAF?b@?bDAb@?b@?v@?lA?j@?vA?jA?J?`C?pAAV?bA?D?h@Aj@A\\AB?f@C^AVC^ARCf@EVCRAd@ERCPAXEXE^ED??Ab@G^ErCg@l@Md@Kn@On@Ol@On@SHCVI`@M`@Ml@Qj@Un@Sh@UTK`@Ol@Yn@Y@AJG\\OVMHGJEn@_@b@UFEn@a@b@WPMTOFEBAJIPMDCf@]^Y@?RQLIJIZY\\W`A}@lAeAFGzAwARWnAwA\\a@n@w@v@aAZa@|BwC@AX]`@g@b@k@r@}@f@q@HInBaCvGiId@k@lA}AbC{Cv@aAJOJOX]X_@RWNQLQLOBEJOLQ@?b@s@HI`@q@NWLWHMBE^s@@AFKP_@Tc@Tg@Pa@?ADKHURg@Rk@@APk@BKFi@@QDIFUBMBMDO@CR_AJa@HUVgAVaAp@yB`@eAf@mAN[Zo@r@sAl@_An@aALMX_@Xg@`@_@b@a@`@c@fA_Av@k@z@m@hCkBtB{A`As@|@o@@A?ANKHG^YhCoBrDqCzBcBTSPO~EsDd@YxEgDRORMh@[l@]f@Wv@_@rBy@jAc@z@WvA]j@MFAZGJATEz@Kj@Kd@GzAIjBIp@Az@Al@@jABJ?x@DrAFpBJP@b@BhKf@dDPz@DH@pAFjAFb@BH?h@@p@?VA\\?b@Az@GrBOb@GVE`@GJCTEj@Mf@O`@Kh@Qn@WXKd@STMFC\\Of@Ub@U`Bw@p@]VKXOh@Sd@Qd@Qf@ONE\\KTEfAUNE`@ILC`@E^E\\C^CNARADA\\An@AfWIvDAdCAvAAvBApHCnAAj@?Z?XAH?b@?b@?L?F?X@@?b@?H?X?T@D?D?b@@@?`@BV@J@TBV@XBT@R@\\B^DXBJ@z@F`@DjBNb@Bb@DZBD@P@\\Bz@HJ@B@R@ZDF?N@ZBj@BT@LAP?\\?D?N?`@?@?v@CH?D?b@C`AGD?RCNAPCfAQn@M@?b@IDA|@Wz@Wh@QPGl@Wl@WZQbAe@d@[r@g@ROTQj@c@d@c@r@m@FIh@m@`@e@`@i@RWBE^g@BEz@wAf@{@LWDI`A{Bn@aBPe@JYnAaD@EN_@HUFMFQFM@EFOHUZu@DM`@gADIb@iAf@oAVq@f@uAh@sABCDK^cAj@oAv@{ADK^u@BEZi@^k@\\i@JO@ANUr@cAt@aA`@k@|@cAl@u@BAj@q@Z_@RSd@e@NM~@_AhLcMdC}CTYj@w@`@k@DEV_@LSV_@PW^g@",
                      },
                    "start_location":
                      { "lat": 34.8860896, "lng": -117.0130474 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "9.1 mi", "value": 14706 },
                    "duration": { "text": "8 mins", "value": 459 },
                    "end_location": { "lat": 34.1423304, "lng": -117.4890084 },
                    "html_instructions": "Keep <b>left</b> at the fork to stay on <b>I-15 S</b>, follow signs for <b>Los Angeles</b>/<wbr/><b>San Diego</b>",
                    "maneuver": "fork-left",
                    "polyline":
                      {
                        "points": "qs~oE|uvkULc@@AVa@DGJQBEV]@AV_@TYBCT]@AXc@V[X]NSFKfA_BV_@p@_AfAaBx@mALQV_@X_@V_@V_@V_@X_@n@_AV_@b@m@DIV_@BCZe@h@w@V_@JOJOLQJMfA_BfAaBfA_Bn@aA\\e@DIh@s@x@eAn@}@n@w@BELQt@aAx@gAt@cAxAsBJMp@}@LQ~@iAX[X]DEn@q@HIZ[PSHGr@y@HIPSX]X]n@}@FKRYR[NUFKHMPYPWZg@P[@A^k@PYT_@HMHOFIP[lAmBl@aAb@s@\\k@p@gAb@q@`@q@VQJOPURUFIFGZ]RSLKf@c@^YJIp@a@LIf@Y@?DCn@Wp@Yb@MVIZIr@Mf@IbAILAZCv@APAD?n@@@@b@@b@BbAJt@HPBbALPBNB`@Ff@FTBh@Hh@HH@jAPZDTDTBl@JbANb@Ft@JXDZDPBdANx@Ln@JPB\\DfANVDb@FRDN@VDv@Jh@JJ@b@F\\Dx@LJ@TDB?HBRBD@`ALTD|@LPB`@Fh@HxATl@JVD~@J`Dd@D@|@Lh@H@?XD\\FPBh@HTBf@Hx@J@@l@HZD|@N|@N~@H^HXFhB\\bB`@r@Pn@P~Ad@r@TVHp@TbA`@LFHBp@XXL\\NNFlAh@n@ZXLDB^Pd@Tf@T\\Nj@Vr@Zv@\\vCtA|@`@r@ZfAf@FBh@VbAb@PJx@\\t@\\r@ZfDzAfAh@bBt@bAf@`@Tb@Tz@h@xAbATPbAx@fAbARBDBFDDDl@p@LLPTTVV\\\\`@n@~@V`@^l@f@x@T\\f@|@n@bAPX\\h@R\\BBXd@z@xAh@z@DFXd@`@p@`@p@V^R\\@@T`@h@z@lAnB~@bBl@fAnAxBLRNT^r@v@rAZf@NTPTPZPTNVRXFJh@v@d@p@NTd@p@JLV^PVPTRVPVb@l@@BfAtAhAvAvAhBHHt@dAd@h@RVNPFHJJb@f@^b@~BjCZZnAvAt@z@^b@n@r@BDZZTVz@`Ax@`AZ\\LNNP^b@nA|AdApARXFH@BfA|AJP^f@dAdB\\h@`@p@^p@LTR^l@jAj@hA\\r@hA`CLXz@jB|@lBx@fBf@dAR`@LXl@nAbDbHj@lAZp@z@hBn@rAh@lATb@Rd@l@pA^t@Vh@Rb@d@dAb@~@x@bBLXJTP`@j@jANVNZNXl@jALT`@t@PXNVNVNXLTPXNV~AdCf@n@FF\\h@TZRXBB`@j@JNX\\X\\PXNTFHX\\bC`DhB~BX^~BvC|BxCjDnE^d@`@h@vAhBxAjBbApAX`@hDhEPT|ApB`AjAJLvAhBhB~BTX|BxCfBzBhAzA~DfFl@v@x@dAjAzAn@x@VZj@r@`BtBLPj@v@tCrDRX~ArBb@j@V^\\`@d@l@JNX\\RX^b@DFd@l@DF^b@h@r@@BHJPTJLLNTZDFTZRRZb@FHdApADF`@f@nA`BFHLPHJDDvAjBX\\LPRTNRd@n@NPRTRVNRRXPRLPDFPRRVRVPVNPTXPTRVPTPVRTNPRVRVPTBDLNPVRTPVRTPTDFJNPRRVNRBBFFHLPTLNFHHJRVBDLNJLJLPVPRr@~@d@j@`@j@BBb@h@d@l@d@j@JNV\\d@j@d@l@V\\JLd@l@d@l@BB^f@PTRVZ^FJTXRXPVDD^b@LP@@PR",
                      },
                    "start_location":
                      { "lat": 34.2407293, "lng": -117.4308731 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "6.2 mi", "value": 9934 },
                    "duration": { "text": "5 mins", "value": 327 },
                    "end_location": { "lat": 34.0711732, "lng": -117.5450579 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-15 S</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "qlkoEhablURVDDHLLPFFPRPVPTNP@BRTPTPTRVPTDFJLRVPTPTRVPRPVRTPTRVPTPTRVPTFHHJVZLPPTRTRXPRJLDFPTRVDFHJLPFFNR@@PTFF@Bl@t@LPBDRTb@j@\\d@X\\TZHJh@p@PTRVPTJLDFTXPR`C|Cd@l@PRb@l@d@j@RVNRRVPTRVd@l@PTJLFFPVRTPVPRPTPTPTd@l@PTPR@BRTPTNT@@RVPTJJDHRTPTRVJLDFPTPRRXNRRTRVPTPTLPBBNPV^TVBDLNNRRVNRLLBDJLJLh@p@|@hAlA~AhB`CRVbApAf@n@zAnBHJb@j@JLl@v@n@x@n@z@n@v@\\d@f@n@`AvADFvBlCfB|BdAnARNx@fAVXX^V^LNfAtATXPTfAtAjAzAf@n@h@r@p@z@PTHLZ^`@h@^d@JLTXTXNRHJFFFJd@l@t@~@NPHJNRRVPVTVr@~@PTRTPVRVb@j@RTRVp@|@|BtCrGlItDxEv@bAPT`BtBnBfCjB`CPRNRRXNPTXTZV\\l@r@RXTXNRv@`AX^V\\DDRVb@j@PTRVZ^X^LPZ\\NRTXr@|@RTd@l@t@`A@@dBvBjB|Bb@j@d@l@RVPRb@l@b@j@hAvAv@bAnA~At@~@hAxAVZPRFHDHDFHHZ`@n@x@hB|BvBrCdBxBBBnA~AJLX^b@j@LNh@p@X^HJd@l@NRTXZ^`@h@^b@b@j@x@~@z@|@Z^fAdAh@h@~@z@h@d@h@f@TPRPx@p@ZTVRp@f@j@`@x@j@LHPJ\\TFDVN\\VLFHFLFLFtAx@f@Vj@XTLZLTLTJXLn@ZTHLFHDr@XTJXJhA`@p@VHBJDTHZHb@NfAZv@Td@Ld@Ld@JZFHB@?JBTFB?VFXFZFVFXDXFZDVDZFRBZDXDZDF@NBXDXBXDZBVBN@F@XB\\DT@D@N@F?XBV@XB\\BX@t@BD?N@h@BxBDzB@rF@X?Z?V@Z?X?V?\\?Z?|B?|C@D?V@X?t@?X?fA@~@Ap@?rA@N?^?v@@pB@r@?nC?nBAdB@lA@F?F?`@?d@@B?X?fC@dA@F?nA?zA?T@D?lA?`@?l@?dB?b@?`A?`B@J?dC@jB?",
                      },
                    "start_location":
                      { "lat": 34.1423304, "lng": -117.4890084 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "8.7 mi", "value": 13943 },
                    "duration": { "text": "9 mins", "value": 523 },
                    "end_location": { "lat": 34.0867721, "lng": -117.6868201 },
                    "html_instructions": "Take exit <b>109A</b> to merge onto <b>I-10 W</b> toward <b>Los Angeles</b>",
                    "maneuver": "ramp-right",
                    "polyline":
                      {
                        "points": "yo}nEr_mlUTRb@@X@X@H?|@Br@Br@BF?LBJ@PBPDB@JBFBJBLFTHXPZRLHPNFDDD?@HFHHDFHHDFFHDFDFHNBBFLFJDJFJ@DJT?@FNDNDL@HDNBLDPBJ@JBL@J@J@FBZBd@F~@?N@H@h@?@Nl@Ax@?n@?v@?@GrC@tB?b@?X?\\?~@A`B?zD?jA?rA?PAvB?tAA~A@~B?`D?fCCrD?^?`@?RAj@?~@?bA@|BAvC?dB?pA?r@ArD?bD?`BA\\?pA?jJ?^A~A?~A?b@?zBA~A?l@?pB?jGArAFrBAbB?d@?hC?rC?\\A`D?f@?p@?T@pC?\\A~@?lAAXCfD?vA?j@AbG?xC?zDAtKAbG?`B?`D?j@A~I?`BA~A?fDClJAlB?n@?nBAh@?h@?l@CpA?HCfAE~A?BC|@WrHG`BAb@E|@IdCAXCz@GfBCh@Cp@Cn@A^EbAEzAGnAWjEW|CUtBYtBUbBe@rCEPQ|@Q|@Op@I\\Kf@GPGXOl@_@rAWx@Uv@s@vBSj@Ul@Wn@Wn@Sj@[v@_AtB_@t@q@vAoB~DQ\\Q\\_BhDOZe@~@ELQZ]r@O\\MVoAdCKTMXOVy@dB[p@mA`Cy@dBIN_@t@]r@Q^KNO\\g@bA[n@a@x@c@|@Q^Yh@e@bAUf@c@t@]r@GJGLKTCDOXABKTOZOXOXMXKTCBMXOXOZMVMZOXOXMZOXMVOZOXMXMXEHIP]r@OZMXMZOZMXGLEHOZMXOZMXMXABMVMXOZMZOXMXOZMVMXOXOZMZQ\\MVMVQ\\KVOXMXMVOZOZOXOXMXOZMVOZOXMXOXMZOVEJGLO\\OXMXOXMXQZKTEHIPOZOXIPEFMXMXOXOXGNEJOXOXKXGJGLOXMVGNWf@MXIPEHMTQ`@MTMXIPa@|@MXMZMZKRCHKXKZMZKZEHGRKXK\\IXKZK^IZK\\GVADI\\I\\IZG\\I\\GZG\\CHEVG\\G^GZEPALG\\E\\Gb@EVK`AE^E\\C\\E^C\\E`@CZC`@C^E|@CXEhAAZCx@Ad@CfA?@CzB?xB?z@?`B?fA?J@pE?nE?hA?lA?tB?f@@DAv@?v@@l@?zF@fC?\\@tA@v@?nA@bB?vE?|C?|C?`B?n@?h@?j@AfB?\\?n@?dB?n@?fA?nC@jB?lD?r@?rA?x@?BBR?`@?hA@V?vD?tA?V?r@?|@?n@?~A?|A@~A?|A?d@?x@?|@?~@?lA?r@A`B?|@?`@?~@?^?`@?|@?`@@~@?|@?`@?~@?|A?`@?|@?^?`@?|@?x@@z@?~@?|@?j@?r@?~@?~A?|@?jA?T?|@?`A?|@@|@?R?N?\\?Z?T?h@?`B?|@?\\?b@@|@@~A@~@B|@D~@D|@H~@Fz@J|@L`AL~@VvAF\\H^",
                      },
                    "start_location":
                      { "lat": 34.0711732, "lng": -117.5450579 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "6.7 mi", "value": 10710 },
                    "duration": { "text": "6 mins", "value": 373 },
                    "end_location": { "lat": 34.0694168, "lng": -117.7978427 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-10 W</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "iq`oEruhmUFZH^J\\HZFZJ\\J\\JZXx@Vv@Vv@JZJZXv@Xx@Vt@JZ^fAPj@Nf@h@xAHVNd@Pf@Tn@`@jAZ`APd@BHHVVt@Vv@Pb@?@v@zB?@@DL\\FTVx@V~@Tt@Jb@BFBNT~@^fBj@`DBLVbB@JFb@BRBP@NDf@DZ@HB\\Dl@BVF~@Bd@@VFxABh@?D@P@z@@nA?~A?`B?LCjBClCAlA?j@?h@Aj@?h@A`DEzH?f@Aj@AvBAfB?z@Ap@?v@?jA?~B?lB@d@?d@@xCBhCDxC?j@@V?Z?^?V@Z@bD?`@@z@@tA?d@?f@?H?j@@X?t@?p@@lB?T?R?@@f@?nA@l@@pA?Z?x@@`@?D?hA@t@@fDBpE@xB?H@~@?lA?R@fA?T?r@@tA@z@?r@?`@?T?vB?d@?bA@vA?~A@zBBpC@lD@h@?d@@j@?\\@`@?BFlAFbADt@BRFl@BRDb@DVF`@Jr@Nz@Jl@Ll@VbAHXHZBFX`ADLd@~AX~@r@zBTt@Tt@~AhFBJz@pCDLTr@f@dBr@zBHTDNFPNf@\\jApAfEf@`BlA~DPh@Tv@Vv@`@tAb@rANj@Ph@Tt@b@vAVv@`@tAVv@dBxFRn@Rl@d@|An@pBFR`@tARn@Vv@@HDJTr@v@lCL\\h@fBHTh@fBZdANf@BFhAvDRp@j@tBPp@Rt@ZpA`@fBPx@PdAP|@Jr@RbB@BLrADx@F~@@XDfA@`A?^AtEKjCEt@Gn@?@?BAPKjAg@nF[nD?@Ef@?@y@~J]rDc@dE[zDeAnLOxBIzAARGrA?BC~@EjCA|@C|@?DC`CCrF?bAA`A?Z@nC?|A@fC?tC@rA@fDC|@A|BAnA?R?d@?V?l@@r@?l@Bp@?Z@L@f@@`@Bn@D|@Dp@Ft@Dh@B`@Db@Fh@Hx@NlAHj@Hl@Jp@H`@PfALl@Ln@Jf@Pr@Jb@HXPp@Rr@X|@Nh@Ph@Nb@nAjDL^Rf@j@~ATp@d@nANb@l@fBn@jBXx@Vv@",
                      },
                    "start_location":
                      { "lat": 34.0867721, "lng": -117.6868201 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "20.7 mi", "value": 33362 },
                    "duration": { "text": "20 mins", "value": 1207 },
                    "end_location": { "lat": 34.0681089, "lng": -118.1520724 },
                    "html_instructions": "Keep <b>left</b> to stay on <b>I-10 W</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "{d}nEnk~mURj@Xv@Xz@Tl@\\`A?@Vr@JZ\\~@Xv@^bATj@LZN\\^`Af@rAZx@Xv@Pd@@Db@jA@BN`@b@hADLxA~DL\\p@lBl@dBFNZz@bA|CPp@\\~AR`ATlA@D\\nBFZBR?@Hf@@HLhA@F@HD^D`@Dd@BZBRDh@@RDd@Fz@Bp@Bp@@D@d@FhBB`ABvA@J?\\BvABhABxBBr@DfCB`BDfBDvG?tA?bC?h@?pAE|BMlFK~CQjFOdE?l@MtBMdAc@fDy@zDQr@A@q@tBeAlCADw@dBe@bAKRe@`ASh@M\\w@|BENQf@Uv@GTADGREJKh@Mf@]xA[zAg@dCUhA]dB[~A]bBWrAm@vCKd@_@nBCJKj@E^ADIh@Iv@Gv@Ej@GpAC^A`@A~A?x@BfA?HB^@^Dj@Dz@Dh@Fj@JjA?@@D?@BP@L@PD^?@JdA?@@JDZD`@B^BZD\\B^Bd@HtAB^DxA?F@tB@Z?|AAr@CzACxAAbAARC~A?f@AXCvAAx@AbAAz@?JAp@?`A?v@?j@?d@@t@BrAF|ABx@Bj@@VFdA@^HdBB^B`@D`ABb@@VD`A@\\@z@@`@?`@?@?\\?\\A^A`@A\\AZ?BC^C^C\\E`@C\\E^E\\Gb@EXCLKn@Qv@ERAFK\\Mh@CJCDCJCFIVCJMZKZKTELO^GNKVKV[r@ABKXO\\Wn@O^Yn@Qb@O^m@vACFmBvFGX_@vACLMd@GXShAKp@G\\E\\G^E^E\\K|@?HGt@CZC^ALANA`@C^A^A\\A\\?@?^A^?\\AfE?RA~@?j@?h@?@?f@AlCAnDAvB?h@?N?d@ApD?P?|AA|A?r@AdBBdBC~HA`DCfEAfEAtF?hAC|JA`DAfGA|F?rBAbC?n@Ad@?^A|A?`BAvB?vA?j@?rAAlA?\\?f@?r@ANA\\?VA\\AZ?VAF?PAX?B?^?\\?^?N?P?^A`@?X?`@?\\?L?N?Z?b@?X?T?D?LAP?B?t@?R?b@?NAl@?XAX?X?V?X?X?V?B@P?P@R?H@P?H@L?FAfA?N?L?R?J?NAN?^?L?RAZ?p@Ah@?n@ARCnBAzICnHArA?`A?~@A`DA~HAd@?~@?R?h@ExN?L?p@AzHA|B?n@?J?XAp@AdG?j@AjFAxCAbG?xAAp@CvI?@?ZAhCD|EAxACbC?p@EvGCxB@t@?`A?fCAZ?l@AxAAhE?jDAfB?`C?|B?l@@Z?xAAR?H?xBAzDAdCAhF@dADlBBdAHfBFfAL`CBl@FbAHnBDr@@\\RpE@XDdAHvAFnAL|BBh@VpFNp@bAnStApXJ`CFtA\\xHN|B\\nGXzEJ~AB^RnCLtBRvCF|@Fx@F`ADt@Dz@ThDP`CVrDThDLvBBhAD`@P|CVhDDj@BTj@~HNjBDt@LjBThDDh@N`CN~BB\\PlCj@hIDl@NxB^|ENjCDh@VrDBj@f@`HPfC?@z@bLj@zILhB`@vFNrB^~EDj@Dh@b@`G`@hFLdBJvAFd@N~BBl@BRL~BHxATvD@ZDh@Bf@Dn@T|CVhDJhAHhA@`@T~CFn@JjATxCJzAJlA?BDd@Db@BZ@VB^@b@@\\@n@?t@AV?J?ZAZC^A\\Ef@CXCTMfAW|BKt@CRGd@m@hF]xCCR_@nCG^ALABU`BCVIh@A@Mz@Q|@ABIZI^GVI\\Ql@Ol@W~@KXIZQf@k@|AcAzCCDM^ADs@vBIZa@jAYbAGRGTQn@Kf@Ox@ObAKl@Gd@E\\Ir@MvAGr@?HK`C?@AfA?|@@r@@h@DjFBdD?x@BjABnDDlDDlD?f@@nA@jD?vAA|ACvC?@?NCjCOrG?d@A@?f@G`B_@pIMrBCh@Et@K|Ag@jHMpBGh@Ej@C^OzBATCREd@Gj@CTIr@Mv@Kn@G\\GZc@rBWz@k@jBQd@s@rBQh@St@eB|EUt@Wv@k@|AeApC_@|@Sh@Sn@]nAQt@Or@Kf@Ip@AFEf@Gn@EZANA\\Ax@Ep@?d@A`@@F?H?V?J@L?X@FBvA@T@TDlC@t@FbC?xA@dA?|@@zC@h@?T?~BB|B@tA@bB@dB?|@@d@@rB?^?^BxD?lA@tB?~@?`A@~@?j@BvG@dC?bC@pB@jD@fEBzD?z@?x@BdH?Z@~DBlD@|DBbK@pB@jC?dB@lA?jA@nB@xA@vD@tEBlI@nE@pA?vA?J?V@~@?z@?j@?R@|@?l@?j@@H?^?T@dD?h@?D?F?B?D?HBnI@`C@tD@|D@~@?t@@fC?`EApBArBCnBCzBCbEAtA?tFAzB@~BBjBHzCFvADx@DlBBp@@hABfA?vBBtG@dC@j@?p@?bC@V?bA?`@?\\@zA?`A@`@?t@BbH@~C?xA@bB@|A@`D?X?|@@|@@dD?pCDzI?h@?f@@pA?~@?~@@xB@bCFrR?h@?h@@jA@|B?L?pA@z@?|A?H@v@?hB@|@@bC@jE?p@?p@@|A?\\?x@@RA~BAtA?j@?\\@nC@hA?xA@jB@jC?~A@xA?zA?Z?BA~@A^A`@Cb@KtAMzAC`@Gz@E~@?\\?`@@^Dz@D^D\\H^H\\HZJZN`@j@rAr@~AN`@f@hA\\x@f@hARb@Pb@BF\\x@f@hA\\j@h@nAd@fAb@bADHFLXr@JTl@vAn@xA`@`AJV",
                      },
                    "start_location":
                      { "lat": 34.0694168, "lng": -117.7978427 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "2.9 mi", "value": 4722 },
                    "duration": { "text": "3 mins", "value": 173 },
                    "end_location": { "lat": 34.0554787, "lng": -118.198992 },
                    "html_instructions": "Keep <b>right</b> at the fork to stay on <b>I-10 W</b>, follow signs for <b>Valley Blvd</b>/<wbr/><b>Long Bch</b>/<wbr/><b>I-710</b>",
                    "maneuver": "fork-right",
                    "polyline":
                      {
                        "points": "u||nElqcpUFVd@fALZXp@h@lANZL\\h@jAj@nAL\\Xp@j@nA\\z@Zn@Xp@\\v@Zt@JX|BjF\\v@Pb@^|@FJ@DNZLZHTFNL\\JVVt@h@nBHXJ\\Nh@N`@HPBHDJDFFJJTLRHLPVPTRVNNVVVXb@d@TVPRRTDHJLNVNVDFHPLXLV?@LZDNBHDNLb@@FH^FVDZBVD`@BT@J@`@@\\@d@?P?^?^AH?R?FAVA^C\\C^C`@Gt@AFG|@C^Cb@CXGz@ALANEb@C^AXC^A^A\\?^?\\?^?^@F?V@R?JB^@R@H@F@VDb@DZD\\Hb@DZH\\FX@FFTBJDP@DHT@FHT@BVt@HXFNDLHXL\\HTf@zAd@tAVr@Rn@b@pA`@jAh@|AZ`Al@dBpAzDBF@HLl@Xt@Vz@JXVt@?@JXL\\JXJXJZJZJZLZJXJZJXXt@JZJX@BHV@?HV@@Rj@DLf@rAVp@Rf@Tl@LZJX\\bADJJ\\JZJ\\H\\FXH^HZFZF^F\\D\\F\\D\\D\\@R@LDZB\\B^@\\B^@\\@^@\\C^?x@?RApGIjJGtGA|AAz@C`CAzBC|BCxCA|@?\\A^?\\?^A^?Z@`@?\\@\\?^@j@Bp@@\\B\\@^B\\BZ@N@N@X@DB\\",
                      },
                    "start_location":
                      { "lat": 34.0681089, "lng": -118.1520724 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "1.7 mi", "value": 2675 },
                    "duration": { "text": "2 mins", "value": 100 },
                    "end_location": { "lat": 34.0527432, "lng": -118.2263097 },
                    "html_instructions": "Keep <b>left</b> to continue on <b>San Bernardino Fwy</b>, follow signs for <b>US 101</b>/<wbr/><b>Los Angeles</b>/<wbr/><b>I-5 N</b>/<wbr/><b>Sacramento</b>",
                    "maneuver": "keep-left",
                    "polyline":
                      {
                        "points": "wmznEtvlpUNz@D\\B\\D\\D\\B\\Hz@BRJfAD\\D\\D^DXD^F\\F\\FZH^Hb@FTH\\p@lCHZJ`@Pr@H\\HZH\\FZH\\@HJp@DZD^D\\B\\B^Bd@@L?B@`@@^?\\?`@AZ?JAb@C\\Cb@C`@CXCZIf@Gf@Or@Mt@S~@UnAIb@YvAOt@Mp@CZ?@ERI^Mt@YvAGTIb@Kl@O|@GXEf@Eh@IfAATCd@Ah@?LA\\?j@A\\?~B?L?N?\\?B?D?F?lA?@?@?pA?pC?hDAV?J?H?b@?Z?TBbADxAR~AP`ABLV`Af@xATd@R^HRZf@v@fAz@bA`A~@f@h@p@nAP^Rf@Np@FZNjBBL?P?TA\\?H?JAL?BALAJATC\\Cv@?FC`@?D?L@V",
                      },
                    "start_location": { "lat": 34.0554787, "lng": -118.198992 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.4 mi", "value": 712 },
                    "duration": { "text": "1 min", "value": 44 },
                    "end_location": { "lat": 34.0538629, "lng": -118.233914 },
                    "html_instructions": "Merge onto <b>US-101 N</b>",
                    "maneuver": "merge",
                    "polyline":
                      {
                        "points": "s|ynElarpUAJC^AFATCJ?DAJOnAU~BKhAEZC`@CNMrAKpAQzBMtAOzBCRGbAAJK|ACRAT?TARAb@ARCVEZIdAGbA?BCZ",
                      },
                    "start_location":
                      { "lat": 34.0527432, "lng": -118.2263097 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.1 mi", "value": 198 },
                    "duration": { "text": "1 min", "value": 15 },
                    "end_location": { "lat": 34.0540864, "lng": -118.2360303 },
                    "html_instructions": "Take exit <b>2B</b> toward <b>Alameda St</b>/<wbr/><b>Union Station</b>",
                    "maneuver": "ramp-right",
                    "polyline":
                      {
                        "points": "scznE|pspUMb@CJAJC\\Af@Cl@?FAh@?^?R?J?H?H?LAb@?LAVIX",
                      },
                    "start_location": { "lat": 34.0538629, "lng": -118.233914 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.1 mi", "value": 170 },
                    "duration": { "text": "1 min", "value": 24 },
                    "end_location": { "lat": 34.0545122, "lng": -118.2377978 },
                    "html_instructions": "Continue onto <b>El Monte Busway W</b>",
                    "polyline":
                      { "points": "aeznEd~spUAVGd@K~@Gl@GVCLCPa@nBCL" },
                    "start_location":
                      { "lat": 34.0540864, "lng": -118.2360303 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "482 ft", "value": 147 },
                    "duration": { "text": "1 min", "value": 34 },
                    "end_location": { "lat": 34.0552449, "lng": -118.2391171 },
                    "html_instructions": "Continue onto <b>E Arcadia St</b>",
                    "polyline":
                      { "points": "ugznEfitpUIXQf@CHMVABMVCDADQXS^INIPCDOX" },
                    "start_location":
                      { "lat": 34.0545122, "lng": -118.2377978 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "0.3 mi", "value": 522 },
                    "duration": { "text": "2 mins", "value": 95 },
                    "end_location": { "lat": 34.0515659, "lng": -118.2424561 },
                    "html_instructions": "Turn <b>left</b> onto <b>N Los Angeles St</b>",
                    "maneuver": "turn-left",
                    "polyline":
                      {
                        "points": "glznEnqtpUEFEH|@t@HJJHJHf@b@BBZZXZf@d@LJt@p@`A~@ZRHHFBBDl@b@r@j@HFVNXRp@d@x@l@|@v@",
                      },
                    "start_location":
                      { "lat": 34.0552449, "lng": -118.2391171 },
                    "travel_mode": "DRIVING",
                  },
                  {
                    "distance": { "text": "443 ft", "value": 135 },
                    "duration": { "text": "1 min", "value": 38 },
                    "end_location": { "lat": 34.0523525, "lng": -118.2435717 },
                    "html_instructions": "Turn <b>right</b> onto <b>1st St</b>",
                    "maneuver": "turn-right",
                    "polyline": { "points": "iuynEjfupUWb@g@t@QTs@jAU`@" },
                    "start_location":
                      { "lat": 34.0515659, "lng": -118.2424561 },
                    "travel_mode": "DRIVING",
                  },
                ],
              "traffic_speed_entry": [],
              "via_waypoint": [],
            },
          ],
        "overview_polyline":
          {
            "points": "eir~FdezuOxyFzfFl`G|qZvtSzqo@d}EhlLtqIdjFhrTfvEdca@{_@p{\\~`\\f}MprT~qRbyPnvObbXd_TxaEdxYxjRxvUnz\\bDfeLbpLxv@pmLroD`fTxrYfkTti\\xp@baMj_MoG|xNrlNpiL~cKn`OloFroRbk@lmDn_FnxHnQnz^~Thlo@uVlcc@|rQrnM~lAvlP|sH~qUlkPbzRxvE`cF~rPn_K~b`@tbDpx\\toK|_g@ldD|s_@piIzwc@nzNtlNdrKxoTtkXpeXrsO`l_@brWbkjAptBxoa@npNfiRv_QtcbAxpBlwb@rt_@ry`@pcKjtPpuPj`H`mNpsFjzHfpN~hIdfbAp}JfxY`Fxo^vdUnhq@}k@~`bAkMvli@cClxIjmGfHblG~bRhtF|eI~jFffQzsLldRr`WdrKxtKxb_@zlNrxU|qUpfYdwNpzP|rRxsc@zgWfdYtdBrqR|~Iz~Qv`ApvRntK`jI`cZz}n@nsW`mcA`}WndvB~iCdiVpjJnlErfNplA`i@bcGojCpsl@yeEn|l@{hDtsu@tl@lxs@~~DditAjcJzrf@~qIr`l@bbJrme@~rI|zC~dBfrO|yEdne@qAj{y@Qrsj@diAdns@l}EpnYwmDjn|@ywAbso@~kB|au@`{Alj|@csLzxcBl^|cr@fyJvwd@rxNxnlAyuJhqWjtCbmy@lwNjwpA`cSdimApgBxeNwbCx~_@{dB|y~@cyC|tfBxU~di@inFpxi@_bLpad@~wEbcNkJdxTwkDdeX`aHxh\\pgKlhs@r]`c_@imGdjUeCvnYajFfnN`Gd}c@u_Unm\\itMldMinIpgBadIzhLskDdy\\}iFz|UuvPnfo@v_A`}n@nvR~da@pdS`qUfnDljY|qLrbRdwO|ig@jtKt}k@frM~qo@~~JpwS~bA~pSgeGbvQc{Bzib@yiWzkuAecD`dh@mjKnhf@qwBl_ZzpDn}Wg_CrfUonH~pVpA|bRapAthi@n|FbgPnd@|p[yi@vjVqzHrhd@cgG|zl@jyE~g^|oLjyYvvBprWlpDrtd@ahHbyhApiBteSxpNzkHjtw@|yDjaPrmTzu@tqZjv@f_TuyGjxL{yMlcFafGh{IxDthNpxC|nZvxBzyUnhEpieAdsN|zw@qmAblk@t}Bhb^gvA|ml@{vPjweAkkDhpj@mmFnyZ`eAnsLjxKbfDnhUnrTdaSjtH``m@f`b@xyBbyGrjJ_|DxyGcyD`~Gfe@drNluRd`GlaC}cBfgObcAhh]vM`q`@|oBvgv@",
          },
        "summary": "I-55 S and I-44",
        "warnings": [],
        "waypoint_order": [0, 1],
      },
    ],
  "status": "OK",
}

XML

<DirectionsResponse>
 <status>OK</status>
 <route>
  <summary>I-55 S and I-44</summary>
  <leg>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>41.8781139</lat>
     <lng>-87.6297872</lng>
    </start_location>
    <end_location>
     <lat>41.8769003</lat>
     <lng>-87.6297353</lng>
    </end_location>
    <polyline>
     <points>eir~FdezuOdCEjBC</points>
    </polyline>
    <duration>
     <value>24</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Head &lt;b&gt;south&lt;/b&gt; on &lt;b&gt;S Federal St&lt;/b&gt; toward &lt;b&gt;W Van Buren St&lt;/b&gt;</html_instructions>
    <distance>
     <value>135</value>
     <text>443 ft</text>
    </distance>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>41.8769003</lat>
     <lng>-87.6297353</lng>
    </start_location>
    <end_location>
     <lat>41.8768866</lat>
     <lng>-87.6307300</lng>
    </end_location>
    <polyline>
     <points>sar~FzdzuO@fC?|@</points>
    </polyline>
    <duration>
     <value>20</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt; at the 1st cross street onto &lt;b&gt;W Van Buren St&lt;/b&gt;</html_instructions>
    <distance>
     <value>82</value>
     <text>269 ft</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>41.8768866</lat>
     <lng>-87.6307300</lng>
    </start_location>
    <end_location>
     <lat>41.8689131</lat>
     <lng>-87.6305960</lng>
    </end_location>
    <polyline>
     <points>qar~F`kzuOlBAb@?zA?\CnBAZAt@?P?xAAl@C~EGxA?pAAJ?bAAL?NDr@?d@@J?f@?XAf@?rBAH?T?\?B?v@AZ?</points>
    </polyline>
    <duration>
     <value>182</value>
     <text>3 mins</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;left&lt;/b&gt; at the 1st cross street onto &lt;b&gt;S Clark St&lt;/b&gt;</html_instructions>
    <distance>
     <value>887</value>
     <text>0.6 mi</text>
    </distance>
    <maneuver>turn-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>41.8689131</lat>
     <lng>-87.6305960</lng>
    </start_location>
    <end_location>
     <lat>41.8529490</lat>
     <lng>-87.6300619</lng>
    </end_location>
    <polyline>
     <points>uop~FfjzuOJEBAB?d@Az@ArACXAl@?V?V?VAb@?jBA~AAJCpAKb@AJ?dACd@@TA\CR?x@Ef@AzA?h@?lAC|BAt@C^?ZA|ABn@@j@?b@Af@?`@?b@Ax@AnC?rDCx@A`AA~@AhBAnBChBAL?v@A|FGP?bACTAZ?^CN?</points>
    </polyline>
    <duration>
     <value>196</value>
     <text>3 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;S Clark St&lt;/b&gt;</html_instructions>
    <distance>
     <value>1777</value>
     <text>1.1 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>41.8529490</lat>
     <lng>-87.6300619</lng>
    </start_location>
    <end_location>
     <lat>41.8529400</lat>
     <lng>-87.6310536</lng>
    </end_location>
    <polyline>
     <points>}km~FzfzuO?~A?j@@n@?H</points>
    </polyline>
    <duration>
     <value>20</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt; onto &lt;b&gt;W Cermak Rd&lt;/b&gt;</html_instructions>
    <distance>
     <value>82</value>
     <text>269 ft</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>41.8529400</lat>
     <lng>-87.6310536</lng>
    </start_location>
    <end_location>
     <lat>41.8500987</lat>
     <lng>-87.6310927</lng>
    </end_location>
    <polyline>
     <points>{km~F`mzuO?n@\?hACfACjBClCED?fCU</points>
    </polyline>
    <duration>
     <value>36</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;left&lt;/b&gt; onto the &lt;b&gt;I-55 S&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;I-90 E&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;I-94 E&lt;/b&gt; ramp</html_instructions>
    <distance>
     <value>336</value>
     <text>0.2 mi</text>
    </distance>
    <maneuver>ramp-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>41.8500987</lat>
     <lng>-87.6310927</lng>
    </start_location>
    <end_location>
     <lat>40.4505676</lat>
     <lng>-89.0233948</lng>
    </end_location>
    <polyline>
     <points>czl~FhmzuOXPF?r@@n@BV@T?n@B^@@?B?N@LBD@D@NDNFHFJHDDLPJNFLFNFPDR@?BND\@L@L?V?f@?L@F?f@?X@f@?X@BDj@?B@DLv@Lt@Fd@BVL~@BVLlBHzADjA?BFVB|D@lC@xDBhG?j@?fA@X?L?P?P?\@^?H@T@\?P@FB`@Dl@Dj@Hj@?@Ff@Jj@@FHb@DVH\HXHZNh@Jb@h@hB\tANj@H\DRLh@Lz@Hn@JbADd@HhBFpBNzEBrA@RBXFt@Fv@BLD`@Fd@Hh@Nx@BP\|AFR@DNj@^lAL\BJr@|BBFHXn@nBJZfApDpAxDfBlF@BPd@Zx@Vt@DHf@pAPd@Rh@Rd@dBfEbAfCr@zAt@|Ar@bBJPh@lAxCjGp@tAhBtDRb@N^P^Rl@J\FRHXLf@HXH\BFDTFXDVPlABLD\@FBXB`@FjAJnCB~A@|@?n@@~A?V@X?z@@`@?bAB|B?h@@hA?Z?p@@P@bB?X?PBlD@R?n@@rA@h@@rB@rB@lCB\@\DfABd@B`@Fz@Hv@Hr@BNF\X`BVfADPVlA^bBPz@hAnFh@~Bl@bD@?@LBH?@T`A@F^bBvBxJJj@FXLj@Jd@Rz@Ld@Np@TdA~@dEDNTfAj@nCNt@`AnEdA~EdA`FDRDLBLF\Rx@BNFXH^l@tChHr\dBdIFXBLNp@@B?@~@bE`@lBFVzF~Wf@|BDVJf@P~@dArE^bBdAdF`BtHLj@x@tDhAlFDP@BVjAZnALj@ZtA`@rBv@nDFXdA|Ep@`Dd@tBPz@J`@H^DP?@@BfA`Fx@|D~@fEjB`JR`AlAxFH^p@~C\xATlAfBlIhBpId@vBf@vBPv@^fBd@xB~@dE^`Bl@tD@JPbA`@`DJl@T~AF\BRLh@@JDN@D?@@B?BVfAZlAv@lC`@lA?BPh@DJVz@vEnRp@bDXnAl@nCn@xCTbAp@xCxBhKjAjFNp@VlA`@lBvAnGVlAh@bC|BnKh@dCHZBNJb@x@xDb@rBDPrAjGLj@jAnFFXlAtFvAxGR|@fA~ERdArBpJ|DlQdCvLjBxI|AhH|BnKJd@@FnCdMdCdLBJZxAf@~BdCdLf@|BLl@^dB~BpMHd@r@xELdA?BxAdNVdBRtAHf@Jj@Jp@^hBHb@BFf@dC^vANl@|@~CBJNd@BD^lAbApCNZrAlDtAlDHXLb@@?Jd@J^H`@Hf@F`@D`@Hr@Dn@HrA@\?R@t@?FAjAAt@EbCGbCE~A?D?J?^A|AAp@DhFBX@^Bf@N|AP~APhAP~@BJTdA^tAd@tAh@rA@D\v@Xl@\l@\f@Zh@`@j@n@v@f@l@bA~@^ZFH\\@@d@d@hCdCJJh@f@NN`A~@lDhD\Z`EzDfC`CvBtBdMtLdC~BRPTXf@h@`@b@`@b@vA`BVXh@n@dArAnAfBvBdDdDxF@BjCzEp@fAnBtCrBjC|@dANP~BfCVXZ\ZZ|FhG\^Z\DBzEhFhBnBb@d@NPJJd@f@tBzB~BbCf@f@v@p@nAfA@@`At@tAbAhBrA`Ap@hAv@DB\VXRn@b@z@n@t@f@|@n@dBjAv@h@LHNLp@d@zDnCxBzAvAjArArA`AjA\f@V`@T`@b@z@h@hAXz@Pl@Rt@Pr@RfAF^BPHp@JnAH~@|BpZF|@RnCRlC`@pFHlAJnAVzDDn@d@zGx@vKX~D?BBZ@JDl@`@lFb@hGX|Df@~HHlBBn@@b@LbIHtJBxC?FJfQ@xBHtI?vD?LC~CAfBE`DAd@An@EnC?HExD?~C?xD@tF@lB?X?^@|A?t@?D@pDJ`L@dC@bCFpHH|HFpH?P?HBjD@XDrDBx@NnCHrAXdDb@~C?DDXXbBTdAHd@R~@Rv@Rt@DRVz@FPzCrJHP`AxC~@tCj@fB?@r@bCx@bCp@tB?@HVBDHVPf@?@ZbAd@xABDb@vANd@b@rA\bAh@bBz@~C~BbH|AtEh@`BPf@Z~@t@|B`@pARn@x@fCNb@d@vAfAfDl@jBXz@FTv@zB@Bj@`Br@nBN^HPRf@|CjHh@fA`@v@x@bBtBzDDHPZvBrDr@fABBv@lApBvCrAfBp@|@~ChEX`@bCnD`@h@f@r@b@v@b@r@^p@@Dj@bAf@bAJVR`@Zr@Xn@j@tA\z@^dAh@|A\fAd@rALf@Nd@HVBFRp@t@hCL^BJPl@^lAL^BJL\v@jCNf@~AnFHVp@zBrAlFt@xCf@rB|@jD`@hBDTDNb@fBDTx@hDNj@z@lDhBpHJb@z@hDH`@VbAp@vCnAjFT~@Ld@dApE\pALj@jDpNf@pBTbANh@Lh@Rx@dAjEH\Lf@l@hCPp@Pr@vAzFNp@Np@dCbKb@~A|BlJH\`AhEjDnNb@dB@BJ`@n@hCJf@Lh@Lf@@Bf@tBBLl@dCRx@\tAp@pCf@tBd@hBd@pBZpAd@hBj@pB~@dDNj@JXdAhDj@~APh@|@dCz@|Bt@nBBDr@fBr@dBhApCr@fBvBnFTj@l@vAnBxEZp@bC`GzCfHPb@`A|Bb@bAj@vAtAdDzAnD^z@\x@h@rAd@fA`AzB`BzDDLb@`Af@lATf@h@rAxBhF|@vBlArCJVr@`Bj@nArBpFx@nBJVrAfDpArClCrGrBvEd@dAnBvEt@fBbB~DnBtEN^FJdBfEjBlEBFJRh@rAHPN\dBbER`@bA`CLZdA`C`@|@jApCzCjHlAvCh@nAVl@n@vAd@hAtCzGDJN\Vp@Vh@fChGVl@h@pArB~EzApD\|@jClGt@fBt@fBL\Rf@BBh@nAdBfEzEfLt@fBFP@B@@HTzAnDP`@l@xADJtAbDTj@\x@pB|E^|@`CvFBHTf@Rf@x@rBfBhEh@nARf@rFtMJTFNJTFPLXFLDNFLFLJXtSbg@Xn@x@lBjArCDJN`@Vj@j@rAv@lBRb@Pb@FN`AzB^|@@@Tn@@@b@hAx@jBPb@hCfGDHVn@h@hARf@JR~ArD~BbFhBzD\t@`@x@rA~CxA`DzAjDXp@z@jBl@|Av@hBnA~CxD`Jh@pA@@jBlEj@rAt@fBt@dBVl@v@nBxBjFdD|HxBjFN\BHLV@Dp@|Ab@dArB~EP`@d@fAnBvE\x@DJt@fB\x@lBrEZt@t@dB`@v@fF~LL\zAlDn@bBp@bBpAzCh@pAx@nBP`@jDfId@fAFLvAhD@BJVZr@dDzHJVxCbH|ArDh@nAnBvEz@tBp@~ABHLXBF@@HRVl@P^DNd@lAdC|F@DP`@@B`DvHtExKxDhJN\N`@Th@HTDHVp@h@vAj@|A@Dl@bB`@rAh@xA|@pCh@~ARp@Ph@?@vAnE`AzCTr@b@rAb@nAhArDfAlD|@pC~@tCpA`EdAtCp@jBt@jBt@hBn@zAp@zADLlCxFz@hBVh@Xn@fA`Cp@vAr@zA`@|@l@nA~@rB|CvGx@dBbBnD|CrGpC`GlAjCTd@DHhBzDP^h@lAj@jABHpApC`D~GnC~FbCfFLXjAjCtBpEhClFfCdElArBtCzDTZlCtC~BbCfAb@^XDDt@d@h@XlAr@lAl@tAl@x@Xx@Xp@RNFPD@?h@Nn@NzAZ^HVDj@HP@d@HTBJ@f@Dj@D|@Fl@@h@BR?X?h@?b@?fA?jJEzFC`AAb@?b@?rDCdEApHEb@?rDApAA|@Ab@?zBAfECb@?rDCb@?J?fDAzECbIEvBAbEAlDCtCAlCApAAfA?rGCnAAbCAb@?fAA~QIlBAb@?vJGnDAfDArCC~JEfJOjA@l@@jCJhBHN@XB^D^DLBVBTFRBZFb@Ht@Pj@Rl@Rl@Px@ZXLnB~@jAr@r@d@v@l@ZPj@d@d@`@b@^z@~@xA~Az@hAr@~@b@f@bDlEv@`A?@Z^X^PVrAdBX^RV@@pAdB`C|CV\d@l@nA`BbArAdLdODFDFHJrBlCX^p@z@\d@rA`BHHn@x@vAxAZVp@l@x@p@h@b@@?\V\V^Tj@^rBlA`@RhAf@z@\x@\h@Ph@Pp@Tl@NHBz@PdATj@H|@Nt@H`@Ff@F~@D|AH~ABrBAB?lCEd@AlAA`@A|CEr@Ab@Ab@Ab@AlACxACvBE|GKvIKhDIzBCbKQb@AfAAl@C~JOpGKvBE`@AfJM~EI|FKdGKv@AzKS`CGzFI`BCxCGz@AdCET?ZAV?PAxACvAAz@A\?H?t@?jABx@Bt@DN@lAFr@FvAPv@JhARfARjAVt@RtA^fBj@pAf@~@^hAf@BBj@VpAr@n@\^TfJvFxK|Gz@h@t@d@hC|A|AdARLlIdFrBlAHDfAp@lBlAlDtBnAx@nFbDhDvBhF`DjEjCrAx@^VDB@@XNXPtAx@l@`@jC`BhAp@^T^TtFhD@@dAp@t@b@jBhAlAr@p@^jB~@v@\VL^Np@VdBj@r@TLD`@LD@ZHVFn@NVFd@HdAT|@LF@B@dAN~@Hj@FfAH~@DtAFrABzA@pDENAb@?D?\AhDEtBCxDGp@AN?lEGlEEvDGb@AfAC~CE|EGrDElFIvBEnBEjEGdCEtCEhDGlFGnHIfBA`@AzBCpAAT?bEChB?nA@vD?h@?j@?j@?`BAlAAnA?B?F?~@?@?^Ad@?tACX?D?|@A\?zCEZ?B?@?ZAzDEjAAhAAl@A~@Ab@AbBCF?b@AlBCh@AzAArBAhAAjACb@ApDKjBI`@C`@AlBIlAE@?ZA@?h@CVALAR?^CbCIZC`@Cd@Ah@CVAbAE^A`@A`AEjAEh@AtBKnAEn@ChAExAGJ?|DO@?`@AJ?xKOL?dBEN?p@Ap@A|AED?ZA^?D?fAAB?X?DAjBEJ?P?DArDG`BEfCKxACtAGfBEtCKd@ApDMF?v@CbBEr@Cb@AJ?VAVAZAt@Cn@A^Ah@A@?zBERAN?D?~@Al@A`BCb@Ax@AL?T?L?RAdEElCETAp@Ab@?fAAx@CL?fAAb@AT?LAnCCjACT?hAC|AChAAX?b@AH?zBA`@AN?TAl@AlAAj@A~@CJ?F?r@AR?N?jBCPAd@?l@AD?J?p@Al@AT?L?VAV?hAC`AA~@AbAAj@AZ?nHMl@AJ?vBCd@?VAV?d@AF?N?F?F?PAjA?@?dAAl@CF?V?xCE|@AlAAnBEhAAhCEnCGfAAXAH?nCGtDI^?B?b@?lC?\?tBE`BGH?rBIz@I\Az@GnBObCSdBQzAM~BQbAEdAGtAI|BIFAvBEZ?VAH?XAF?bAAZAdCCL?V?rACP?`@AT?l@AbAA^?^AV?JAz@AV?TAbAAn@AtAAh@Ah@?f@AtCClHIzBCRA@?fEEpAC`GIhDCzCElDGjDCbKMdKMlAAB?|OQtKMDA`AA`DEN?|@A|EGjBAP?t@AN?v@?fA?X?l@?J?`C?dJ@H?X?\?rG@N?b@?D?v@?V@N?T?P?B?RAJ?jA?dB?B?^?nA?dAAfCA^ARARAj@ETA@?P?T?V?R?P?h@AD?j@ATAT?R?T@D?N?f@AX?T@f@Bb@Ab@?b@Ab@AfAAb@Ab@?PAvCEpACb@AL?zAE@?LAR?@?tAEj@AJ?vBEvAElBEbCGlBEj@ApBEPAj@Aj@A`AAb@A\?vAClBCnAA\?jBCfBAtAAvBCB?Z?fDCjDCrCCzAC|@?~BCj@?J?fDCbDEr@Ad@Ah@?j@?TAT?j@AT?T?l@AhA?|BCzBAzBCvCCvCEnC@zEIvJGF?vLK~HE`GGtDCxCCxCEL?jBC\?DAhDEdFKh@AdCEjAAnFIxCGh@Af@C\?TAtAAfZi@l@AfT_@j@?h@AV?R?T?R?T?T@T?d@@p@BV@T@TBT@P@n@FT@RBVBRBRBXDRBNBXDh@HTDTDTDd@Jj@Ll@Nh@Lf@Nj@Nf@Ph@Ph@R|@\f@Th@Tf@VRJd@TPJVLFD\Rz@f@PJPLPLRLPLHDHFRNPLPNRLPNPNRNPNPNPNPPPLPRPNPPPNPPNPPPPPRVRPX\?@`@b@b@j@^d@NR\b@LRPTj@z@l@`A\h@j@bAh@`APZFLNXJTLTJVLTJVJVLTJXLXJTJVLXHVJTJXJXJXHVHRFRBH^jARp@JXf@jBdApDz@xCDNn@lBh@|AvDvKZ|@d@jAdCtG`B|D~@~B@BdDrHvA~CfA~B`DvGfBnDx@zAn@lA\p@hBbDvBzDjAnBrAzBv@pAnApBfAdBtAvBx@jA~@tA@Bp@bAv@dA@B~@rAt@bAtAhBn@z@V\dAtArAhBzAlBt@|@bApAh@l@PTv@t@t@z@d@f@PPPRPPj@l@`CfCb@b@vAtArApAVT|@|@ZV@?XX@@NN`@^d@`@b@`@t@n@r@l@`@^B@`@\d@`@JH@@PLHH@?DDtAhArCzBhA|@f@\t@l@f@\b@Zd@\x@j@x@f@VRTP^VLHDDJFPJ`@XZTB@HFD@LJRLNJ^TDD\R@@RJBBVNp@`@^T\RDBb@XVNb@V`@TTL@@x@d@x@d@v@b@x@b@lAn@lAn@x@`@f@Vd@VlAj@nAl@b@Rf@T@@JD\Nx@^h@T`@PB@h@Tf@Rx@\pAf@jAd@dBp@f@Pr@T`@Pf@Pz@Z|Bt@h@Pb@NdA\|@VpA^hD`AhDz@~Ab@pBf@jBb@|HzA`C`@pATvB^H@LBlANtARf@DxARhFn@dD\\DvBXbALb@FrANzAT|@LrAT~B`@H@z@P`AR`@JNBd@L|@T`Dx@z@X|@Xl@T`A\z@Zl@Tp@TnCbA`E`B\Nz@`@v@`@DB`Af@nAp@tAv@zChBjAt@r@b@nAz@v@j@pCtBd@^rC`Cp@j@nBhBn@h@~B|BtAvA`AdARTl@r@vA`B`BpB~ArBjBhCfAzAnA`BdAvAz@lAlAbBn@z@t@bAb@l@\f@d@l@^h@n@|@z@hAz@lA~@nAdAvAzArBvAlBzAtBz@lA`@h@`@j@|@jAbAvAt@dADFj@t@b@l@`BzBLRJJtC|D`CfDrAfBh@t@@B^d@PVzArBpK~N|GhJ|GjJlBhCj@x@l@v@lAbBlA`BZb@V\nEfG@BV\fBbCX^BBhSvXV\dJbMV\T^b@h@X`@Zb@PVbCbDX`@d@l@dDnEx@hAv@bA|DpFnEbGn@|@|EtGbAtALNp@~@h@r@p@`AlA`BdCjDn@x@^f@r@`AxDhFvDdFbArAb@l@DDRXz@jAnAbBdCfD`BvBrAjBhE~FjA~A`DhExArB~ExG|GfJp@|@rBpCt@bAb@h@f@n@NP\b@^b@Z\VXXXn@n@t@r@ZZXVPNRP\Z~@r@hAz@pBrAz@f@nAr@DBzBbAj@Tz@^t@Vd@Nv@V~@VtAZ|Bd@`APbAPb@FxAThAPJB`C^tGdAvBZnFx@dG`A~AZ|@TbAXz@Vp@RXJp@Tf@PbCdA|At@fB`AVNPJRLRLFDHDRNRLPLPLRLPNRLPNRNNLRNPNPNPNPNPPPNPNPPPNPPNPr@t@`@b@PPNP`@d@^d@^d@bArAPTzCdEZ`@|CfEnGrIvC~Db@l@`_@hg@Zb@pBjCNTX^jGrInDzEdAxAz@fALPtIjLb@l@jKnNZb@RXJLNPLPPTRXV\\h@rAfBlFlH~ShYbAtAfB`CzGbJrBpCjFfHtBrCp@|@h@r@bAtAtJtMzKdOtS~XtMlQ|CdEDFX^nBlCfAvAdLpO|B|C`@h@lEbG`ApA|@lAl@x@p@|@|@nA\b@RVlA`BLP^f@RVJPn@z@n@z@l@x@p@z@~@nAl@z@n@x@l@z@p@|@^h@\d@\f@^j@Zh@V^FLNTLRLVZh@LVZj@Zl@Xl@Vl@Xn@Xp@Zp@Vp@Rl@Xr@`@hARp@Vx@J\`@tATz@Lj@HXFRDVHXPt@Ln@Pv@Nz@Nz@RhAJt@Hl@Jv@RzAHn@JfALjAb@tE~@pJ|@hJ`@bE^rDT~BFr@XrCXxCHr@tAnN\vDFl@Fl@NrAD`@B\Hv@RtBvBvTt@|HNvALhAJnAd@~E^lDvBbUJdAx@fIJ`At@bIv@bILnAXlCPdBN|ALpArA`NLrANnAN`ALt@Jv@Nt@Nv@Nt@Pt@Pr@@DNn@Pp@Tr@Rr@BHTr@L\d@pARf@p@`BrAtC`@t@f@z@f@t@f@v@Zd@HJXb@NPX^BB`@f@RTb@d@NPDDd@d@VV^Z\Zb@^l@f@b@\DBp@d@t@d@r@^HDhAn@|@d@^N^P`@Nb@R`@N`@Lb@PF@h@PjAZv@Rr@NtCb@TB`@DdAHhAHb@Dd@BrCTvAJpAJxCVvBPfCRRBT@jBN`@D|ALP@N@`@DvAJhKz@vALN@l@FlBLnCTfAJ\BD@ZBb@DF?`DXf@Dn@D~DZVB~Gj@t@DJ@fBNv@Dd@DdAHpDZB?`@DRB`DXl@DtE^dAHXBbAH~MdAjDXd@DlAJr@Hf@Fj@Ht@J~AZlATjAZn@PZHn@R\JTHXJXJr@ZrAj@z@`@^Pb@Tx@d@d@Xd@Xf@Z`@Vz@n@l@b@jA~@h@f@b@^nAjA|AbBh@l@DDv@~@NPb@j@fBbC@@jSpXtAjB\d@`BxBvG|I|@lAzFzHjFdHpAfBn@z@nEdGp@|@jKlNpAdBlCpD|BzC`ApAX^r@`A|@jAjCtDdAvA|@nAtCxDpAbB`@f@jAtA`AhAx@z@|@|@j@h@h@f@fB`BpG~FzAtAnF`FpBhBjC`Cn@l@rAlAt@r@lBbBxAvAh@b@|AvAn@l@nF|ElBhBpG|FzElErChCt@p@t@r@xClC~DrD~EpEn@l@jHtGfAbAvBnBvDlD|@z@f@h@^`@X^\`@~@hAr@|@d@n@~@vAr@fAt@nAb@z@bAnBh@dAp@|Ah@nA\~@Xt@b@lAVt@Rr@Ph@Vz@r@fCTbARz@Pz@XvATrATpAX~ANdA\tB\jBb@rCl@tDZhBnA|HdBrKxDxURpAp@`Ev@tE^vB\vA\vARr@ZfA^fAZ~@Rd@Rf@Tl@P`@Vh@Zn@Zl@\l@Zj@\j@^j@^h@^h@Z`@BDb@f@^b@`@d@b@d@b@b@d@`@b@`@d@^d@\f@^f@\d@Zf@Xf@Xh@V@@f@Tz@`@j@Rh@RTHj@PTFh@Nj@L`AThI`BbDp@tE~@zBb@bATbARZFxE`A`@HbB\`ARnAVxBb@bB^nFfAH@`Ez@pAVrAVzBd@x@P@?tB`@|Bd@HBjCh@bGjAbB^xAXjAVpDt@jB^xAXx@PxE`A|Bd@fCf@v@PfARv@P~AZtBb@TD|AZtAZ\JjAZfBj@tAf@f@Rr@ZlAj@h@VtAt@fAp@l@^hBnAr@h@t@j@dA~@xBrBrDdDz@x@|@v@rBjBh@f@hD|ClAfAfC~BbCxBvArA^Z`A|@dC|BnAhAnAhApAlAhB`BjC`CfD|Cj@d@fC~BzAtAhD|CJJlLpKtBjBd@b@hAbApBjB|BrBxBpBbB|AxCnC~BvB`BvA~AvAvArAnBhB|BrBpBhB`DvClC~BfD~CtDhDfC|B`CvBjD`DnE~DtApAlBhBpAtAxAbBz@bAdAvAh@p@bAvAbBdCJR^j@h@~@Xf@l@dAj@hAr@vAd@`AJRLXVh@`@bA\r@HVN^Th@@DFPJVJVJXh@xA~CxIf@vAvCbIzAdEf@rAPf@|AhE`AlCHTZ|@dDbJtAvDf@tAh@zAx@|BnBnFL\t@rBBDv@xB|@bCpCxHPf@bCzGrC|HjCjHdAxCRf@tCbI`@hArC|Hl@`Bh@zABD|@fC`AlCFPnAhDvB`GjAdD\|@x@|Bt@rBb@jABJ^~@Xv@FRzDpKxAdEv@xBBFdCvGd@nAhAdDbCzGbApCbAnC`@fAJ\pBrFx@zB`@fAz@`Cj@zAJZDJd@nAPh@HPtAxDj@~Ah@vAt@tBv@vBTn@N\j@zATn@bApCDLnF`O\~@rBxFjEvL~CtItAzDJVFPlA`DjCvHh@tA\`An@bBhBbFt@lBvA~DRf@b@pAd@pAlBnF@BpCzHBFrAvD`AjCf@tAzAbEHXzAbEl@dBz@|Bd@rAdCvGlDtJv@tBTn@Vr@Tn@b@hATn@f@fAVl@DJTb@?@Xj@Xj@\l@T`@Zh@b@r@RXV`@X`@FJ^f@nA~Ax@`AnAnAb@b@p@n@d@^HF\XLJz@n@hAv@rBlAh@Z|@`@b@R|@^f@Rh@Rj@Pf@P|@TtA\JB^Fh@Jj@J^Db@Fz@JbAHVBt@Dr@Dl@@f@@^@h@Ad@?h@?^AnACz@?H?z@BV?j@?tA?dAAfECp@?lBAjB?pDCb@?jC?lBAj@?`A?vAAtAAvA?dCA`CA`C?bAAtA?tA?bAA~@?hAAnC?@?nBAlB?tAAl@?B?d@?j@Aj@?`A?|AAvEArBArA?lAAvEApA?l@?j@?h@A`A?F?v@?bAA~@?hCArAAX?H?vC?nCAzOEb@?b@?pCAfB?`DAxCApDA~B?`KC~UG~B?j@AbA?~@A|@?n@?j@@h@?^@`@@^@`@Bl@Df@Bl@Fh@Dh@Fl@Hh@HZDd@Hr@Lt@N`AT~@Vf@Nf@NTFTHh@Px@Zj@RZNXLZLNHLFNFZNVN|@d@`@TVNFDxD~B|FnDjAt@rBpAlAt@`BbAVNhAp@n@`@FDlAt@d@Xd@Xz@h@d@Xx@f@lAt@x@f@f@Z`BbAd@Zl@^bAl@`EfCr@b@XNf@Zz@f@b@VTJPJB@d@Tf@VRHRJTHh@T^PXJVHf@Ph@PrA`@hBj@pA`@pMzDdDbAd@Nx@Tn@T|@Z`A\TJVJ\P\N`@R`Aj@^Vh@Z|@n@`An@ZTZRtOjKhErCv@h@x@j@jAx@lAv@rBtAdCbBp@d@h@\~AdArA|@tA`Ax@h@dC`B|AdAvBvAjAp@h@Xn@X|@b@p@XXJv@Xx@Xt@R^JZHz@RlBb@zCt@~Ct@z@R|A^tCp@d@Jp@PpCn@pGzApP|DZHbE`ARDjCn@vTfFzD~@l@NfDx@\Ft@RB@pDx@nFnAbIlBVFlAX|HjBx@RnAX|A^~Bj@lDx@|@R|Ct@jFjA`@Jh@Lf@Lh@LZFvBh@r@RlA\bA\bA\DDlAf@jBz@dCpAnVvM`IhEpLnG~JnF~MlH`Bz@jE~BpDnB\PFDdFnC^R|@f@dB~@lFrCfCrA?@hAp@x@f@h@\v@j@VP`@Zr@j@l@h@~AvAx@z@v@x@x@`APRf@l@p@z@TZRVf@t@PTFJrDpFf@v@Zd@nC`EHLpAlBxCpEh@z@`B`CxAzBv@jAlAhBdBfC`@n@NRp@bAh@v@d@r@X`@n@bAx@jAPXtApBLTbBfCh@x@bAxANTT\n@~@bAtA`@f@d@h@d@f@b@d@b@^t@p@p@f@\V`@XNHTNd@XFB^R^RRHLFb@RXJ@@l@ThA\x@TXDb@JB@\Fr@L`AJ\D^Bf@Bh@B~CBj@@p@?n@?HAbBCv@A\AjAA|@Ax@?^?j@AnA@d@A@?d@Ab@AR?N?RAL?`AAL?dDCV?nBCj@?|BC\Az@?~DE`@?R?JAlBAlAAh@AzBAf@AD?b@?|GGlDC|DC|HGfAA~HGdBCl@?dAApCC|@Ab@?H?zAAfDCz@@rABb@@h@BvAHx@HF?b@DJ@z@JfAP^FH@XDXFfATdAT~Ab@jBl@zAh@~@`@fBx@xAt@xAv@r@^fAj@`B|@x@b@nE~B`Bz@`Af@^R~BnA@?fCrAdExBXNpAp@n@\~@f@b@TlAp@PHrAr@jB`ADB^RRJ|DtBz@d@h@Xv@`@nAp@h@V\P\Rf@Vp@^n@\\P\Pl@ZHDx@d@h@Vx@d@f@V|@d@`Bz@`Bz@d@VDBlAp@ZNn@Zz@d@pAp@z@b@d@VlAn@nAn@lAp@z@b@`Bz@~HdE^R~@f@dB|@v@b@|@d@fAl@l@Zf@Vf@Vh@XNHpAp@nDlBd@Vf@VRJRLh@V|@f@t@^pAp@FBRJVPXLXPJD^RNHrAr@VL`Af@p@^xBjAj@XvBhAbB|@jAn@fB|@LHpAp@bAh@dAj@dB~@jAl@RJnAp@LHd@T`Af@p@\bAj@pAp@r@^v@`@NHPJPHn@\f@XTLXNdB|@hCtAlAn@nAp@z@d@x@`@z@d@lAn@nAn@nAp@lAn@`Bz@~@f@`Bz@nAn@b@V|@d@z@b@d@VlAn@nAp@pAp@TJNHx@b@TLh@X~Az@j@ZVL\P^Rp@\VNPHXNr@^x@b@~Az@t@^n@\z@d@b@T`@Rp@^rBfAVLnAp@h@X\PD@z@d@\RFD@?BBXNNJ\TRL`@ZPNNJRPXVBBFFJHFHLJXZFFb@d@?@NPJLBD^f@Zb@\f@\l@FJDF`@t@?@Xj@FNXn@JVLZHRJXFRDJ@DNb@JZFVHV?BPl@Pr@Pv@Lp@@FBJFd@@BBLHh@D^BNFd@@ND^PrBPhBd@bFVpCJlAT~BFl@b@vEJrAFl@Fn@Fj@Fl@N|ADl@PhBPlBBNLzA@BVpCTjCNtANfBVpCBTLtA@FFl@?FLrAFp@J|@Fx@BNBZ@PD^@LBVJhAd@`FJ`ALxAPjBH|@Ht@LrAFt@Hp@Hj@Fh@Nx@Hj@Ll@Jh@Nt@H^Pn@Pr@Tv@Rl@Lb@@?Pf@Pf@@Bb@dA@DHRN\`@x@LTNZLRBD@BLR\j@Vb@NRPXJLX`@PRV\PR^b@\\PPTV^\B@FF@BPNB@DB@BJH`@\RLTP`@V\T\RTLf@Vd@Tx@^FDLFrAh@lAd@`A`@bA`@hBt@dAb@b@Pj@Vd@RXJJD|@^D@dDrAxAl@`@Pl@VZLrCjAz@^`A^nAf@VJlBv@~@^LF~B`A`A^pDzALDNHf@RnBv@~@`@dBr@~@^@@b@PbBp@~Ap@JDtChA~Ap@TH|@\JBj@VXJh@RJDb@NdA^`Bh@hA^r@Rz@Vl@PpA\dBb@`Cj@fAT~A^NDpAXzA\rCp@n@N|A^F@`Dr@RDTDJBrE~@vBd@~@Rh@LxBb@lGpATFn@LdATnDt@h@LZHr@Pb@Lb@Ln@T^NHBhAf@v@^h@Vf@ZfAp@bAr@p@h@d@`@VTl@j@f@f@^b@XZl@r@Z`@^d@\f@l@~@xAbC`IlMXb@BFrRb[~AjCrF|IdNzTjMvSfCbElAnB\h@n@bAn@dAVb@p@dAn@dAn@dAhAfBT^p@fAV`@?@V`@\h@zAbCVb@p@dAt@nAh@z@V`@FJxA~B|CdFJNfBtCvA|B~@|ArD~Fp@fAn@dApCnEn@dA`BjCj@~@tAxB`@n@fAfBhEbHhBxCFJx@|At@vAj@nA^x@Pb@Vj@^bAXr@Zz@`@pAVv@`@vAd@dBT|@T`AZrABHd@tBDRbBpHLj@TbAtAhG`@bB|BfKx@lD`J`a@jGxXBNHZhBdIp@xCPt@lAnFBJf@|BfAzELj@p@vCx@tDJ`@Lb@Rv@FPVx@L`@L`@JXTl@Tl@Vl@Th@BDRf@Xh@\p@`@t@Xh@^l@FJh@x@Z`@Zb@HJX^b@h@hApADF~CrDX\|BlC~AhBt@z@xDrEdInJpAxAb@h@zClDjAtAx@bA~@dAh@n@DDtA`Bf@j@|@dA|DvE^b@n@t@fAnABBLNXZt@r@PPb@^h@`@RPHDNJPLB@`@VLHDBTL^R^P`@PNF`@NPHPFVHRFh@NRFb@JXDB@RDXDd@FnBXRB~@JbANhBTbCZd@FZDf@FTDTBVFRDd@HVHn@PLDTFj@Rf@RTJf@T^R`@T|@j@LH^VXTHHLHRPf@d@b@b@\\VZVXRXNRHHRZNRLRT^T`@\l@JPv@rA~BbEdB~CNV\l@d@z@@@LTNV`AdBR\HNNVLTNXLTj@bAb@t@zAlCNVz@|AHPt@pAv@tALR^n@Vf@f@|@jArBd@z@DFbAfBLT\n@\j@~ArCn@jAb@t@n@hAb@v@HNRZ|ApCbAdBDJd@x@|@~A~@`BVb@T`@j@bAp@lANTFLhBbD~@bBr@pAJPBDnAzBlAnBzCpFp@lAh@`Af@`AVf@P^P\Tf@Rf@@@Pb@LZNZL\Pd@N`@L^f@xAXv@Ld@JZRn@FV`@zA`@`BdAhEt@`Dt@xC?@|AnGVfAFVHd@H`@BHJr@Jt@Hh@BRH~@HbAHjABl@Dh@@^@b@?j@@r@?V?N?TAh@?\A??^Cj@Ch@?DEf@I|AKpAOhAyCnTIh@It@Ip@I|@Ej@E`@Cl@ALC`@Ex@?\?NCr@AbBAV?\BpD@l@?p@@Z?d@@bB?TDrI?~@@|A@~A@bB@vA?n@@v@?nA?DB`E@j@?@DjI?\@zCHvM?`BHdO@n@FvM?n@@n@?n@BzD?n@DjFA`ABzCBjC@lE?n@?l@?n@?|AAzC?fAAdA@^A~@EpCCrEEhF?h@AxCAf@Av@AbB?p@Ad@GlKAjACjCCfFCvDAdC?ZAf@?j@?DA|@AX?d@?p@AlBApBA`AAbBCbBAdCCrCCbCA`BAt@CbFA~CIzI?fAAl@?d@C`C?dA?zACzC?xAAvBClEC`DCjDCjCGdME~E?d@@d@@f@@|@R~DBb@Fv@Jx@Jx@L~@Lx@F\FVLp@Lf@Pt@Nj@Rp@Vx@Rj@Xv@@@Rd@FPTf@Zp@^n@NXNVNVXb@LRNPV\PVBDPRBBZ^Z\RRb@b@r@n@t@j@f@^l@^ZRZP^Pb@Tb@Rd@PXJTHRF`@L^JVFTDVFTDRBRD^D`@Fh@Db@Bf@Bl@BlCJV@lCJxJ^|BH`Pl@pBFxHXtNf@vEPfGTbENrJ\l@B|ADbCFfCBbBBpA?jB@z@?tBA~DAN?^?p@?bBAtLCrDAtC?|@ApA?Z?lBAtFA~KCpDAnOCvEAp^IlA?XAzEChB?D?|HAbDApGCX?lIC`A?n@?tGNrBPnALzCd@dDf@~AXpIjAlHbAhAPl@Hh@J^DXFb@FnC`@PDhBXp@JdG~@t@Jd@Fv@F^BXBx@DF?R?r@BN?T?d@@V?RANAn@Cb@A`@Cj@Ch@Ed@EZEVCZGh@IlAO\GhAW~@WPEb@Of@Qv@Yp@W|BcAh@U@?dCgAbAe@\QbBu@bBs@?AhAe@jAi@vEuBZMjAi@ZOjIsD`@QbCgApD_BpCmAt@]^QHCr@[PIhBs@ZMbA_@fAa@XGLEXIx@WzAa@rA[</points>
    </polyline>
    <duration>
     <value>7436</value>
     <text>2 hours 4 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;right&lt;/b&gt; at the fork, follow signs for &lt;b&gt;I-55 S&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;St Louis&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Stevenson Expy&lt;/b&gt; and merge onto &lt;b&gt;I-55 S&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Stevenson Expy&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Continue to follow I-55 S&lt;/div&gt;</html_instructions>
    <distance>
     <value>218546</value>
     <text>136 mi</text>
    </distance>
    <maneuver>fork-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>40.4505676</lat>
     <lng>-89.0233948</lng>
    </start_location>
    <end_location>
     <lat>39.7905528</lat>
     <lng>-89.5983999</lng>
    </end_location>
    <polyline>
     <points>ao{uFdkj~O~@S|A]REf@MbB[n@Mx@O`C_@p@Gp@I~@Gx@C`ACl@?h@?T?F@J?T@@?N?Z@j@D\B^B~@Jb@F`@FTDPBVDRDNDVFZHj@NRDt@VVHNFVHXL\Ll@Xb@RXNB@FDLHNHJFRLRJb@XVPVNJHLJDBPNXRFFDBPPDBn@h@PP@Bb@`@fEfEdFdFpHpHlBlB^^bJ`J|BvBhCfClBhBzIxIVTd@b@~BzBbAbAf@d@bAbAv@x@^^RT\\PPlApAj@n@b@d@v@z@lAtAbBlBp@x@`AhAZ`@FH|AlBb@h@p@v@l@v@p@v@`@h@\b@d@h@nA|AFHHJlAxArA`B^d@^b@pA~ARTd@l@x@bAbAlA|@fA^d@TVLNd@h@RTPRl@l@RR^^JHJL\Z^ZVT\Xl@d@ZVZT\Vd@\XPNJPLNHPJTNJFVNXN`@TLFhDfBdB|@tCvA`ClAzAt@v@b@lAl@HBPHzAx@PHdKhFbAf@vCzA|EbC|C~Aj@X~Ax@z@`@d@VlAn@h@VhIdEvAr@XNTLb@TTL^TBBVNBBNH`@XRNb@\PNp@h@HHNLNNXVXX`@d@`@b@`@d@^f@^d@NRNRNT^j@Xd@\j@Zj@Td@R^BFh@hA^|@Tj@FRLZHVJV^jAJXHZHXJ\FVFTPt@R|@Lj@TlALv@D\F\DXJv@Fp@D^Ht@Ft@Fv@Dv@LpBJvADz@BTDz@BXBZBZBZBZB\D\BXDZJz@Jr@Lr@DXF^FXFZDTFXHZH^Nl@H\JZNl@JXHXHVJXHVXr@HRVp@JTLXJTLXLVVf@LTNVJRPXJPLTNT^h@NTLPNPNTNPNP^d@`AlA`@d@rA`B^d@bAlAlAzA^d@dCxC\b@RVpBbCrBfCpBbC\b@rA`Bl@t@v@~@p@z@zFdH|BpCxDxEJJh@n@zE~F`BrBnAzAz@bAbBnBJLzBbC`BbBt@r@z@v@v@r@|@v@dA~@RNj@f@pAdAbAv@TNd@\tAbAr@d@d@ZdAp@vA~@dAp@z@j@lAv@z@l@lAv@`An@p@b@~@n@dC~AlAx@rAz@z@j@dAp@d@\|AbAdBhArA|@bAr@fAp@fAt@lBnAbBfAlCfBr@b@|@l@hAt@jAv@r@d@dAp@hAt@z@h@XP|@l@|@n@dAr@\T`@Xl@`@hAr@d@ZxA~@x@h@`@Xr@d@r@d@`ElChAt@jAt@f@\\VFDv@n@ZV\Z^\b@`@\Zf@f@^b@FFZ\^f@p@z@l@v@HLT\LR\h@\h@LT\j@Xj@\j@Xl@Xl@\t@Th@Vn@b@jA`@jAl@bBnEdMbB|EzAfEx@zBlAlDl@bBt@tBl@bBbAtCl@bB\bABDlAjDv@zB|@fCt@rBh@|Ab@jAN`@N`@Tn@Rd@h@tAd@hA\z@\t@Xl@LZJR\v@p@tAf@dAf@`Ab@z@Zn@t@rAz@xA`@p@Zj@V`@R\j@|@h@z@fA~An@`At@`AnAdBh@r@h@p@h@n@d@l@p@z@xAfBh@n@TXd@j@t@~@lAxAdBvBx@dAv@|@hAxAv@~@d@j@|@fAxAhBpA|Av@bAh@n@`AlAv@~@t@|@bAnAx@bAl@t@p@z@r@z@~@hAv@`A~@hAp@x@|@fAdArAdAlAj@t@\`@hBzBhAvAxAdBHLNP`@d@bAjA`@`@Z\^`@`@`@ZZVTZZZXXVTR`@\^Z`@\^Zb@\VRZTb@Xf@^b@Zf@Zd@Zp@b@ZPp@^^RhAp@VJ^Rv@^r@ZpAj@fAd@xAl@fBr@pAj@~@^|@^XJLFPHVJj@TxAl@j@VDB|@\bBr@b@Pd@Rd@Rv@Z^NXL\N`@Nj@VtClA~EpBB@p@Xd@Rj@Vt@^VLZPdAn@l@`@\TPLDBXTBB\XRPf@b@\ZZZTVd@f@Z\DDr@~@Z`@`@l@@@NRDFLRJNTb@PZDDLRFNVb@Zn@NXBHNZLVVn@LZPd@Zz@BDL^Nb@Lb@J`@Nb@@DDL@DTx@DJ@FNd@d@xAl@pBHXFRJ\JXb@xAd@zAd@|ABHBJdAhDVx@BHt@fCh@fB^jA`@rAf@`B@BX|@l@rBl@lB@BNd@h@fBz@tCt@|Bp@rBZz@n@~AVn@`@bA|@pB\t@r@zAh@bAv@vAv@tAr@lADHn@dALPFJh@v@LRX^DHLNx@hA`AnAbBrBpErFfC|C`BrBzAhBvAfBdDbErDpEpBbCd@j@Zb@`@f@TV`AjAPTr@z@fArApDnEnBbCdCzCzAjB|@fA|AjBnA|AhAtAbAnAv@`At@|@lAzAlB|BvAhB`AjA@?LPrBfCbAlAn@v@zBpCf@l@|@fAb@j@tAdBPPDDRX^d@^`@`AjAp@z@`AjAZ`@tAdB`BnBp@x@HJDDPTRV`@d@NRb@h@j@p@`@b@`@d@^^h@h@d@^\Xr@l@b@ZZR`@VTNd@XTL`@Td@TVLv@ZVJRHNFRHB@JDj@Pn@RvA^\Fd@JJ@j@JPBXDh@Fn@F`@Dt@DP@Z@J?l@BxBBP?t@?j@@h@@tA@|A@n@@|@@~@@X?h@BT@z@DZB\Df@DVD^F\F^Fz@P\HPD\JPBTLh@Td@RHBPHd@RZPn@Zr@`@d@@~@j@bBjA|ClCx@v@\`@j@n@XZ\\Z^TTf@h@b@d@TVj@l@FHbAfAv@z@LL@@JJ@@pAvAr@t@`BhBTVFHjAlAb@f@JHBDLJt@x@b@d@^b@|@~@r@v@bAfA@@Z\ZZv@z@z@~@VXjF~FPT^d@\h@NT|@rArAdCZn@p@xAJXn@`BJXTn@^nAvAxFP`APbAPdAFj@F^R`BNhA@P@?V|B@HRxAF`@Hx@`@|Cl@dFTdBZbCPtAL~@X`Cb@jD^xCJt@Hd@?@BNNz@RfALp@Pr@Pt@Jb@Pr@Nj@Nh@X`AL^Rp@HPBJJXVn@DJXt@p@~A^z@n@nAn@lAFJLRLT`@p@T\NRBDHLLPDFLRh@r@PVX\TXr@z@d@j@tBhCx@bAbAlABDjBzBtj@zq@vExFlCdDvExF~GlI~CzDdFhGrAbBlDjEdGnH\`@zFdHdEdF`DzDPT`AjAb@h@NPLPNP`@d@p@x@LP`@f@PRRVl@t@`AjAp@x@tBhC^`@^d@PRNRHJl@t@h@p@`@d@HHHLJL`@d@RX`@d@^d@JLTV|@fAn@x@PRJLRTNRHHFHJLn@v@TXJJTXp@x@^d@NRxAfBLP\^RVp@z@`DzDrBdCr@|@LNhdApoAJLJLJLl@r@Z`@j@r@h@l@TXb@h@n@v@`@f@n@v@`@f@`AhAn@v@PTNPNPt@z@\^p@t@^^TT`@b@j@h@l@h@\Z^Zl@h@p@h@n@f@r@h@n@b@HFf@\t@f@v@f@x@f@l@\v@`@d@Vf@Vh@Vf@TXLNHf@T\L\Nx@ZvAh@z@\THzBz@b@NVLjAf@rAh@bBr@d@Rt@Zd@RbAb@l@TjAf@~@^b@RTJJFVLNHn@\h@ZFFd@Xd@\FDNLPRPPRTVVJLlAzAhAdBp@pAFJ`@x@HRP^JVJXTj@Nf@N`@HTH\Nf@BHFXFP@FFVLn@Px@Lt@BRHh@Hr@Fh@@@Dj@Fr@Ft@@\B`@@N@NBv@@n@@zA@vG@dG@bG?|@@dD?J?l@?Z?H?jA@vA@j@@b@BjA?PBz@BhA?BFvADv@@VDdADv@Dl@LpBBNDl@Fv@BRPjBD^@LFl@Fl@D`@ZpCD`@ZxCv@pHXjCh@|Et@`HPbBbB|OFh@`@bERfB@DPlBDXRpBH`AF~@Fr@Fv@Bj@Fx@Dv@D|@Bp@@^@NBn@@l@B\@x@@r@@`@@f@@p@@jA?hB@nC?d@?l@@hL@jF?TBlQBrP?bD?V@`D@`L@l@?rA?x@@zD?dD@bDBbR?pA@tB?n@?lA@xF@lC?jC?n@@l@?lF@xD?n@@l@@hI?~@@`A?dG@xG@~G@xG@zDBvI@zKBrP@hL@J@|H@xG@zL@dB@vI@dE?j@?j@@fE?rB?tA@fA?zB?F?bD@nA?`@?r@?rA@lA?`@@v@?\@x@@z@Bx@Dt@BVBl@Ft@Fh@J~@PnAPhA@DJj@@JNt@Nh@T|@ZhATr@Tp@Vn@Tj@Zp@Vj@LVZj@Zh@NVj@x@n@|@^d@LLRVh@h@b@b@l@h@r@j@x@l@`@Vv@b@PHLHb@Rb@Rb@P^L|@XpAZn@Lz@Lj@H~@FZBl@BX@^@l@Af@?`AA~@AV?x@?xDE\@PBTA`AA|HGvBClA?fBAzACF?F?B?dBAdDCrAAdAA|@AR?`@?fAAB?J?zACl@?F?PAB?D?|@?JAjEC`DCV?jAAh@?h@A`CAjCCZ?B?f@AnAAn@?j@AtEEnJIfCA`DCPArEClDEdCAzAAb@AV?n@ApAA|@?zAAzBC~SO|DEjBAjBAb@Ab@?|^WbDElg@]j\WnCCnCAbCC^AN?`@?fJItDCjAAlCARAjBApBAjBAnCAdHC~AAJ?H?vDErBCZ?j@AN?dAATAlAAt@ApEEbHEhFCrCC`ECzBE@?Z?L?n@?B?TBj@@T@l@BlAHPBn@DlAPPDhAPjATVHt@Ph@NtA`@z@Zt@ZpAh@\Pv@b@JFnBjAJF^TfAx@p@h@RPf@`@d@^lDpCTPFFTPFD|@t@zAlA`BpAvAhArAdA`Ax@NLjA~@lDrChBvAHHpDtCvBdB^ZlA~@xBdBHF\X\V\Vz@r@PNfAz@j@d@n@f@nAbAHFtBbB^ZdBrAtFpEjA~@z@p@@B`DfCfBvAXTvBdBfCpBn@h@p@n@RRn@n@NRz@~@d@n@V\`@h@PXl@`Af@x@R^dAhBrAbClBfDBDNVvBrDpDlGfCnEl@dAn@dAXf@HJZ`@VZ~ApBn@r@l@l@XVb@^r@j@FFr@j@lBlADDz@b@x@`@vEpBb@PTHPHRHdBp@lAf@TH\NfAb@lAd@jBt@xAl@l[dMlCfAd@P~@`@h@V`@Rl@Z`@VXNf@\^Vj@b@zAlAj@b@~@t@lCvBfAz@z@r@p@h@xD|Cx@l@x@r@fAz@tAfAhA~@bAv@xAjApB~AjBzApB~A`BpA|@r@bBtA`BrA|@r@tAfApAbAnAdArAdAnA`AxBfB|CdC~@t@b@\NLdCnB`BpAjA~@z@r@dBvAdBrAjA`AbAx@`At@hA|@h@b@x@n@lCxBh@b@x@n@nAbArAdAdBtA|@r@dAz@fAz@dAz@|@t@~@r@t@n@z@p@fAz@x@n@r@j@bBxA~@v@dBxA|AtAFFz@t@zAvAfAbAbA|@r@p@v@v@t@x@l@p@v@~@t@`Ar@~@p@`Av@jAt@lAn@hA`AlBj@jAh@fA`@`Ar@dBh@xA^fAd@tAZdA^pAV`ADRd@nBz@rDz@tDx@lDZvAj@`CZpAPv@x@pDj@hCFRrAzFPr@BLHZJ^Rr@DNTr@Rn@BHZz@Xp@Xp@N^P^f@bAHJ`@r@Zj@j@x@`@l@h@p@\b@RRRT`@b@h@h@n@l@DBPL\XB@`@X`@Zj@\x@f@ZP^Pf@T^PZLNFXJTHd@NHBb@LRDb@LF@~@Ph@JdANd@H|@NbANj@H^DpB\rARpBZnEr@z@Lb@Hz@Lt@LH@bC`@b@Ff@Hd@Hh@FjCb@pCb@~@LrB\\F\FlARl@Jh@Jb@Jp@NvA^@?ZJF@|@Xb@Nf@Pb@Pf@RXJpAj@b@Rd@Vj@XzAz@PLd@X|@l@n@d@`@Xn@f@\XDBj@h@f@d@b@`@jAhA|@z@nApAxAxAbC`CPPHHf@d@`D`D|BzBlBlB@@RTZZh@f@rApAh@h@tBrBv@v@bA`A|AzAdAfATRr@r@nFlFnBlBtBrBxEvEdFbFrApArBrB`G|FlNfNnAnAl@j@|B|BbAbAr@p@pCpChAfA|@|@JHdBfBtCrC`B~A~A~Ab@`@h@h@f@f@f@d@RR\ZrArAJJDD|GxGjBjBb@b@HFr@r@LLd@d@t@r@fDfDh@h@d@f@NPLLfAnAx@dAV\\d@f@p@h@x@T\R\\j@l@bAf@|@^t@Zl@b@~@\v@NZPb@Pb@v@jBj@pAh@rAJVdCdGn@zA`@bAVl@Xn@Xr@x@pBr@`BlCrG|BtFp@`Bf@lAn@zAv@lB`B|D~AzD`@~@FNhApC|@zBJTZt@Rb@^~@N^P`@FNN\^|@`@`AJVVj@Zt@Td@Td@T`@V`@V`@Xb@nAbBV\RVZXh@j@`@\\Xf@b@n@b@VPXP`@VVN^PXLTLDBb@P`@PVHd@P`@J`@JZH|@Pf@J`@D^Dd@D`@Dh@@b@@Z@b@@B?^?\Af@CjAEr@CzAEbAEp@CnEQz@EbFSX?j@Aj@?`@At@@r@Bf@BdAFF?@?^Dn@Hx@L`@Fp@Ll@L~@Vh@NjA^dAb@n@XbAf@j@Zr@`@JFb@X\Tb@Z\ZZVb@\ZX\V\X`@^`@\TRrHnG~CjCz@t@\XBBnB`BlDxClRhPvAlAh@d@PNlA`AtCbCnD|CdCtB~FbFrBdBvOxMXVv@r@fGfFzDfDbCrB@@tLbKhJ~HzBlBfA`Ab@`@d@`@t@r@VTZZ\\d@j@PRNRf@p@\h@NTPVXj@NTLVZl@Xn@JVFNDJRf@Rj@BFL^Pj@Rr@Np@Nh@Np@l@lDD\VtAPjATjANv@Pv@J`@HZVz@N`@@FDLXv@h@vALVRd@LVN\r@lAr@hAn@~@\b@Z`@BB`B~Aj@h@t@l@x@n@p@`@^R`Aj@HB|An@pA^PJlAVt@Lb@H~@J@@z@Fj@BD?`ABL?f@?PA`@Ax@CLAb@EF?^EXCnASb@K\ILCdD{@l@OvCw@VIjAYnA]lAYp@Kz@Kj@EPCdAEbAAt@@rADp@Fv@H|@Lx@Nz@RhAZVH|A`@HB^Jj@Nt@RH@ZH`@Hd@Jf@H\Db@Hp@Hj@F`AH~@FnADjADtAF|K`@R@VBrDLtADdBFF@lBFlBHlBFB?fBHfENl@B|@DrBHt@BlK`@r@DD?J@F?J@H?R@rAFfADx@Dl@Br@BpBFF@R@d@@h@@p@@d@?L@`@?\?v@?vAAb@?dAAj@A`AC|DOdBG\AtAGn@Cl@CnCIvHY`DKnAE~AGv@CTATAL?z@E`@An@CPAlAEJ?`AEnBIp@AdGUL?dBGD?|AGJAnCITAr@C`@CrDMTAn@Cd@AjFSdMc@~@C|AGhBGtAGdEOjAEbIY`FQbDK~@EdCI`CIpDMjCKvFQrBIvAGb@AvAElBInCKrEOjCKbDKjCKjCIfDMtAE|AGTAJA~@CTAN?`GSn@EbCIB?T?PA~CMhACp@E~BIL?LAJ?hEOjAEbACXAj@CJAd@ChAEnAExBIjCK|BIb@ARAb@CfAEZAjACtHWV?D?VA^A\?DAB?P?j@AjBAbDBvBBdHH^@`EFzBB\@LApAB`EHfGHlB@P@tCFpBBxBDhB@~BDjCD`A@r@@lABzBJt@F|Eb@lDb@dEv@lARXDf@Jj@JF@LDZDdARB?d@JhCb@\F|AXr@L^FTDfCb@bCb@dAPtB`@F?B?`ANPDbAPlARJB|@NhCd@`C`@`APjBZbEr@VFnEt@~AX`AP^FxAVxNfCtCf@</points>
    </polyline>
    <duration>
     <value>3167</value>
     <text>53 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;right&lt;/b&gt; at the fork to stay on &lt;b&gt;I-55 S&lt;/b&gt;</html_instructions>
    <distance>
     <value>97481</value>
     <text>60.6 mi</text>
    </distance>
    <maneuver>fork-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>39.7905528</lat>
     <lng>-89.5983999</lng>
    </start_location>
    <end_location>
     <lat>39.7438900</lat>
     <lng>-89.6355489</lng>
    </end_location>
    <polyline>
     <points>}qzqF~tzaPzAV|@PXDbAPf@Hr@N`Dp@zAVr@LD@^HTDp@LNBb@FNBLBB@tAVJ@TF`@Fv@N~@LlARD@v@J^FJ@fAPJ@b@Hf@HH@bBZj@Hj@Jh@JbCb@b@HvCj@j@Hd@HVD|B`@B?LB\F`APTDpB\ZFVDn@Lp@Jr@LfARd@HbAPvAV~AXhAR~@NZDfARb@Fp@J`@DPBd@Hj@FTDRBl@Hv@JdAJXDpANjANb@D`BRjDb@zBVXBh@FtC\\D|ARj@Fl@Fx@Jn@Hn@H~@Jt@JbAL~APr@JdALb@Db@FrC\`BRz@HjALn@H|@L^DB?b@FJ@|@JfALbALB?VDpBTvARt@Lz@PXFh@NLBd@Ld@LDBvB`Ab@Rp@^r@b@v@l@jAbAdAbAhApA\b@d@l@BB|@zAb@v@^t@~@vBvAdDjAnCz@nBn@vAvAfDbBxDxApD~@xB|@lBp@hBfAdCfC|FLVrA`D`AzB~@vBn@~Ab@fA^hA^jAXjAPt@Hd@DNLt@RnAPlAD^LhATpBLfAb@pDPzA^~CDZTjB@L^tCFf@Hl@NxAHh@PtAP~AHp@NzANlANpAXlCHl@NvANtA</points>
    </polyline>
    <duration>
     <value>233</value>
     <text>4 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to continue on &lt;b&gt;I-55 S&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;I-72 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>6768</value>
     <text>4.2 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>39.7438900</lat>
     <lng>-89.6355489</lng>
    </start_location>
    <end_location>
     <lat>38.6805444</lat>
     <lng>-90.0121054</lng>
    </end_location>
    <polyline>
     <points>inqqFd}abPP|@PtA@@Fl@f@fE`@`DNjADXF^?@DXFTDV@@FZFXFVFRHXHRLb@JTJXHTJV@?Vh@LXPXJPVb@PVNRNR`@f@RT^^b@`@`@\f@`@b@Zd@Zh@\b@Tz@b@RJVJf@Rz@Zv@VZHbAT\Fp@JVD^DZBH@L@RBV@R@T@R@T?Z@`@?T?T?T?V?@?B?@@VFtBAnDCbA?D?jDCdCAb@?|BA`A?n@?tBCnACt@AzACpDEvKIbKEnHGxHEnMGh@?`BAVAhFC|BCnGCxECpGElHEh@?zAAt@AN?rLEnCEtBAhKGhBA`A?dAAt@AT?l@C~@Ej@CfAId@EVCn@IbD]vFm@lCYxEg@zEg@`I{@f@E`AEr@A^?L?X?X?\@\BP@N@PBB?VBdANf@Hh@JlAZhAZxBl@bDz@jDf@R@`@BP@f@BV@r@?h@?l@Aj@Cd@EVC\C`@GXEdAOdBYdAQdBWBA~@KlAG^APAd@Ar@@l@@`AB\Bb@D^Dr@Jl@Ht@P`@J`@Lr@V|@`@t@ZbAf@PL^Th@\d@^`@Zd@`@b@`@d@`@d@`@jAdAp@l@\ZFD\XZT\VPLPJb@X`@TXNf@Tb@RPFZLZLZJXH\HRFf@Jl@JTDl@Hx@H`@B^Bb@@h@@|@@H?hGCfHCnGA|NEnSE`JCtNEfSEbTGzFAbFAvBA`CAlB?lBAl@?dDAtBA^?@?lC?pHC~CA\?xDAzJCdEA|DA@?p@AnDEbCGfAC@?z@EhBGlBIpDOrACbAC|@CtACb@?ZArBAzB?zB?f@?f@@rBBtA@dAB@@N?xADT?^Bd@@jADzAB\@nA@bB@`BBjAAfB?tA?hAAnAAvCAhEAlDAzAA|BAxICrFCh@?D?lMGbA?hCAnA?xDCb@?X?dOGxTIf@?jc@QnJChCAdBCrAA`@?r@AbEA^@tLGlDAJ@J?jBCB?`A?z@AD?tAA\?B?P?d@A@?\?\?zGCf@?b@AxBA|BA|EGN?rDCvD?z@?h@?nE@`FA@?`KEF?\?~DCd@?`KEd@?`DA`@?n@A`AAn@@bDCxB?`KG`HCl@?bKEpEAvECzDAzVKr\KnSIzNGxA?|TIb`@OR?N?RA`[KnLErDAzBAvIEbICjBAxSIlIAxAAlBAjBAX?rNGpKE|NG~NE|NGpBAhDAlWOpDAbTKzQKtUOhBAbAAdECzEE|UObTMlUMzOKb@?lQK`CC`@?vNKnLGrDCtQMrOI|QKfKGfXQzAAp@A|CAnKGtEExCAhAAlKGH?J?XAjJGjHEdA?|AAJAvDAfEEhFC~CC`DAx@Af@?tCC|DCL?dDCb@?|DE~DC~IExIGz@?jAA~CChMIf@Cn@AzGChBC~CAjFEn@?pHGpBAX?dB?nDCnGAv@?j@?tJEdEAj@?`DArGAlDCxIChB?`BArFApDA~PEt@AbNCb@AnEApFAtCA`YG|EClB?\Al`@Kp@?v@?|@?rYKzLC`HApFCtNEvJC|C?l@At@?lA?zBAhA?lE?rB?rA?b@?H?lB?xA?pAApB?b@?b@?z@?lB?l@?vE?xA?xFCxB?zC?rC?lM?V?`BAb@?v@@bA?jA?tIAX?l@?tBAfC?j@?nC?b@?z@?`B?n@?b@AxA@xAAp@?~F?xSAtF?xF?bEA|C?dE?nD?`G?l@?`C@X?`A?R?hD?|A?Z?`B?hA?rA?vA?lA?F?xAAvAAxA?@?pAAV?b@Al@?hGGvAAzHEzAAlCAlLKnFCnBC~@?hGGnYQnKIxTMT?dEEj@A`CAxAAtACx@Ab@?dBAnFEdCCf@?xAAlA?b@Ad@?lBAxECp@?p@ArDA|AAxBAvIEN?fBAhA?hJEb@AjBAxBAT?|CArAArA?`A?hBApBA@?`A?pAAp@?~@?`A?tFA`AAd@?T?T@L?JAR?R?TAH?zFCzEClBAZ?bB?|CCV?dFEtBAz@?nAA~JEnGCH?xCC~TId]QvEAtGEpA?vECfSGrDAb@?rDC~GClLC@?lUInCAjBAT?hICdEA@?jBAxA?T?tA?j@@x@Bz@Bt@DpAJdAJ`AJ|@Lt@NTBbARl@LlBd@pA^pAb@fBn@hC~@xAh@|HtCrI~C`A\|Al@`DhAz@\z@X|ChAjC`AfA`@jAd@jBx@LFx@`@zAt@@@HD`@TbAj@bAl@dBhAl@`@nAz@jAv@p@d@pCjBv@f@z@h@dAr@dAr@\VpBrAhAv@nChBHFRNvI|FfBlARLhBlAp@d@fDzBfFjDfAr@zF`EbGhEfWtQxCvBpCnB`EtC\VbH`FjAx@jAx@~CzB^VzB~AJHPLnClBh@`@xEdD\VzAfA^VpKvHxIhGvCrBVRDBbDzBvCnBzDbCf@ZdE`CzKrGdJlFhC|Ab@TdDlBFB~BtAx@f@fAl@vHpEJFvCbBnDtBb@TbBbAvDxBpDtBtIdFjHfE~FfDdBbATNpF~CvCbBfBbApKjGrBlAzAz@bFvChAp@jAr@tBpAhBjAz@j@nGfEhG|DhDzBdBlAbAn@vBvAd@ZbQbLdDvB`GzDl@^zDfC~@l@vJpG~@l@lEtC`BdAf@\hAr@|AbAzBxA`DvBjJfGjAt@lDzBvFrDzDhCfDvBpAz@|BzAdBhAnD|BfEpCtNlJzFrDpQnLxOdKr@d@NHvClB`RxLbDvBjFhDBBxH`FhOzJlD|BzA`A`FbDfFfDp@b@|BzANJjDzBxFrDlAv@`C|AlAv@lAx@|BxALJhEpCjAt@jAv@f@Z|AdAx@j@b@Zv@j@hAx@d@^zAjAv@l@dAz@f@b@r@l@fA`AvArAdAbAb@`@p@p@j@l@j@j@bAdA`AfAr@v@\`@PRlAvAt@~@^d@n@x@n@x@b@h@h@t@l@x@|@pAl@x@PXX`@@@\h@x@nANTNVJPj@|@n@dAf@x@h@|@p@jA@@`@p@f@x@Zj@Zh@v@rA@@Xf@j@~@Tb@Xb@t@nAh@|@h@~@Xd@BDr@jA|@zALR^j@l@x@TZX\l@t@VXZ\`@`@b@d@PNPNPNPN`@\d@\b@Zd@ZRNRLNJ@?`@Tf@Xj@Xh@Vh@VVJz@ZVH`@L^Lr@Ph@N^H^Fh@J`ALjAN`@Dn@Bz@DR@l@Bh@?jA@f@?~CDjAC|BB|B@vEB`B@xC@fA?P@N?F?J?B?L?tC@d@?`B@F?Z?F@fA?J?N?R?nC@V@FAp@@lA@fA@J?jB?dA?l@@|@?R?F@~@?|@?nFA^AB?|@?z@?`AAx@?hNEl@Af@?P?P?n@Ar@?j@AbCArAA`A?R?rAAnEAnA?lCArEAhD?tAAD?fA?lJAz@?xD?pEAR?tDAL?dA?`FAhG?zDAnB?lB?xEAjAAzB@bDAd@?x@AfACT?TAh@Cn@Ej@C\EPAb@ETCXCd@EVCTCf@IRCPC^G@A@?`@IFAPCj@Mh@MvA_@j@ONEHEFATIBAbA[rAe@~DcBBAlCgA@?nB{@zAo@vB_AjL}E|@_@~@_@b@Qj@UpAc@`@MZI~@WDAt@SVGfCi@tASj@Ij@GFAd@EbAIb@EF?ZCr@Ef@Cn@AbBCp@A`@?lA@pFEhAAzKEbGCdAAlGCd@?l@?p@?lD@n@?`HBB?pGBtLDvEBfA@`@?~GDpB@hB@nDBb@?rB@fC@jDBrB?hD@l@@T?L?fAAxCAdCArWMdIClLGl@?|GCxA?n@?H?XAj@?h@AbAAlBEf@AdAC`AEjBEvAEl@AP?l@AvAAZAx@?T?bAAbA?H?rDCpEAb@Aj@?P?V?B?fAA^?b@?ZAj@?f@?B?^AJ?j@?r@AfA?D?h@AbA@p@Af@ApA?V?n@BR?P@^@b@BTB^D`@D\Df@H`@FXF\HJ@\JTFtC~@NF^PTHb@TJDXPh@Xd@Zf@\v@h@b@\d@`@\\NLVV^`@\^^b@`@h@\b@DFl@z@dCnDnBpCdAvAPVPRT\l@x@DFj@z@X`@fCrDrGdJpBrCt@fAn@|@FJLNl@z@@Bj@v@LRZb@tApBhAbB|AzBHNX^j@z@p@`AxAxB`AtA\h@x@jAhCrDr@bAn@~@bBdCp@~@p@bA?@|AxBpAjBV`@d@p@d@p@V^Zd@PV`@j@RZX^bBfC^f@jBnC`@l@jAbBv@hAn@~@PV@DX^bBbCr@dAzB`DV`@vEzGzAvB\f@d@r@xAvBHJh@t@V^DFfBhCb@n@^h@fDzEv@jAX^FJzAxBdDzEpAhBlAfBbCnDb@p@~BnDdA`Bz@tAZf@RX`BrC^j@d@x@\j@v@pAtAxBT\x@rAZf@`@l@nAlBV\j@z@^h@Zb@`B`CtCdEJNhBjC`@j@r@bAzAvBd@p@V`@PTV^h@t@`@j@HJ~@nA`C|CdD~D~CtD~AhBt@x@NPrAvAd@d@zDzD`A~@vFlFtKdKl@j@vDlDrBnBjG`GlAhAfOnNrM~LZZ\ZhE~DpBnBvApA~GrGjDbDzAvAhJzIzAtAzNdNvFjFhCfCv@r@t@r@pAjAHH~@z@TPn@h@XTb@Z\XRLt@h@x@j@d@ZRL^Rb@XtAx@jAp@dCxAlAr@h@ZrElCd@XnEjCtDvBfAp@jC|A|A|@bB`Af@XdBdAZPnAt@f@X~@h@zA|@VNt@`@DDvAx@ZP^Td@Xh@Zr@`@nAr@rAt@b@VRLjAp@|A`Ap@^^T@@^RnAt@VNf@XFDr@`@ZP\Rf@XdAp@zHpE~A~@fAn@rAv@TLb@VTNv@d@|A|@lAv@LFh@\VNNJDBd@XdC|AtBrAvA|@|FpDpAx@rAz@ZPf@\rBrAD@LH^T~A`Ap@b@fBhAlDzBpDzB^TnDzBxDbCzH|ElKxGpG~DxLtHb@VZRVPdAp@hIfFzCjBtBrAlAt@fBhAbI`FpEtCXPxBrA~CpBxChBzBxAzExCx@f@v@f@~AbArBpAjGzDjG|DpFhDzBtApDzBjAt@vBrAdC|AzA~@lG|D\Tl@^lAv@v@f@z@h@|@j@zDbCRLx@f@RNdF~Cv@f@\Tn@`@RJ@@d@Xp@b@XPn@`@TNl@^\Tn@^jAt@f@Zn@`@FD`Aj@fGzDhElCHDTN@?^VfAp@tBrAnAv@`@VnAv@r@d@`@VZP|AbAb@VB@t@f@d@Xx@f@j@^dAp@lAr@@@TNr@b@r@b@~@j@VNFDRLb@X|@j@~@j@JFp@b@^T\R`@Vh@\r@b@h@\r@d@TNh@Z^T|@l@t@d@`Al@`CzARLb@Xt@b@z@j@hDvB^T^Tj@^xBrAjAr@x@d@z@b@rAp@t@\|@^n@ThA`@nA^VHh@Nf@Nh@L`ATpAVvAX|@NbBXdARtEx@`ARxB^~Bb@fBZnB\`AP`APf@JxCf@|AXlB^fEt@zEz@~HtAnB^dGfAH@nB\z@N`@HnAVj@J`@HhHpA`BVpAVD?~A\nAThBZrAV@?dARD@XDdCb@l@J`@Hp@LhB\`APbCb@nATvCh@dARpB\r@Lt@NvAVPB\Fz@NRDvAXl@J`APf@H~@P^FtB`@h@Hr@Lx@N~Bb@f@Hb@HLBz@Nj@JtAVtAV|Ch@b@Hf@J~@P`@H^FD@b@HtATr@NlARj@JvAX@?b@Hb@HfBXtB^f@JTFlAR`AR\FxAV`BZbBXvB`@XD`@Hb@Hr@LzB`@jB\dARj@Jz@Nr@LpB\hARp@Lr@LHBb@H`@FhB\r@LrAVlB\b@Fp@LRDb@HLBv@Np@LxAVlF`ApB^F@tAVh@HvAVRDh@JjB\\FVDNBpATtDp@bBZZFxB`@jARD@F@@?`APnATbCd@hF|@lDn@xB`@D@PBVFtAV@?B@fCb@bEr@bHpA^F`TvDdM|BpIzApAVlARx@NdCb@lF`AdCd@~B`@fARrB^nHpAxJfBF@dARb@HB@D@NBLB@?F@|NhCpDp@rATrAXdDh@zCh@@?fCd@b@HPBxJhBbC`@~Bf@d@JdF~A~Ar@p@`@r@`@v@j@l@f@hAbAp@v@LLn@t@p@~@BB\f@PXNVDHPXJRXf@Xl@d@jAVr@L\^hAX`Ab@|APr@r@vCDNH`@FXBD@B@FDLXnALd@@HH^Pv@XlArCpLBJPp@BLNn@v@hD`@dBt@xCXlAPt@Pt@Lf@x@jDZrAJf@j@dCh@fC\bB^dBJj@VnAVnABLJh@Lv@PhAPdANfAPnAVrBFn@Hr@LnAPnBFh@Dh@BXTnCRdCR~BFt@jArNZpDHfAPjBFv@h@zGh@hGh@tGXdDVbDHbAL~APnBPtB\fENfBTjCPvBL`BDj@\~DFx@PfB@Pt@jJHbAJfAXlDh@rFl@vEXvBFb@Lv@L~@bAxG~AzKHd@DZd@~CLt@l@|DHj@RnA@HXjB\~B@DPnAl@zDPjA@Dp@pEXjB\`CjA|HXjBRpADV^bC^fCBP`@jCTzA^bC@F@HBLN|@BNDVJf@@HLn@Lj@ZrA@FFVDLFVRv@BH`@vAXbAJXFRTp@Pj@N^JV^dAJVVn@Xn@Xn@Xl@HPXl@Xj@v@vAZl@Zf@\l@v@lA^j@n@z@PV~@lANPNP\`@TVZ^dAfAb@d@`AbA`@b@`@b@RRNP`AbAr@v@d@d@Z\b@b@b@f@b@b@\^`@`@p@t@b@b@l@n@VX^`@PPPP^`@`@b@`@`@jAnAZZ^^h@j@\^\\x@z@x@x@f@j@t@t@\^rAvAn@n@r@t@TVPRb@d@z@z@t@z@h@h@h@j@v@x@z@|@lBrBZZPPz@|@j@l@JLTTb@b@pAvAn@p@~@`AHJd@f@^`@@@Z\RT\^n@r@f@h@PRl@p@d@h@`@d@b@f@f@j@Z\X\t@z@?@^`@Z\JN^d@h@n@hDvD</points>
    </polyline>
    <duration>
     <value>4186</value>
     <text>1 hour 10 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; at the fork to continue on &lt;b&gt;I-55 S&lt;/b&gt;, follow signs for &lt;b&gt;St Louis&lt;/b&gt;</html_instructions>
    <distance>
     <value>131189</value>
     <text>81.5 mi</text>
    </distance>
    <maneuver>fork-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>38.6805444</lat>
     <lng>-90.0121054</lng>
    </start_location>
    <end_location>
     <lat>38.6358417</lat>
     <lng>-90.1380288</lng>
    </end_location>
    <polyline>
     <points>kxakFtnkdPf@j@X\NPXZ@@VZ^b@PRbAlA`@f@BDf@p@\d@RXJNFLRXZd@\j@T`@`@r@HLXh@Vh@Pb@BJtAtCN\Rf@`@`A`@fA\bAZ|@ZfADNv@xCp@hCn@|CXzA`@zBLr@^nBJh@?@TnAbAlF^tBHf@f@jCVxA^pBJl@f@jCf@rCNz@dBfJNx@BNP~@FZ^pBNx@@@BN`@zB?@Nt@Nz@pBzKhAtGDRTjAx@rEn@fDHb@VtAdBlJdA~FhAhGRbATjAHVx@tE@@bAtF`@vB\nBLn@X~ARfAJj@FXF\Z~AHh@H^X`B~@dFFXNx@b@~BLn@H`@r@~DRdAJl@DRH\|@bF`@xBTnAZ`B`@|B`@zB\hBFXXxAjApGBJF`@Lz@Jn@N`AHn@VnBRnBL|AF`AHjAJnBF`BBt@BnA@v@@x@@t@?fC?dAApA?~A?dA?l@AhC?|DAbD?B?d@?ZAtC?J?nFAtBAjE?|@AjB?xEA|B?R?vB?~@?dAApJ?dBCnI?hB?bG?JArA?R?F?jAA|@?hA?bB?xE?F?~A?h@AzAA~A?B?zAAV?zB?B?d@?~FA`C?fA?b@@tA?l@@h@BfADtB@^Bl@JvAFdAH~@JbAJbAVlBJx@TtAJn@Nt@`@jBZrA`@zAb@tAPl@Vp@Rl@Zx@Vn@\x@j@lAd@`AVf@^p@j@`AXd@hBtCJPnD|Ft@lA^l@tA|BhAhBvBhDT`@^l@n@dAjDvFhAjBzC|EtAzBzAdCT^z@tAjAlBv@pAb@p@dE~GbC~DJNh@|@nApBbAbBx@pAT^Xd@JPpAxBrApBzIxNdAdBt@fAjArBn@`ANVR^z@pAj@|@x@fA^d@X^x@bAX\FFFFLJd@f@~@bAXX~@x@ZZvBfB|@t@d@^TRRNHHFDZXd@b@fA|@LJlA`AZTXVLHJJPLtC~Bv@p@z@r@XTzAnA~AtAf@b@p@j@</points>
    </polyline>
    <duration>
     <value>419</value>
     <text>7 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to continue on &lt;b&gt;I-55 S&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;I-70 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>12590</value>
     <text>7.8 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>38.6358417</lat>
     <lng>-90.1380288</lng>
    </start_location>
    <end_location>
     <lat>38.6307938</lat>
     <lng>-90.1541232</lng>
    </end_location>
    <polyline>
     <points>_ayjFtadePp@t@n@r@Zd@@BXf@P\LTL\`@`Af@pA@DRr@Rx@RhAJj@PxAFv@Fx@@v@?t@?j@Et@CLO~AGh@M|@QvACZCZAFAZAX?R?B?Z?ZB^@XBXDVFb@BTBHH`@?@J`@Nj@L\J^Tn@\`A@DHTBJPd@FPHPXx@^fARf@^h@Rr@n@dBTr@vC|HbAnCtA`E</points>
    </polyline>
    <duration>
     <value>67</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; at the fork to continue on &lt;b&gt;I-55 S&lt;/b&gt;</html_instructions>
    <distance>
     <value>1575</value>
     <text>1.0 mi</text>
    </distance>
    <maneuver>fork-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>38.6307938</lat>
     <lng>-90.1541232</lng>
    </start_location>
    <end_location>
     <lat>38.6250805</lat>
     <lng>-90.1647068</lng>
    </end_location>
    <polyline>
     <points>maxjFffgePdAbDVr@Lf@J\Nl@@DJ`@@BF^Jh@BT@BDb@D`@D\NxAZhCHd@LzAFv@j@`EDTDPTbA?D\lAFP@D?@DH@B?@Nb@@@?@Nb@@@Nb@@@Pd@R`@DJFL^p@?@j@|@@@@BJNd@n@DDd@h@\^HFh@b@BBf@^\PVNRJVJDB`A^v@PnB\</points>
    </polyline>
    <duration>
     <value>48</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;right&lt;/b&gt; to continue on &lt;b&gt;I-55 S&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;I-64 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>1193</value>
     <text>0.7 mi</text>
    </distance>
    <maneuver>keep-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>38.6250805</lat>
     <lng>-90.1647068</lng>
    </start_location>
    <end_location>
     <lat>38.6190308</lat>
     <lng>-90.1864182</lng>
    </end_location>
    <polyline>
     <points>w}vjFlhiePtBVH@l@Jv@L~Cd@pARf@HL@H?j@H`BXhBXdHfAdAPv@TNDJB\Lb@Tp@\^Rd@ZNLj@`@j@j@FFLJ?@l@r@RTBFXb@f@v@@D@BTb@N\Vh@ZbATp@Tz@VnALx@Jv@JhABb@@T?B@P?D?FDlA@z@Ar@Ad@Cl@?@Cl@KrAIr@CP[pBWtAIj@I^W`BGVCRKj@eBpKGZADEZ[bBeAdGEREVeA`G_@`CKj@Kj@Ij@Kj@a@`Ck@lDIj@Kj@k@lDCRCP</points>
    </polyline>
    <duration>
     <value>106</value>
     <text>2 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-55 S&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;I-64 W&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Entering Missouri&lt;/div&gt;</html_instructions>
    <distance>
     <value>2672</value>
     <text>1.7 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>38.6190308</lat>
     <lng>-90.1864182</lng>
    </start_location>
    <end_location>
     <lat>38.6184369</lat>
     <lng>-90.1908455</lng>
    </end_location>
    <polyline>
     <points>}wujFbpmePKLGNELIXUr@ELCDIRQb@Wf@Yh@u@vAk@fAMTMVCJEJG\CNAh@?RB`@BVFXHTHPBFBFHFPPRLPFx@TZD@?P@f@D\@ZFHBLDJD^L^B</points>
    </polyline>
    <duration>
     <value>38</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Take exit &lt;b&gt;40B W&lt;/b&gt; for &lt;b&gt;I-44 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>603</value>
     <text>0.4 mi</text>
    </distance>
    <maneuver>ramp-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>38.6184369</lat>
     <lng>-90.1908455</lng>
    </start_location>
    <end_location>
     <lat>38.6112263</lat>
     <lng>-90.2042965</lng>
    </end_location>
    <polyline>
     <points>gtujFxknePh@^z@j@JFp@d@TPfAt@b@Zb@XNJNJ|@p@n@l@XZVX\f@Zf@PZXf@N\P^Vn@`@xA~@vDZpA^`BZvADP@@TbAv@jDDPb@bB`@bBv@xCh@dBxH|U</points>
    </polyline>
    <duration>
     <value>60</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Merge onto &lt;b&gt;I-44&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;I-55 S&lt;/b&gt;</html_instructions>
    <distance>
     <value>1458</value>
     <text>0.9 mi</text>
    </distance>
    <maneuver>merge</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>38.6112263</lat>
     <lng>-90.2042965</lng>
    </start_location>
    <end_location>
     <lat>38.5056275</lat>
     <lng>-90.6741367</lng>
    </end_location>
    <polyline>
     <points>egtjFz_qePJp@Rl@V|@Lf@H`@Hd@F^DVD`@BZB\BX@Z@Z?`@?Z?`@?VAXAVCf@Cf@CRIh@UnAAHAHIV?@Mb@M`@Wr@[v@A@Uj@IPCFM`@Sf@ELQh@GXEJI^[bBE`@Ix@Ef@IdBKdCKhBADAXCX?BAPCPANEZKl@Qt@e@bCQ`AWvACLW~Aa@~BSlAM|@Gn@I|@EXItAO~CK~B?HKrBO~D?DKbCSbECZSnFE~@A`@KvCC|@GlAAh@C^GbBMpCIjBMtASxASxAMr@Mt@K\g@nBg@nBc@zAa@|Ai@pBAFWlACPSdACNEZUlBCVGj@ALEn@InAUxFQnD?FALI~BOfDKhCGz@I|Bi@fM?BAXAHEdAQtDOvDCl@GxAQvDQ|Dc@nKEx@SvEO`D_@|IM`DGrAk@~NE|A?FEnAAvD?jC@lC@nALxIBjCFnD?^@bDCvD?\C|@GpCGlBc@~IOhCEt@MhCQjDKpCGvAInCEtAAr@ANEhC?\AZ?v@Ar@ApB?nA?lA@bC?f@?P?@@fA@X?R@l@Bp@@x@@n@@VBx@Z`O@h@F|A@VNhCJzAPlBFj@D\@HFn@JbAF`@Lz@F^Jt@RlAX~AHd@ZrABNH`@Rr@r@tCb@zAPh@XbAn@tBPh@JZPj@Nf@Rl@`@tAdDvKZdAx@jC^hA`@`AVp@Xn@\p@`@t@HLt@jAd@p@JN\b@JLPR~AbBPNd@^d@^TPz@l@pBjAj@VjAb@`AZxAb@lD`Ar@\v@^@@h@Z`@XRNb@^l@j@XZtAjBbC|D\h@j@x@`A`BjApBp@fAbCxDt@`A~@bAtAtAtBhB\X~ArAzAvAJJl@p@d@l@f@x@HLHNHPJRBFDFN\Pd@\z@L^f@bBf@hB@H@BHVVbA`@xA`@xAh@dBHPPf@@DP^JVFLh@lAT`@Zj@RZR\BBLTLPh@v@Z`@@@PRFHRR@@\\p@t@@@DDJJPRl@r@PTZ`@PXHLT\JTNX^z@N^HPJXJZRn@HZLb@Jd@H^H`@Jr@DZD`@Fh@Dl@HnB@xA?v@?d@ApBDrD@p@Br@?JDj@Bb@D\D^BTBJ@ND\@HDTFf@Hf@Lv@Hf@Lj@Lh@ZlADNFXV|@?DX`ALb@BH@DBHDLBF?@Nf@Rh@JXJVPd@Tf@Td@R^R^RZ\h@\h@VZRZvAjBRTNLHL^d@FHn@n@jCnC@@j@l@lBtB|DdEp@r@HJx@z@h@p@l@x@d@t@T^T^DJLTTd@R`@FPBDN^Pb@Rh@Pd@^lAPl@@@Rx@T`AJf@@Hv@pD@DXtA`@rB^`BfG`Zd@xB`B~HzBvKn@vCPr@ZjAFRJ^JZRn@^bAZx@@@Rd@N\Zp@Vl@p@~ANZPh@Pf@V~@Rt@Hb@FVBRJn@PlAPzA@FRjBDb@`@zCrAxIJh@Lt@Hf@Lx@`AbGb@rCFXF`@@HPfADRJv@Nz@p@bEBPHd@Hn@`@fC|@vF`B`Kp@fEBLdBxKN~@N`AhBfLp@bE~@|FrAlIXfBHj@h@bD@Jb@lCd@tCDX\hBRrAJn@Ln@Nr@Nh@J`@Ph@Tj@Nb@P^Rb@NZPZT`@\h@TZ^f@VZNNNN^\ZVTTRNTP`B`ApDrBr@\XRHDtAx@vAz@~CfBXPZNp@`@TL@??@\P@@FDh@Xb@VFD`@TXPp@^bH~Dx@d@bE`Cv@d@`@Zd@\d@b@\ZTX\b@\b@RXPVNXTb@PZj@pAd@tAPl@Rv@Lh@H`@L~Ad@dG\bEBd@Dr@HvADf@J~ADp@JfAL`AFd@Jt@Jj@Hh@Hh@d@pCP~@@DBL^dBH`@FTDRd@hBLf@@B@DTt@Vz@Z`Aj@bBVp@\~@BFXr@pErKrDvI\z@FNh@nA`@v@Zv@JRZt@LXDLHNVn@P^DLXn@Vn@d@dAd@hA?@HNRb@\z@LVx@nBHRHR\v@f@lAb@bAN\x@hBb@`ADFXn@j@dALPHPn@bAj@z@l@|@fF|FfAtATX`@`@\\VVh@l@^`@?@LLDFDBDFFF?@FFVXTX^`@r@x@\`@^\LL|@|@h@l@LJlAvAdDlEp@hAdAtBh@pAj@xAdA`Ep@pC\vADTl@pDRdBPxC@dC?nC?D?vMCvEAvDA|C?zACzREnP@nAA|LAbHAfH?\AtEAv@A~LAp@?D?T?T?B?j@AlEAlHAvA@bECnE?BHzLBz@DhBLlBRnDd@lFj@|EJl@TpARlAPdAN~@TzALx@\nBD\Jj@^~Bh@jDHh@RrAJj@PdAN~@Fb@TrA?@Hh@PfA`@jCDRDXVbB@FTrABLLv@Hf@DVFl@P`BLbB?HDt@?@HtA@lDAh@Ad@CfAElBElAQnHAVIlC?LC`ACz@?VAd@AV?Z?b@?L@d@@z@?X@R@T@V@R@TBd@Bj@RvBVtCFx@PjB\rDB`@@@@LDh@?@D`@`@zE?DHt@b@vEJrAJpAHx@@HD`@@HTdC|@zJtB~UX~CJlARtBdA~LjAjMFp@L~AN|AVtC@ND\J|@Fh@DVLx@FXJl@Hb@J^H\HZZlARl@`@pANf@j@fBXx@^nAPh@|D|LtAhEPl@n@nBfBtFbA`DPf@ZbAb@tAdAdDf@zAVz@DLHT@BDLX~@f@zAVx@Tt@Xz@^hA`@pA`AzCPl@b@pAT|@VbANt@Nv@?@Lt@Ff@D`@H|@HlAHrAFdAHxABl@FdAHjBPxCFrALhCBTBj@Dj@JlAFp@F`@DXF\Hb@Nv@Ld@DPJ\Rr@Tp@j@xAHP`@x@`@p@NVZd@l@v@X\n@p@VVJJNLXTp@d@TNj@Zb@TPHVLb@PXJf@Nn@Nh@JnCf@fARnCd@n@JRD|@Nl@JnATdATj@NZJRHXJ~@b@f@Xr@b@NJHFbA|@|@|@TTFFZVZZjAjAx@x@n@l@LL`CzBp@n@PLJJb@^^ZTNZX\Z\Vz@r@b@b@TPZXx@v@FFTPZZ\\FDRR?@t@p@LLbAbAjIdI@@JLPNXXNPh@f@d@d@r@p@n@l@FFb@b@X\b@h@JNPTPVHNPX@DJPVd@Xl@Tf@?@HRFPHRFNZhAFRFZLj@Hb@Jh@Jp@Hh@Db@Db@B^B^Dh@@^@d@?B@V?T@`@An@?^EpBCl@?BAh@KhCAT?VG|AKpCG|BIxBALAl@Cl@ATGrBKfCAl@A?Cx@C|@GfB?TAjA?b@@v@?L@z@Bp@Dv@Dz@D^?@Dh@?@Fv@Hr@Lv@Lx@BTPbAPfAPhADVZhBLx@TrAJl@D\Lr@RjAXhBN`AV`BLn@Fb@PfAHf@Hd@Hf@N|@PdAJn@PvAVtBZbER~ECjF?LIdBCdAEhA?HAF?DAl@Cv@A\?LAP?R?X?\@`ABt@Bd@l@pF|Ipf@Lt@BPPjANpAJ`A@NHz@JpBDrAB~@?`@@xA?X?t@CzACz@EdAKxAKnAQpBI|@Gn@Q|AKbAm@|Gc@bFO~AQlB?@Gl@?@E`@?DGj@OjBWlCQvBQtBM`BABEh@C\IbAABC`@AJUnCIv@?HGl@Gl@El@UdCAFEd@Gr@MpAUfCi@bGGr@Ir@AVCPAP_AdKi@fGKnAOvBWvDGbA?@AJAZ?@A@IpAKjBC`@?@Ej@Cn@APC\?NCr@C`@Aj@Cl@?ZAXApAAZ?PAl@A`@?d@?|@?f@?NArCAT?d@BdAB`AB|@Bt@Dv@BR@XFj@?@@H?@BZ@DFp@BP@HF\Hf@DXDXb@dCFb@RhAf@tC\jB^zBBNBL^`Cb@nCBL^`Cx@lFBHV`B^bCP`AFb@PnAFj@Hr@Fp@@NB`@HxA@n@Bl@?l@@H?@?j@?@AtAAnA?|@AdBC`D?LAhBA~ACjD?d@EbFA`DAfAAl@?l@Ap@AtBAhB?H?b@?@CxB?|@AhAApAAbBAfCCjCAlCAz@AnAAfCAbCA`ACdDAjCCtDAzCAl@CdF?P?PGrGIvEI~BKxBi@vGe@|DCVa@~Cm@xEy@`K</points>
    </polyline>
    <duration>
     <value>1606</value>
     <text>27 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;right&lt;/b&gt; at the fork to continue on &lt;b&gt;I-44&lt;/b&gt;</html_instructions>
    <distance>
     <value>45888</value>
     <text>28.5 mi</text>
    </distance>
    <maneuver>fork-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>38.5056275</lat>
     <lng>-90.6741367</lng>
    </start_location>
    <end_location>
     <lat>37.8367953</lat>
     <lng>-92.0968131</lng>
    </end_location>
    <polyline>
     <points>es_jFjxlhPQtEA`@EhB?l@APA`A?xA@t@?@@j@@r@@vA?@FzBFfB@Z@JBf@Bd@?@f@vGbAdMj@lHvCt^?@Fj@LzAFj@Dl@Fj@?F`@xE\xEX|DXfDVvCRzBJvAD`@Fv@?@Dj@JrA@DDl@NlBPrBDj@Hz@HjA@?@XH~@Dl@BXXbDHhAPxBJlAL`BNhBLtAFj@PtANnAN`A?@PjAHb@BNHb@Lr@Jh@DP?@H\BHRbARz@?@R|@b@rB`@hBJj@tAlG^bB^jB@BXnAZ|ALf@H`@TfARz@b@rBDNJd@?B@?XtA?@VdA@JLj@XrADRFVLh@XtABJH\f@~BJb@^dBh@hCnB~IZvAZ~AJh@Px@n@vCr@`Dv@vDbArE^hBZxApA`Gd@vBz@`ERx@\|AXjAHb@h@dCZvAr@fDXvAZrAnBlJdAtEb@tBj@fCd@xBn@rCHZXtALh@?BLf@Jh@Lh@Lh@Jj@BJVfAJh@H^Pt@TfAPx@VdA?@TbAJ`@f@fB?@\jAd@tADNf@vAFNj@xA\x@BDh@lA^v@HNTb@Tb@NZz@bB`@t@Tb@d@|@h@bAVf@Zn@Xn@LZRf@Pf@BFL^BHJ\L`@XjARx@XtAHn@F^BTHj@Fj@DXDd@D^JlADlA?J@`@BxA@X?nAAbAChACx@GfAMdBEz@MbBABIvAg@zHMbBEl@IlAGlAKxA[`FEb@[lEi@rIEj@k@zIEh@C^MhBEj@En@KxAInA[|ESxC]fFGnAMbCKbCSdHa@`M[xJUdHMxEItBCn@?D?BA^G|ACt@?@Ab@IfC?@?D?BA`@A??F?BMbEQrFO|EQrFG~AG`CErBAf@?Z?LCrBCpE?X?@?dC@dBDdD?f@@j@DnBLpEBr@?BBh@@VFfABv@NfCJ~A\`FHv@\xDVbCBVX|Bz@tG@BHj@Jt@RlATvAn@lDn@jDHf@Hf@j@hDXxAF^F^DVj@bDfA~FLt@DVJ`@DXVzAv@xEdBrKp@fG@NHhA@JHdABp@Bd@LxCBzABtA?@@j@?@D`CB|@Bl@?bABrAT~N@h@BbB@^D`CFpC?\FjCBdBBhA?^@ZD`DP`LDjBJpGD`BFxD@l@@X?RB|@@z@BtAHzANdBTjBPpAVzAXzAZfAj@`Br@pBh@lAr@zAn@jAjAdBz@jA~@hAh@f@|ApAtAx@t@d@~ErBl@XNFf@Tf@V`@P`Ad@JDvDhBLFRH`Bv@`Ab@`@R^P`Ad@^P`@PvB`A~Ar@NF|@`@lAl@tFhCNFh@TJDLFPHLFRHLFz@^XLHD^P`@RLFPH^PD@j@VPH`@Pn@VZNB@|@`@^PD@^Rr@Zn@Z\T`@Th@^b@ZdA|@XVHHPR^^p@t@n@z@BDBBTZLRJPPVXh@LTLTLTBDRd@@@Vl@Vl@\|@Nd@Tp@Pl@v@tClAxEr@hC`@vArBxHZjA`@zAFRr@hCzDxNb@bBv@rC?BLd@l@zBNh@|@dDNh@DPd@bBd@dBHZPn@ZjAv@vCv@rCl@~Bn@|Bb@bBn@~BZhAZjAl@|Bl@zBFTjAjEn@~BPl@Rt@j@xBRt@ZhAZjAJ`@V~@Rr@ZjAd@hBn@|BXfAJ\BHLh@Rp@XdA@DLf@Nh@t@nCFTHZDLJ`@Rr@Pl@t@|B\fAh@~A~@jCb@lADHLZPf@Rf@Rf@b@fA@Bf@lARd@Rd@Rb@?@Tb@f@hA@@Rb@NX~@nBHNP\Xd@@Bh@dAR^B@Zj@d@z@@@\l@d@z@NX\l@j@`AZj@T\BFf@|@fAlBh@|@@DZd@jCtE`AdB|@|ADFpBnDVb@Tb@@@bAfB\l@jBbDJN|@|AFJd@z@^p@Zj@n@fA|@~AFHTb@LTb@r@BDFLj@bAT`@Xd@@@@B@@Xf@t@pAXf@T`@BDr@pAXf@Xf@Zh@r@nAfCnET^`@p@f@t@hArADD\ZHF`@ZBBt@f@RJRLFBLHz@b@x@\r@Tr@RRDTD|@N@?h@Fl@Fl@Dz@BV?H?V?T?f@?B?f@?Z?V?d@?l@?F?`@?J@h@AB?`@@h@AB?D?l@@b@?b@?F?j@A@?F@pABB?B?X@x@Br@DL@J@b@DVBJ@fANXFF@x@N`B`@h@Lh@P@@B?ZLVJf@PxAn@r@\NFNJ`@TVNLHRLTN`@XDD`@XXT\X\XTRBBBBh@f@j@h@l@l@zAzAB@VVBBt@t@B@h@h@LLx@v@ZZZZHFn@n@v@t@dE`ErBrB\ZpApA^\XVvAvA@@XVx@v@PNh@b@JHx@n@d@\r@f@TP^Tl@`@v@d@x@d@lAl@pAl@bBr@tAf@~@Zv@TXHj@Nh@N~A^D@\DdBZd@Fb@Fb@FdAJv@Hr@FlAJnCTbBN`AHzAN|BRbAHlE`@`CT`CT`CRtALxALL@jAJtALh@Ff@Fj@Hl@Lb@Lh@Ph@RZNLFNFJFFDVL`@XTN^Z`@\B@XXFH`@b@`@f@@?@BX`@JNJNBDNVVd@@BHNXn@Xp@Pd@@FL^@BL`@Pn@Jf@FTLn@ZdBFXd@hCDTJj@FZ@DJd@BLH`@Jf@H\Rz@DPFPJ`@HZHTTt@HTRn@JTl@|A@DLX@DRd@P\Td@f@~@Zj@NZfAbBb@n@h@r@l@t@PT`@b@l@n@vAtAt@n@z@p@DDZVtAfA^Z@@tAfA`@\RP~@t@|ArA`B~Ar@x@f@l@V\f@l@bAzAt@lAh@`A\p@Vf@JRLXVj@N\HPDLBB?@JTBHFPTl@p@pBb@|ADPLh@@DXhALn@Pv@F\RhA@Jb@`CFb@RjAd@jCHj@FXZfBHj@Jh@Lv@F^VvADTDTTtABHDZ@DHj@TvADXF\BJDTHf@BJDZDTNt@D\RjA@HFXJp@BHLx@Jl@\pBJr@Jf@@L@@h@|Ch@bDLt@F^Hb@Jn@Lr@FZH`@Ll@FXBJ`AnDfA|Cv@lBz@hB`@p@NVV`@NV\d@NTJN^h@JL@@JNJL@@BBb@h@JLNPNNRRVVl@j@b@\p@j@NLTNf@\B@ZRTNHDJFRLNHRJBBPHB@\PHDNFJDPHJDHDB@t@Z@?HD\LZLJBh@RNFHBdA`@LDl@Tj@RdA^VJh@R`@NB@z@Z~@\n@Tb@P|Aj@~@\LDjC`A`A^f@Px@Xl@TfC`A@?|Ah@?@jA`@`@P@?THf@RD@l@TPFh@RD@RHfBp@F@p@Vv@XXJD@b@RD@RHDBb@RFBRFTLPHXN@?BBb@RLFJF\RFD@@b@VTNr@b@XRb@\FDr@f@`Av@XTh@f@j@h@JJNNTR~@~@ZZx@v@ZZ\\rArAZZ@@TT^^ZZ\Z?@v@t@ZZ\ZfAfAtArArAlAtAlA^Zd@^`@\`Ar@fCjBbAr@VP|@n@b@ZvA`ADB^XrA`ADBLJvA`AdAt@nA|@DBRL\Vl@`@`@ZLFPNJFzAfAPL^VJF|@n@n@d@JH\TRNhAv@PLHFRN@?FFB@NJ@@HF@@FDdBlA|AdA~AhAlAz@fAv@zB~Av@h@PLHDl@b@HFj@`@@@x@l@VPVP@@~@p@PJVPZTFDNJBBd@\\TBB^VPLJFXRHFTPB@FDTPDDZTh@b@HHBBPNJHRR^\z@|@p@v@b@h@NNXb@fA~Ah@x@t@vAbAzBd@`Aj@vAL^Z|@j@fBDRd@jBh@pCX|A\hCTrBLxAHhAB|@@l@D|A?@B`A@r@@L@b@B`B?d@BjA?FDfB@d@@ZHxF@p@@H@r@FxCFjE@\BtA@t@@f@Bv@@Z@d@Bd@Br@@LH|@@LNjAJt@@HJj@N`ALn@H^Jf@DLNj@Tr@JXJXFLN^Rf@\r@R`@PZHNLRT\?BX^FJPRRVPT\`@DDZZBDVTNNJJTPFF\V^VXRB@b@XZPFBTL\PD@RJJDHB\Nl@RNDXJj@Pz@Vr@Rt@Rr@R~Ad@ZJ`@L^J@@|@Vv@Xl@Tj@Tb@RVLRJh@Xn@`@RLj@`@v@l@RPNLr@p@n@n@^`@p@r@v@x@`AdA`AbAbAfAx@|@zA~Ah@j@tAvAx@|@v@~@n@r@bAhAXZb@f@hBrBlAxA|@fAn@|@h@t@`@l@^h@f@x@^n@^n@d@z@@BXj@\p@Xj@`@x@Pb@NZXp@LXb@fA\`ABFd@rA^jAVv@ZfANh@Nj@@BPl@H`@XhADP?BVhABHPz@H`@Jl@P`ADRV|AHn@PhAF^XjBXtBR|Ab@vCL`AL|@d@zCHh@d@fDXhBn@bEj@zDlAnInAnIFf@Jt@ZtBzBdOP`ABNNx@VdAZnAVx@HZHVL^Rh@Zz@Zv@fA|BPZf@`Ah@x@HNHJt@hAHLbB~Bf@r@vApBn@|@pAjBVZHLt@fAhAzAf@t@|@nA|@lA|@nAl@|@|@nAlBhCLR\d@`@j@\f@^f@\f@^f@\h@l@x@b@l@Zb@\d@\f@|@pAl@x@^f@LRNTHHBD@@NT\f@j@|@Xb@BDLR\n@JTFJDFJVJTLTJVJTJXJVFLNb@FPJXRt@JXPn@Lh@R|@FXHXDXHb@@HTxADZDZBNFd@?@BTB^D\B\B\@XDn@@Z@Z@`@Br@@b@?j@@V?l@CfA?^AXAZAZAZCn@Cb@G`AK`BC\Ex@KpAEn@Cb@K|ACj@KpAE|@OtCEjACfB@v@@z@@`@Bl@@\Bh@H`AFp@J|@Nx@DRVnANp@Pr@HZb@`Bb@fBZlAXlAXhARt@Pp@XlAZjAXlAJ^Nj@b@bBZnAb@bB^zAh@pBXjAZlARv@j@zB^zA\tAj@|Bn@bCp@lCRv@d@lB\nAd@dBPl@Vr@Xr@Vh@Xl@Zh@\l@fAzAl@p@VVNPd@`@b@\RLPLRNd@VRLj@V`@Ph@Rh@Nh@Nh@J~@Pp@F`@D\Dn@D|@JbBNv@H|ANx@H~@JzAJVDjBPlCVbBNj@Fz@Hp@Hh@Fx@FfAJvANlBPnALnAJdE`@xAL\D^DnAPXBXDpARLBVFVDXF\FRDXFVFVFTFz@RjAZVH`DbAdAZdAZ^LPFPFd@Lf@NNFHBF@vAb@PFjDdAt@TtBn@ZHrAb@h@NZJPFhA\pA`@h@Nd@NbAZh@Nd@Nl@PPHvEtAlA^vDjAr@TxAb@`@Lz@V~@ZRF~@Zh@RpAh@l@Z`@Td@Xr@d@JHdAx@b@`@b@`@nArAn@z@^f@lAjBx@nAV`@pAnBnAnBt@hAb@p@hAdBLRNPh@z@nAnBnAnBtAtB\h@NTl@z@\j@vAxBx@nAPVx@nAl@|@z@pAlBvCZf@l@|@j@|@h@z@b@p@f@|@Vf@v@xAz@fBDJJRn@|Az@rBb@fA~@zBhArC`@`AZt@l@zARd@JVDJHRRf@`@`Aj@vARd@FLb@bAb@bAl@hAZl@h@~@x@nAl@x@`@h@^d@p@v@h@j@l@j@n@l@b@^f@`@z@p@|@l@v@l@`Ar@zAfA`@Z@@VP^X~@r@\Xv@j@|AhAfAv@lBvAdDbCn@d@|@p@d@\t@h@\VpA`AzAfAv@j@zAjAlBtAv@j@v@j@zAhAhAx@t@h@\Vl@b@fAx@zCzBfBpAhAz@`Ar@\VdAv@t@h@x@l@v@j@lBvAbCfBbBnA~@p@hAz@jAz@z@n@ZTd@\|AhAv@j@fAx@v@j@\V|@p@v@j@zAfA`@Zl@b@\VfBpA~@r@VRRNb@Zx@n@~@v@b@^XVp@p@`@^t@x@^b@tA~AtAhBnAfBh@v@LPRXBDp@~@`@j@t@dAd@n@Zd@tAlBbAvAFJdGpIl@|@tBvCdDxEjCtDj@v@p@~@^h@l@|@zArBpAlBfBbCbCjDbAxAhDzEbAxAtCbEvAnBT\z@hAf@p@|@jA`AhAn@r@l@n@RPd@d@j@j@~@v@pAdAnA`AZNHJBB^VTL\TTP^RTLRHTNf@Vb@Rj@ZNJvAr@n@ZhCrAjAl@z@b@vBfA|Av@b@RPJNH`@TVJ|@d@t@^RJXPPHPJf@Vb@RRLl@ZVL^Rh@VTLlAl@b@TTLVLDBRLr@`@TLJFhAt@RNjAz@|@r@t@l@b@^PNp@p@PPp@p@b@b@`AhA`@d@NPPTX\b@h@b@f@Z`@X\fArAb@h@NP^b@Z`@PTNP`AjArA`Bl@t@NPbBrBlAxARVVZp@x@PR|BrCRTr@|@PRnCfD\b@NR`@h@PTjA|AzAxBhAdBjAjBhAfBHLT\vBhDvBhD~AhCvHxLn@bA~AfCrBdDHJh@|@\h@`@n@NTHNZf@NRZh@\h@NTLRx@rA\h@j@|@\h@\j@j@z@LVj@|@z@rAbBlC^l@j@|@V`@T\Xd@PVx@pAxA~BXd@l@`AZf@|@rAFLTZl@z@jA`Bn@|@|@jA`BnBbBlBbAhAxAxA~@|@t@r@@@vAnALJz@r@PNh@`@^ZxAjAbBnAnA`AJHJHDB\Vb@\x@n@h@`@LLLHPLJJHFxAhAx@n@t@j@v@l@|@r@~@r@NLpB~Af@`@v@l@t@l@n@f@n@d@@?HH\XFDf@^TRn@l@PPHJJJh@p@h@p@FJf@v@JRHNTd@\p@JTJTRj@L^HTFTFRJ^HXLh@VpAZjBXhBV|Ap@dELz@f@|CBNr@hEvB~MlAlHBHf@fDr@jEl@vD?@X~ATtARlARlALt@ZlBLz@PhAbA`GRpAXjB`@dCDX`@~Bf@xCl@pDVdATbARr@L`@JTJXp@fBRd@h@jAFHj@dAr@pA|@~AVb@f@|@nAzBr@lAVb@FJ@DDFZj@NVPZ|@~AbCjE^t@dApBl@bAR\Zj@j@dAxB~DBBv@rAbCpEPZJRJPT`@Tb@|@|Ad@v@LV`@r@T`@LRTb@DFBFb@t@HNl@hAj@bApA|BHNLTt@pAR^pA~B~AvCn@hA~@bBZh@|B`EzB`EhBfDdCnEt@nA|BhEdAfBvClFp@nAtAdCx@rAl@hAr@lAv@vAf@bAd@|@t@bBVl@Tf@N`@Pb@Vn@Tl@ZbAVt@JZTt@Pl@Pl@Rx@Lb@Pr@Jd@h@|BXrANl@`@hBb@hBLl@XhAXnAVjAd@pBj@dCl@jCp@xCb@hBLn@Pv@`@bBt@bDv@hDp@vC|@xD\~AHZJf@^zAh@dCdAlENp@FXJd@Lf@VhA`@dBR|@FTl@jCH\`@jB`@hBv@dDf@xBNn@d@tBv@fDj@fCp@zCZpAXlABLR~@@DPt@J\FRRp@Rp@b@jAN`@N`@Vj@Td@BD@DXh@\l@DFR\Zd@BDj@x@^f@\`@`@b@b@d@dA`A|ArATPt@n@`@\NL`BtAJH`Az@hA~@xApAhA~@hA`AZVt@n@BBz@r@VTdBxAd@^nAfAJJHH@@HHdAlAbApAh@x@dAjBj@fA?@JRTh@Rj@L^BDNb@Tp@\`ABFLb@Zx@j@`BPf@Nd@h@xA~@tCJVDN@@Z|@pAxDvBhGx@`Cj@~AXx@FR@@b@lAFRj@`BFN?BFNx@`C~@jCRn@@BPf@BHDHDLdA~CBD@FJX@DN`@Xz@FRVr@@@HV?@@BN`@L\HVTp@Vp@FRFNFLRj@@BRd@L\BF`@|@FL\t@`@v@Rb@?@Vd@Zp@r@rATf@BDTb@DJNVh@fAVd@P^LTJTl@jAP\Vf@`AlBd@~@@DLTFLBFVh@Xl@HPTf@P`@@@HRTn@Th@N^BH@BL^JZRj@DJNd@\jARp@ZhAZjABLV~@DPRz@V`ARz@d@jBj@zBNh@@BZlALh@@Fl@`Cd@dBh@xBZlAd@dBTz@b@hBZjABFLf@Ld@f@`Bz@fC\`A`@fA`AxB\x@h@jA@Bd@dA?@p@xAr@`B@@P`@Td@^z@f@jATd@h@jAf@lA|@pB|@pB|@pBTf@dDnHRd@fB~DpAvCRd@rAxCdDpHlEzJzBdFdDpHRd@DH`F~Kz@nB@@Rd@DJlAlC`ClFr@~A@BVl@h@jA`@|@h@lAz@nBd@bAVl@pAtCf@jAl@tAh@hA|@pBlBhEDLJRP`@FNXl@b@bA^x@R`@t@bB^|@nArCz@jBP`@Tf@f@jAZr@DFBHLXZp@f@jA`@|@@BDFf@jAR`@L\Zp@`@~@f@fAh@jADJN^bBtD`AxBXl@Rd@^x@tBzEt@`BRd@@@fAdCZr@Td@Zr@^z@?@DHd@fAd@bA?@f@dAd@dAp@|AjAjCHPJTv@fBh@lAxDrIRd@Rb@zBbFpBrExAbDZt@h@jAzAhDRd@Tb@Rd@Rd@f@jA`BpDJT@BFNx@jBDHJRvDrIn@xAlBfEnAvC^x@b@bALVNZ@B@@b@dAp@xA^z@`AvBLXn@xAr@~AtDnIl@pAVj@v@fBBHjAhCDJnArC`@|@p@|Ah@hA`@`Ar@|ALV@DP^N\jAjCt@`BP`@DHVl@f@fAd@fAJTJTLXhAhC`AvBJVjAhCXp@JVVl@Vp@Tl@JVJZTl@JZHX\dATv@rAtEBHJ\Nh@n@xB^pANf@Nh@~@bD^pANb@lBtGjCdJf@dBnAlEl@nBnIvY`@tAx@pClBtGZjA|@zC`ChIzD|Mh@hBn@xBpAnEjAbE^pAj@lB`BrF|CrKdCrIxAbFp@~Bz@rCxAhF`@pAt@jCJXJ^~AlFvDzMhAtDdEtNd@fB?@HXDNJ`@Np@@DNr@Np@DP@JFX@DDTDRNx@Jp@Nx@@FHj@?@PpAD\BVDZNvAFp@?DFl@B^Fv@Dl@@JFlA?DJnB@^JnBP~DB`@Dv@?@Bj@LfC?@Bj@Bj@Dl@JfC?@Bj@Dj@XpGFnAPbD`@lJ@PDt@@X@JBf@^bIFfABt@FnABj@LbCBp@B`@HfB?DB\H`BBl@Bj@J|BHdB@@\~HJdBHdBB\@VJrA?@HdA@DVlCDVFh@@HJt@Hn@VjBDTBT@H@FNdAHh@@JBLd@`D\fCBPN~@Jv@F^?@Hh@f@nDb@|CL|@Hj@NdAT`BT~AT|ANfAN`AXtBPnAVhBF`@DXJt@Jr@DXJr@@HHj@DVBH?HBN@FBH@FRvAHn@Hf@BXBLJr@F^NdARxALv@DZLr@@HBTRjANt@^hBLh@Jb@Pr@Pr@L`@FVFRRp@FTRl@HX@FTr@ZfAPf@@DHXDNn@rBJ\Rp@Pl@Vt@BJFPNj@JZPf@@D?@HVDNL^JZ\hA\jAHXHV^lABJFNl@rB@DPf@Nf@HVTx@z@nCBH@FHVFNNh@hAtDVz@nE~N`@pAZdA`@rA@Db@rA^pA`A`D`A`DtArETr@Pn@Tt@pAhEj@hB`AbDtApEjCvIbAhDhArDlBhGjBjGDLX~@r@|BBHJ\^nA`@pAb@xANd@Nh@bBpFNh@t@dCvEpOjAvDJ\Vz@Rr@\jAd@nBPt@V|AFb@ThBBRB`@Fn@HnABp@Bz@@r@@l@?f@?r@A`@?l@Cj@IvDI`EWpKIzCC~@C|AEbBAb@ClAAx@?NAdA?D@l@?h@@fAD`AJhBHhAH`AFf@Hf@Jx@RjALp@Pz@BHH\?@Pp@ZhA@Bf@~AfDrKr@xBzAzEPf@@DfAjDX~@l@jBFP^jAdC~HRn@~@xC|DbM\hA@DN`@@Dd@vAlAzDrAhE`AzC@Bt@`CTr@b@vAPp@L`@Pp@XfA^bBXpAX|AVtA^zB?@@@Jj@RrA@@Hf@ZjBBLD\PbANt@TtA`@`C`@`CH`@b@jCl@lDl@jDpBrLBNJh@l@lDTtAX|AXfBX|AfAnGTxAdB`Kp@zDTtApAnHV~Aj@`Dv@xEJh@Hj@Jf@`@bCVvAp@~Dd@tCb@dCBNZ~ATlAf@xBd@dB@HVz@FT^pAVr@\dA|AzDh@rADLd@`Ad@`AHNLTj@dAx@xAr@hA@@f@|@BDjCrEHLTb@HL\n@hAlBhCnEpAzBp@jA|AjC@??@T^@@Tb@Vb@`@p@rBpDnAxB^n@R^HJFJ~B~Db@v@bEbHn@hAtFrJr@lAtBpDl@bAr@pAd@|@@Bd@bAp@fBFL?@FNHVJ`@`@vALh@Pr@PbALt@TrA?@Hf@?BRrARvAHj@@@\~B?B\~BHh@@Bv@rF~AvK?Df@fDHj@@DFd@@D\zBHj@@DHj@PpAHj@TtAHj@?FJh@ZzBJr@PnAfApHTtA@H?@p@rETbBnAxIJp@Jt@RlA?@\`C\bC`AvGtAtJpBdNJv@xA~JPpANpA@JLzADh@JtAFr@\~EB^@JBX@XJhATbDPfCJxAVlDFp@PfCPdCj@zH@LNvBDl@RrCPxBVrDDj@Dl@hAzOJxALxAPdC|@`MPdCRjCPhCDl@j@xHDl@JxALxADj@@Nl@vI|@`MpAfQnAfQ\~EFl@PdCDl@Dj@j@zHDj@Dl@JxAj@xHT|C@TPdCDj@^dFP`CDl@PdCDj@PfCBX@Pl@pINzBPtBL`BFr@Df@L`BNnA?@BTHp@@HBNFl@DVFb@BLJp@F^Hf@Ln@Nv@RbAXpAR|@BJXjAf@xBH\T|@r@vCb@tBJ\Nl@Nn@BJLf@Nt@FV@HDPNp@TpABL@FDXJt@Jr@Jp@F^Fn@@BHv@Hx@JlANlB@FFfABPBd@?@BV@L@NFt@@VDZ?DHz@Fl@LlAJv@Fb@DZ@J@FZ`CHn@D\Jt@Fj@BJBVJv@Hf@@LD\Hl@Hn@D^BXDb@BVBX@XBZ@XBZ@Z@X@Z@X?X?\?\@VAt@An@?VAd@AVAN?FCd@AZC\C^ATCTE^CVCXE^Ip@[bDStBGj@It@WdCGr@Iv@CZAXCZA\AZAXA\?X?T?F?V?L@L?^@X@X@XB\@XBZBXBZHr@HdAf@dFTdCPdBH~@Fv@LlABXFj@J~@VfCJbAN|ALrAFj@Bb@Ht@Hv@Fr@DXB\D^DVBVDZFXFZDZDP@BFZFXHXHVFVHXJZJVJVHTN\Xj@HPNVV`@R^RTV^n@t@NNPPTRLLTPJJb@Zd@ZTLLHTLRJ|@`@ZNLFl@VnB~@tB~@B@PHJDRJr@ZlCjAd@TbBt@nCnA^N?@RHJFTHJF`@P^N~@b@n@X|Ap@PHtAn@x@^l@Z|@f@v@d@TPXTz@t@fAfA^h@T\Zd@NVHNR^\r@h@nAJVJXRn@Pn@BDNn@FT?DNr@FTJt@Jt@Jt@JnA?BDt@@R@`@Bv@@L?f@@t@@vA?r@B`C@pBBbCF|AF`AHz@Jx@Nz@Nv@DTH\L\Tj@Th@@BLTLTLV@@T\?@DFl@x@l@x@b@h@RVX\p@z@l@x@Zf@LPNTLTLTZj@DJDHLXTd@JVb@fAHRNf@DJFX@BJVXbAH\^bBJh@DRLf@TjAPt@Px@FXx@|DFTv@vDXpABJF\R|@Pl@DPJd@L\Vr@L\P`@DLb@|@R`@Vh@DFNXp@bA|@jAn@p@LNfBxAl@d@RL^RBBPJdAj@`@NVLLF|DlAd@LF@bA\hA^dBh@VHvAb@\JfJvCtA^XJdAZ^JTF\LJDFBD@PHB@f@PnAp@TNjA|@h@f@LL~@dADD@@NV`@n@HNVf@Vl@Xz@`@pAZjA@H@BFXBJJd@R|@R~@ZjBJh@@DNx@?Db@tCL|@n@xD`@nCDXr@rF@JVfBDh@Bd@R~A`@`EHdAXpDFp@NlC@H@ZDl@Dv@@`@Bl@@N@\HpBBd@@Z@VBpADhABzABxA@fA@`C@Z?@?X?P?|@?\@V?nB?P?Z?L@^@fB@lA@jA@|@@Z?N@PDzBFxAB`A@TBr@Bd@?LH~ATlEJfBb@zIPfDDx@LfCBl@NfCFrALbCNpCL~BTxE@LNlCLpCPdDBn@@JBj@DrABhA@fA?P?H?j@?@?P?XAn@?PCfA?H?FAX?@Cj@An@EjBAHAVCr@Cp@?FEp@G`ASvBKbAO`AObA?BKj@CROv@CHKh@Mh@?@Mf@I`@Oj@ADOh@ABMb@_@pAABMb@Oh@]jAADOf@[fACHOf@_@nA?@[fACHQx@M\YdAEJo@xB_AbDoAjEoAjE_AbDIVkBjGMd@_@rAq@nCWnAg@hCW|AUxAMdAKt@AFGn@Ip@KbACPI`AGbAEr@Cd@GbAGzAAJCz@AHAn@CdBAN?T?XAR?~A?P?ZAV?V?|A?L?`@?fAAdA?l@?p@?@@xA?tBAfB?p@?|@?j@AD?dA?t@?d@?DAd@AxE?dBA|EAhEAzB?B?@?d@?DAtAAjFClG?BAzE?FAjD?HAjFAvF?PArB?T?dB?B?@?j@ArAExJAnFA|A?t@?~@AlG?hDA|E?J?tAAfD?X?X?FAhD?b@AT?PAzCA~BAdG?p@AvBAdHAjD?l@AfC?@?j@Mvi@CfJ?zAAjB?l@?F?`AC|F@TApBC|H?~AAx@?Z?~ACvGA|DA|D?hA?T?J?xAEnMC~M?zAClG?tDApDAjEA~AAvB?bB?\?@?v@?lAD|DD`ADtABj@Bl@F|@FdA@HDj@HpA@FT|BPlBBNNxAV`CBXNpA?@DZBXHv@Fh@RnBXlCJ`AFh@|ApOD`@^jDTfC?HBR@HFp@J|@B\@LLnATbCPhBBV@LD^J`AJx@D^\`DJ|@TpBDf@Fl@XrCh@|EX`CVhBRxALv@?BRfAJl@DRJn@VfATfAXnANh@^`AHR`@bAT`@Zl@Td@DHHLDHn@dAfAdBl@~@FLHL`@n@jFjIdC~DXb@tBfD@@dAbBV`@?@V`@n@bAT`@@?V`@l@bAV`@V`@JPd@n@TZl@v@Z\NPRTJJNLNPLJFFRRt@l@HHp@f@@?b@ZVN\R`@TB@NHj@ZZPbB`AFD`@R|Az@bBz@`@PvAt@f@X~@f@vAx@f@X^RVN`CnAFB^TvAt@xC~A`ExBpFtCt@`@`@R`HtDbEzBDBpAr@PHpBnANF~A`AFBHDTNHDzBvAVL`Af@|@^`@PZNj@Tv@b@NH`@T\Rd@XNHf@\^VBB^XVPDBXRbAp@VRDBb@ZpBpADDtCnBb@XhAv@f@^f@^RNHHPNDBDD\Z`@`@`@b@h@n@LRHHJNBBHJPV\h@Zf@Zj@f@~@Xl@BFVj@Vl@DJ`@lARn@Rp@XhADRJb@Ll@?@F^BJJh@?DDZF\BTPzAFv@Dt@Fv@NxBVnDN~BLvANxAXvBBPZxBJn@Jh@?BTpAVtAZbBLp@FZJn@@BNv@BN@F`@`C`@xBd@fCHl@Jp@F\@BTnAThAPv@FTFRPt@HZNh@HZLl@BHFVBPHb@Jr@Hr@Db@BPFt@Bx@@BBn@Bt@FpABr@Bb@Dl@Bb@@FDj@J|@Lx@Jf@Jb@Tz@^lANb@Xn@Vl@LZHPHRJVXn@@BTj@P`@P`@?@@@Tj@N^FLTh@\z@z@pBFJLX^z@f@jAd@jARd@Rd@BHv@fBtBbF?@\t@d@bAXl@Xl@Xj@Xl@f@~@JRLTPZHNZf@HJPZDD?@HJNTZ`@PVPPLLVVLJNNTT^XRLPJd@VRLRJRJTJJDFBTHRH@?NDRFLB?@^Hd@H?@@?`@FJ@RB@?@?PBf@Bj@@B@b@?B?^?d@?`@?@?X@F?b@@l@Bh@FVBRBr@Lp@Nh@Pz@Zj@V\PXPd@Xz@l@hAv@|AfAd@\fAv@z@j@d@Xd@X^PZN`@Pj@Rd@NNDF@VFh@Jh@Hh@F`@B`@@n@@b@?vA?`A@b@?R?r@?b@?F?l@Bh@Bj@Df@FvAPhBVvCb@lAR`@Fv@JrEp@n@JxBZrBXtAThDd@jLbBb@Fp@JVBdBVb@FjC`@z@LdBZpB`@jAVPDzA\zAd@jC~@v@\FBh@VLDDBNH~A|@d@Z`@Zf@`@f@`@B@VVh@f@`@b@\b@BBZ\V^FHX`@PVZf@Vd@Xh@@?d@bAb@`AJTLXJVFJRd@t@bBr@bBzAbDz@nBVl@P\Rd@Rb@?@Rb@f@jA~@tBd@fAj@xAN^Nf@JXRt@J^VfAR~@DV@BLz@Jt@Hn@Fb@Dl@H~@@PB`@BX@r@Bj@@l@Bl@LnG@X@`ADxAHbFNjHP|IBlAD|ADdC@j@JbF@l@HtDDxAJbF@j@PjJ@l@BhADjBLnFL`HR|JLdFBdAN`H@d@@j@FjDV`ND|AJfFJhF@p@@r@?HHnDB|@BfADxBBz@Bn@@PDdALvAFn@@JD^DZHn@@JDRDVDRDVFZBLJd@Nr@VbAL`@Nf@DNBDVv@Vr@Vj@Rb@BFLXJRXj@FJPZBDXd@T\FJTZHJZb@`@d@`@d@TVJJp@p@tFfFh@d@nCdC~@z@`A|@LLvBpBnAnAfC`Cp@p@r@p@lAjAb@^f@b@|@t@LRXV~CvCx@v@|IfIvClCzAzAtDjDZZdA`AbCzBrBjBFHfBfB@Bt@z@p@z@HJ`BbCv@zAr@vAtB|E|@`CHRJX^~@N\\x@r@jBjA|C\v@JXd@hA|@fBv@vA`A|AXb@hA|Al@v@LNb@f@l@n@`AdAbA`AxD~DhAjAd@f@</points>
    </polyline>
    <duration>
     <value>5176</value>
     <text>1 hour 26 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-44&lt;/b&gt;</html_instructions>
    <distance>
     <value>157216</value>
     <text>97.7 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.8367953</lat>
     <lng>-92.0968131</lng>
    </start_location>
    <end_location>
     <lat>37.7545173</lat>
     <lng>-92.5021009</lng>
    </end_location>
    <polyline>
     <points>__}eF`tbqPdAdAx@|@t@r@vAzA`@b@~@fA`@j@VZPTpAhBPXzA`C^l@RXR\LRZf@JPV`@V`@`@p@d@t@b@p@V`@JNBDt@jAT^r@fAXb@FLf@x@Zb@Vb@Xb@pArB~@|AnEbHJLtBhDjE`Hb@r@~@bBLV^v@`@bALZL^JZX~@Ld@R|@FXRfAHr@Hr@Ft@Fr@FjABj@FzADfB@d@LfE@b@PnG@l@HbDBx@@^p@zVBp@PdH@Tf@fRDhB@b@FhBDpB\bMFxBBp@?R?@V~Ib@`QDpAD~@?R@J?TB~@DfAFlBBbAB~@F~B?JFlC@FFzB@V?R?HBt@@XHlCH|CFlCBl@?DDtADxAB|@@j@B~AHjBB~AFdC?tBKlBKnBkAfIE\o@rAIl@?@StAKz@WhBUhBYxB[zBK`AMv@Gj@Il@Eb@I`AGt@G|@AVEt@C|@CnAAdA?D?f@?X@f@BnABnA@vADvBDjBDfC@b@D~BB|A?NDxCBfABjAD|CBrABxADnB@b@@`A@z@Bv@?DBpA@t@@Z?PB|@?V?@@n@Bf@@`@LrBFj@Fx@NfAHp@RlAVlADRPv@Nl@Rn@J\L`@DLFPFR@BP`@HRDJJT@DLXDJVf@Tb@DHJR@@BFNXl@hAFJVd@LTTd@PZBD?@DFHNDHTb@HNJPTb@JPFLP\JRLV@@Xf@LTJTLTLVf@~@LVLRZl@Xf@LVXh@LTLTLTHP\n@Zl@f@~@Zj@LVJVLTVl@JTVp@Tl@Rn@?@Rp@HXPn@HXFXFXFXJl@FZF\FZBP@HHt@DVBXD\JpA@ZBZ@ZBXBv@?H@PBv@@t@?t@?t@AnAAxAAJC|AA~@AJArAAl@Aj@Aj@?BA|@ChA?ZCtACvACjBA~@An@EfBCjBC~ACbBAhAAl@?`@@v@?@@Z?NBj@Bl@Bl@Ft@BXBXDZBXLbAF^@HLp@DZNn@Jh@^vAPn@Rp@HXN^J\L^N^JVHTHRTf@b@dATb@?@LVXh@Xh@DF\l@HLFJx@tA\h@T`@LRv@tALR`@n@h@~@p@jAV`@FJLVn@bAVb@fAhBlCrEtG~KjCnEjCnEnH`MFHBDnEvHR\BB@@HNDHDFp@nAn@fAb@x@DH@@b@z@FJZl@FL\p@d@~@NXBDFJj@fAZn@LX~@hBl@hAZl@v@`Bd@|@\n@Tf@p@pAR`@Vd@Vh@T`@tBdEzAxCl@jAnE`JHRLVHRJTJTHRJTHTJVHTJVHRHVBDl@dB\`AFNp@pBJZDJJZTn@^fA\dAZz@JZTn@\`AHXXx@@B|@fC`@jA^hAJXb@rAd@rAd@rAn@`Bf@nAVn@Vj@JRLXXl@Xf@Tb@JRHNFJLVDHn@fALRHLNTV`@PV\d@JNNRLPrAdBl@v@f@p@f@r@\b@NRn@z@^d@pBjCjCjDLP@?LPJLTZZ`@PTNPPTLPNRNRLPPRNRNRNRNPLPPVNPLP@@JNNRPTDHHHFLDDLRNTLRJRLTLTDHHNHPBDJPJTJTJTXp@Vn@Rh@Tr@L^Nj@Rt@XlAVnALl@Hd@T~AFd@@FPhBJjAF`AVdEPnCJlBPpCL|B@NB\Dj@RpDFv@Bj@@BHxANhC?BBV@TPtCHlADp@Dl@@TR|C?DFz@X|EZdFLrBBd@FfAJxADv@HlANfCDx@HjARzC@VDl@Dp@N`C?BHxAHtAJxAJjBr@dLHhAHbADl@JfBHtAJpA?VNvBDbAr@~Kh@hJJzA^jG^lGHrALjBFlAB`@`@vG@Pn@bKPzCBVRrDDh@HpAh@|Id@rHJbBNdC@\@NZ`FB\NtCTnD@VP~CB^BZ@ZJhBN~BJfBJvAL|Bl@tJ@RBd@NtB?HFz@TbEBZB^RbDh@tIFjABVBn@b@fHBTF`AHpA@TDh@FjAFpA@TB`@?J@L@P@\@Z@X@r@?L@j@@n@?D?v@@L?L?F?V?L?F?d@?NArACpA?DAXAZA^?PAJCdAGrAAVEv@KjBARKxBc@~IMpCSfEEx@A^Ej@?FIhB?BANMnCEr@GpAC\Cp@C\AZAt@AV?FAR?D?X?P?d@?|@B`A?N@JBz@BZ@Z@TBX?BBZHr@@R@FFn@BT@DPnAJj@@DJj@F\H\TfANv@d@~BNt@Ln@F\ThALp@d@~Bt@xDXzAP~@^dBb@zBXxA?@h@jCF\Lh@F\BL@FThAJh@FZPx@?@H^Nr@b@~Bt@rD\hBLr@TjAJn@F^DXDZDXHl@DZD\DVHt@D\BZHr@B\BXFp@Dv@HnAFv@HtAHpAHnAJhBFv@Dj@Bb@JhBHrAHrANdCLjBRdDR`D@RJvANfCLnB@VHxAJbBVbEDl@Dp@HlALnBNdCh@nIDz@F|@PpCLnBJjBNhCHlAFx@TxDR`DPvCHpAJfBNzBLvBHtABXB\JfB@DBf@@LDl@`@xGj@jJPvCVxDT|DLnB?@Dn@?JHhADl@RtD@JHtAHpAD|@R`DBj@@PBh@f@tJR`ER|DBt@Fz@L~CLfCj@tK\lHLfCDp@PrD@JB`@FxA@J?BB\HxA?HB`@FnALdCJhBLbCBh@Bn@Dx@NtCZxGHjA@`@@TB\Dx@Bf@PxDHxAFjAD~@@H@VFdABf@Bl@LxB?LBf@H|A@JJzBLxB@b@V`FLdC@J@NNxCLlCBd@TrEBj@@N?H@RDj@LfCBj@BXDr@?JH~A@T@P?DHzA@TBt@?F?^@j@?z@?XAx@?DAd@?LCr@ALAPARCt@C`@AHSvCEx@YvEMnBARG~@InAS`DKtA?JEh@?BIrAQjCMzBSjDKpAK`BCj@APC\KtAATKjBADAT?XAXAZAXA|@?p@?jA@|@@\Bt@BZBp@B^Fv@BVHt@Hx@Jp@D\Lr@ThA@HDPFXHZFTPn@Rt@DJVv@HVVn@JZRd@Zv@fAhCzFhNRf@Pd@j@rAN\zArDj@tAx@pBh@lAPb@Rd@j@xA`@~@Pd@hClG|@tBpA`DrAdDBFlAvC@BP`@h@pAn@|Af@lAPb@Vn@Rd@`@`Ax@jBDNr@bBDJ\|@Tj@Rl@Rn@HZHXHVNr@VjA@BHf@BLDVFZNhABXD^BRD`@Fr@@VBZ@\BZBt@@R?`@BtA@`CAV@N?~EBtI@zG?vE@vE?r@?D@l@?lA?r@?X@dA?d@?d@?B@rE?z@?|@@dB?rABlAD`BF`BDlAHtAJvAL~AJjAHx@J`ANfA^bCV~A^tBFZBH@FDVBJ?@Jj@Hb@?BH^X~AVtA@DHb@RjAZ~A?@Jh@`AlFRfAl@fDRbAVxALp@^tBDPHb@Jj@VzAHb@H^@JPbAX`B@DF^@J@HDTZvBBTNlABTBTP`BJjALrAL`BNrBFjADr@HhB@d@?FDrA@r@@d@@`B@t@?pAArAAp@A`@?JAj@?@AZ?PGlBIvAIxAUdDW~BMjAKv@UzAY|AsAjH</points>
    </polyline>
    <duration>
     <value>1257</value>
     <text>21 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-44&lt;/b&gt;</html_instructions>
    <distance>
     <value>38206</value>
     <text>23.7 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.7545173</lat>
     <lng>-92.5021009</lng>
    </start_location>
    <end_location>
     <lat>37.0822984</lat>
     <lng>-94.3601995</lng>
    </end_location>
    <polyline>
     <points>w|leFbyqsPk@|BGTIVs@fCSp@GROh@Of@m@nBsArEW|@o@rBOd@GVAB_@nAM^yAbFSr@c@vAq@zBcArDm@rBq@tBWz@_@pAGRY|@]hAIXGTGRGRADOj@M^CHYfAMh@Qr@YnAOn@I\?BCLENEP?BCNI\Kp@QbAAJStAe@`ECRCZAJG`@Eh@Gv@C`@GbAC`@C`@Ep@EnAEfAAx@C~@A|@?v@A~@?d@?H?v@@|@B|AD~AFbBJ|BF`AB\Fz@TbCBVHn@LrAPzABLp@|FLdARjBZfCLlAFf@Hl@?@Jt@RjBLdAD`@@BFj@L~@V~BXdCb@rDThB?@J`A^~CFd@\|CDXBPBR?DJx@\zCNrAp@xFLfAZhC\zCPpAXfCRhB?@L~@LdANpAFh@?@Hl@\vCf@lEPzAhAvJb@lDXlCJ|@d@xDTnBHt@VxBVzBHr@XbC@@`@nDFj@Hj@Fj@RbBD\V|Bx@dH`@fDl@bFf@nENpAHj@Fh@rBpQFd@Fb@TvBVnBVxB^jDF\Jx@TfBV`Bh@|C\hBTlAf@`Cp@rCTz@Rv@T|@r@~Bd@|ADLb@rAZz@Z~@FN`@dAdAnCd@fATf@d@dANZj@jA\t@R^Td@PZNZn@fAxAdC?@~@vADHDFdA|AjA~A|ArBnB`CbCnC\\lAjAjBdBbBxAlAbAxAjApB`Bn@f@l@f@PNvAhArB`BDDRNHFBBpAdAbAv@rAfAVRDD\X\X^Zz@p@b@\z@p@r@l@FDx@p@z@r@z@p@z@p@^ZbCnBzBhBdAz@hA|@xAjANLDDxBfBp@h@^Zp@f@bAz@PLnAbAbAx@JJJH^XbAv@x@r@HDLJNLhA~@j@d@x@p@|@r@j@b@d@^RPVRpB~AHH|@r@`Av@pAfApAbA^ZfFbEz@r@JHbAx@`CjBJJPLjCvBFF^ZTPDBtBdBhBvAjDrCbDhC|BlBz@p@bAx@hA|@~ApAXT@BzAjAHH|@r@PLz@p@BDNJbAz@hAz@xAjAjCxBfCrBlEnDp@h@xEtDdDlC`BrAt@l@p@j@fAz@|@t@@?jBzAHFJHFFfAz@p@h@x@p@@@JHRNh@b@lAbAJJ@?PLTRd@^JH^X\XPNdBtAb@^NJJH@BNJHF@@^XPNxBfBfBvA@?x@r@RNDBVTJHn@f@JH|@r@p@h@\Xh@b@n@f@vBdBlA`Ax@p@fA|@t@j@zCbCXTlA`A\XjBxALJ^ZxBdBLLNL`@XjB|AvAhAPLfBxAB@tBbBJH`@\l@d@v@n@hAz@t@l@LJPLDDpAbAf@b@`Av@tB`BnAbADBDDtAdAr@j@@?d@`@pB~AHD\X`CjBt@l@pAbAr@j@hA|@x@p@LJh@`@d@^~AnARNrB~AdAz@t@j@t@l@|AlA@@v@l@vAfADDf@`@f@`@zAlA^Xf@`@n@f@HHNJfBvARNxBbBx@p@\XnFfEvDxCpB~A@@vBbB\VRNf@`@\Xv@l@DBvBbBdBtA~BjBJH~AnAdDhCtB~A@BxAjA\V\XdBtAPLnA`AXTdDhC|@t@bAv@v@n@fF`EnCxBxBbBbCnBlCrBdHtF`@ZdBtAtHbGjA|@bAv@zAlAXThCpBf@`@`BpA|J~HnCvB\XVRnFfEzAjA\XB@h@b@RPbHrFb@\vBbBpB|AFDhA|@TRv@l@JHbBrAfAz@ZVf@^~BjBlCtBhCrBdBrAlG~EtAfAzGlFpAbA|AlAvAhA~ApAbAv@hBvAtGdF\VZVzAlA`@\nCxB|@p@vDxCXRz@p@jA~@jEhDjA~@jCrBn@f@dBtAfA|@^VPNrAdAlA`Ab@\VRnFfE~AnAn@f@zDzCx@n@lBzArCzBRN`K~HnCxBr@l@hA|@rB~AbBpArB~AdHtF\XxFnERPRNvGhFf@^RP`CjBp@h@\X~@v@nBbB^Z@@tAnAt@r@z@x@pAnA~@`AbAbAzA~A\^z@`Af@l@DBz@dAbBpBFH@BBBJLhB|Bd@l@fAxA`B`Cf@r@r@dAhAfBtAxBjAlBz@zAl@bA`@t@Zh@d@z@l@hAh@`Ap@pABFv@zAh@jA\t@Vh@|@nB|@lBVj@l@rAzAfDhC|Fp@zArCjGdCrFLZx@fB~@tBpBlEj@nAfCxFbAzBj@nAr@|A`BrDd@bAN^`BpDvBxE~ApDbClFhAfCdBxDvA`DrBtEpCfGvA`DvA~Cz@nBp@xABFx@jBtAvCjAjCz@nBh@hAn@xAt@`Bb@`Ad@dAtAzCf@fAzAhDnLnW`@~@\p@rA~Ct@`BdBzDdBvDhCzFnBhEzB`F`FzKvB|EhB`E|AhDnGnNx@fBP`@N\nAnC\r@x@lBFL~AnDLVhBbERd@NXnApC\v@d@dAVj@tAxCbAzBlCbGbBvDBFx@dB?@HRZp@~@rBRb@?@JRDH~AnDFN@@JT`BpDdBxDhAfCBDx@fB?@HRBDbAxBFNJTHRvA|CBFJRp@zAl@tA|BbFb@`AP\HRVh@n@vAHR@Bz@jBn@vAt@`BhDvHVh@Zr@^z@Rb@FLZr@`@z@pArCv@fBHP@DP^@DbBrDr@~A^z@p@xAlC`GVf@^~@f@hAlBbE^z@zAdDFNBBFPdBxDVj@z@lBHPJRHNDLBFHNf@jADFZt@jAfCLTp@zAd@~@FLh@fAP\d@~@HN\n@b@z@BBf@`ATb@BFLRBFVf@j@`A|@bBBDT`@R\BFV`@Tb@DFPX|BzDdBpCvAxBvBbDh@v@jD`FPTjA~A|BzC|C~DDBV^@?~AnBvA`BvAbBd@f@d@h@j@l@NR~AbBhAlAtAvA~B~BXXb@`@@@`A~@PPjBdB@B~@z@ZXZXpAlAx@v@^\v@r@hBdBxBrBlCdCJHx@v@dAbAxApAt@r@fB`BvArAfAbA?@\Zv@r@ZZ~@z@tApAPPDBv@t@\Zv@t@h@f@VThAfA\XBBh@h@h@d@hBbBf@d@ZZRPhBbBvApAzAvAf@d@HHfB`Bb@`@nBlBl@h@dA~@x@r@PNtAfAhAx@@@ZRHFr@d@FBBBRJ~@j@DBXNJDRL@?HDt@^HFB?PHVJRJTJfAb@DBTHJDvAl@JD\Nx@\JB?@hCdAd@R|@\pAh@@@JDn@VZNJDj@T`@NhAd@RH`@PdBr@VJ~Ap@lAf@~B~@DB^NRH~@`@p@Vt@XxB~@j@T^PdCbA|An@FBXLf@Rz@\DBZJDBdBr@~D`BbA`@x@^|@\\N\L\N|@\v@\@?XLXLbCbAzB|@JFn@Vv@ZB@pAh@`@Pf@PFDD@tAj@^NdCdAn@VvAl@HBnFxB`@PlAd@|CrAlAf@d@PvBz@d@RbEdB`Bl@jBx@fAd@f@RtChAl@Vr@ZbBr@zCnAp@XvDzAhEdB|@^xB|@hAd@h@TRHLD`@RlGfCrBz@xB~@VH^P`A^HDnBx@JDLDNFB@`A`@l@Vr@X@@l@VfAb@`DpATHdBp@bBr@TJTHnBx@ZLRHz@^pAh@hAd@b@PnCfAFBpAh@ZNl@TXLdDrANFjCdArB|@fAd@@?j@TB@jAf@PFbA`@^PVJFB`Bp@~CpAlBt@`@N`Br@x@\bC`A^PdDtAvAj@~@`@bC`A@@pAh@nBx@^NXLhAd@hDrAvB|@dGdCjFtBxCjAlChAtAj@~@^lHzC~@^hBt@XJp@ZvCjAr@XnChAlBv@ZLfAd@bBp@jAf@v@\@?pDxArAj@lGfCz@^FBVJFBXLjAf@^NvCjAlDvAjBv@VJ^N~B~@f@TdBr@xB~@r@XlIfD`Bp@l@VVJdCbADBzGnCnChAf@Rb@P\Nl@Vv@ZpBz@jAd@tAj@b@Pz@\r@Z\LxB|@VJnAh@RH`@N^Nx@\|Ap@l@VlDxAzB~@v@^tBz@XJRHt@ZHBvAl@lBx@hDtA`A^p@XlAf@LD~B`AhEdB`Bp@VJHDfA^~@`@XJNFh@Th@T`A`@PFNFrAh@pAj@jAd@RHdHtClEfB`CbA`@N^Pj@T`A`@bBp@bBr@zB|@TJdBr@bGbCn@Vp@X@?^PdCbA^NjAd@f@T|@\z@`@pAn@j@X^RBBv@b@`@T~@l@n@b@`Ap@nBtAd@\PNhAv@DB@?z@l@?@dBjApA~@fBlArA~@^VRPHFXTtA|@bBdAnAr@`B~@hAl@|BhAp@\|@`@d@T~@^@?`@R~@\d@Rb@NZJ?@d@Pz@X@@HBt@Vd@N@?j@RhCt@~DjAdAXfBf@fCr@x@PJB`@L`@Jb@LvBn@@?zBn@LDD@fBf@XHFBdAX`@LJBTF`@LdAX`@LdBf@fCr@fAXhA\`Cp@@?`@L`AXb@LjBf@PFbGdBFBfEjAtA\hBd@jAVtAZfAT`Ex@zBf@h@Jz@Rn@Ld@J~@TnGrA`@HvGtA`@JbATzBd@|Cn@nAVz@R`@Hb@H`LbC`Ez@`@J`@H|@RRDr@NRDXD|@RLDRDJB^Hj@Jv@PvAX`B^tAXlFhA\FVF@?dDr@h@L^HlAXZFtFjAjAVHBH@h@L|Bd@pAZt@NPBbATzBb@`AT\J~@Tl@Pb@N~@ZRH@@`@NXLd@TRHLHD@f@Xd@VXPLFb@Xd@ZB@dAx@NNDBb@^LLb@`@^\TTnAvANPPT^d@\d@^f@?@r@~@TZ@BRXbCdDxBzCBDr@~@~AxBdAxAdAvAx@jA^d@|@nAnAbBj@v@RXpAfBPVx@fAvC`EnH~JdAvAbB~Bx@fAvBvCjA`BfAxApBnCr@bAJLNRpA`Bb@h@TX\`@@@Z^\`@Z^dAlAx@`A@@VX@@t@|@RTdAnAXXBBRV~BnC|ExF~DvEdDxDxAbB`AjAjArABBTVpGrHRVnAxA`AfA\`@`@f@h@p@TX^f@n@|@RZPVFHh@|@h@|@\l@h@~@d@`ATb@\t@Zp@d@hAb@fAXr@j@zA`@jAx@vBf@rARf@Rf@?@BFBHHRFP@@FRN^Tl@v@vBVn@b@jA`@fATn@d@hAj@|ATn@fBvE`@dA`@hAVn@^dAVn@Tj@Rj@Pb@Zx@Vn@Vl@Tl@d@`AXl@Vj@HLR`@Xh@LTVd@PXXf@LRPX\h@X`@HLT\JNRVJNHLh@n@X`@PRNPNPLLTXPPNPzD~DvKjKrYbYxEpE|b@fb@hBfBb@b@^`@r@x@VZVZn@x@^f@^f@V^^j@p@dAh@~@l@bAf@`AVf@Xj@r@|Az@rBv@rB`@jA?@`@fA\`AHRPh@JZ^`AL\L\Nb@^dAb@hAVv@HT`@dATn@L^?@FNHT?@JX^hAZdAPn@FRNj@DPPr@BJJf@Ln@Nx@RdAJt@F^L|@Hn@H~@Fl@Fp@Fv@Fv@?LDh@?@?@Bv@Bx@B|@DzA@NFfCDpBBv@?f@@Z@r@@j@?J?f@?vA?t@A^?RA`@?ZAR?b@AZAX?XAZAZARA^CbAEbBATAb@Al@Ab@Aj@ADAf@?JA\Aj@Ad@Aj@Ab@Ad@?f@?RAf@?l@?b@An@?r@@\?`@?t@@n@BrA@t@Bz@?PFvAB~@@RD~@Bd@@PDz@HnAFx@Fd@Dd@Fh@b@nDl@xERjAnCjNbCxIlCbI~DxKxGlO~EvKpHxPhFjL`G~M`GzMbH`PxF|LbElJvEdKrAxChE|J|AdDz@tB|ApCrAzB~B`CjCtBrCbBnAx@rAx@rAz@^Td@ZZRXP\RXRnAv@d@XbAn@\TLHn@`@d@XXPTNd@ZVR`@Zb@\LLVTZZZ\RRRTPTV\PRBDZb@RX@BTZNVPXNV@BNZNZR^P^P`@JXHTHTN`@JZJZRn@Lb@Lj@R|@Ll@Ln@Lx@Hf@@JDX@NFf@Hp@BPDVBZX`CNpANpAVrBn@rFVxBPvAVtB`@rDl@`FThB^hD`@fDLfA@FBP@N@?^bD@Jt@jGRhB\rCPvA?BPvABZ@H@DHn@Dd@Dd@Df@@J@P@H@P?@B`@Bd@@l@@^@b@@b@?d@?z@?pACnG?l@AZ?hAApAAnEAz@?xA?ZAXAjDAxD?F?R?XAfCAP?tBAvA?@CxE?r@AnDAp@?z@AxB?LCpG?Z?l@AdC?@?d@ChHCdECpE?bA?p@CpFCjG?vAAlAAt@AfAGbFGtDEnBCdBChBGnCCbBEzBC|ACv@A~@KzCOdEGrAEx@ADGpAAFCf@En@SfCEZStCEh@i@vGKjAQvBWzCCREj@APAHIv@AREf@OdBWdDGp@e@nFM|AE\Cb@Gt@G`ACp@Cj@EdAGhBG~CAv@?b@@nA?T?Z@n@@t@@R@h@?PBz@D~@@`@Dv@@VF`A@RHbAF`AFr@BNLvA@@Ht@LjA@@VjBPjAZfBNt@Nt@H^Jh@@?h@|Bl@xB@@Ld@Vz@j@dBj@|A^fAt@rBt@tBv@vBt@tBJV`@jAr@rBv@vBxAdExA`Eh@zAb@jAd@rAf@|AXz@Tt@h@`BVz@Rp@Pr@d@|ALh@V|@VbAZtAt@vCnBdIvFlU\rAnAfFh@zBh@vBf@rBDPhBlHpG~WdAdEv@`D|@pDLh@Lh@`AxDdDdNrAnFLh@Pr@`BzGnC|KnBdILh@\rAhAtEp@lC|Ktd@fEbQJb@J`@dAfET`AJh@VrARbAJv@Jr@Hl@@FJt@Jr@Hr@Ft@DZDZFt@JpAFhA@HJhBBv@FlBFfD@lB?l@AbN?vW?n@?xL?p@Av`@?b\Ad_@?`B?rB?nD?rD?rU?P?hHAhC?dA?T?l@?|H?pO?n@?@@f@Ax@?bM?zKAxH@vMBb}@?^?fHCte@AxP?l@?jIApL?hA?V?rA?vKAxM@fHAtF?`C?|JA|M?zB?dA?f@?jE?p@?n@?tV?`@?`WAxA?hb@?tD?`FAnf@?x@?v@?`F?J?L?pBAjL@r@?p@?tF?rAA^@J?@?J?NAjI?jB@fF?pB?pAA|A?~I?d@?Z?X?zD?pF@l@?bAAj@?tH?dJ?bD?p@?lG?V?tF?`L?fC?jX?l@?fCAnI@rB?hAA`C?hK?l@?tA?tK?pK?pB@d@?T@\@l@Bj@Bh@Dx@Df@Fp@Fn@D`@BRLhAJd@VxAb@lBf@dBZ`A`@dA^z@h@hAx@|AJPpAnBr@z@xAbB^b@j@l@HJlAtAz@`APR@@DDbBnBFFNPVZJLPRXZJJHJ@@fBpB|BhCBDl@r@tB~BzClDfAjAtA~ARVZ\d@h@bAhALPTTDFv@z@RTFFPTl@p@|@dA`DpDbAjAh@j@TXfAnAjBtB`@b@nAzARTZ^z@~@@BVXBBbBlBvA`Bx@|@lAvAZ\d@h@NNBDLNdBnB\`@`ClC@@pBzBn@t@zH|Ib@d@tIzJ~@bAj@p@vA`B~@dAtB`CfBrBjD|D|AbBrA|ApB~Bf@j@|AjBf@j@fAnAdBnBlBvBRVb@f@b@f@BBfCtCNN\`@x@~@nBzBNNlBtBt@x@|JfLdDtDbBnBvHvIRTx@|@BBZ^|KlMxBbC\d@x@fALR\f@Zf@p@fAVd@NZj@dA\t@DJLXf@hAz@|B\bAVx@Tt@BHNl@\pARz@Pt@Ln@P`ALt@Jp@Jl@D`@VbB^bDn@`FDZNjALbAdDtWx@nGTfB?@ZfCt@~FPrA^zCL`Ah@bEVpBpBdPF`@PxA@DFh@v@hGh@bEhAzIPtAL`A`@dD|@lHT`BDXX|BR|AHl@D`@Jn@`@hDNhAf@zDXvBVxB~@fH?Bf@|DnAzJDXd@|D\dCD^Jz@Hl@b@lDZbCVnBf@`EzArLF`@NnAb@dD^`Dj@lEf@~D~@hHpAdKNlAPpATnBHh@j@tE@FHh@b@jDj@rE@HPzADX?@BR~@rHLz@ZhCDXHl@Fh@Jz@PpA`@`DRvApBzOVrBD\lAtJ|A|LpBzOvAbLvA~K|Dd[Fj@F\@HBTrApKTbBbA~HBVRzAPrAJv@jAhJX|BbAbI?@Hp@T`BHp@NnADRD\R`BRbBTdBBLJx@PvAFj@@HPjAPrAHn@n@`FDb@PvA@LDZ\bCLfAXvBTlBBTJx@PfBHz@BZJnABTBd@HlADv@Dv@D~@D~@D|AB`A@l@BtA@V@v@?^?d@?h@?lB?d@AdBC`GElGC`FKhQCrCA|CApBAxACbC?|AGlJCpFEvGM`UCdC?j@?`@CrCAlA?J?j@Al@?j@Al@?^?j@Al@?l@Aj@?L?^Aj@?zAAJ?D?fAAdBA^AfCAnB?VC`C?|@A^?hACvB?lAAZAhBAtAA`DAfBAbBIbM?LAjAGjLEtGAvCGtKALAxBAdC?LAt@AbAC`FQd[AxA?\EpF?j@?NA\AhBAdDAj@?L?l@A|AApC?^?`E?rB?~@A`F?j@?fA?xC?~C?n@AdHAhE?nG?LAhB?vC?`@?xB?~F?zD?dDA~E?v@?J?t@A`@?rO?vE?vBArD?pA?H?xA?xAArD?X?R?l@?~C?lBAzKA`YAhJAlA?^Aj@?~@CtBAf@?BCfCAV?RAl@GrD?l@S`MKxHU~OAj@Al@s@lf@cAbs@MzHe@r\GrDIpF?ZQdLMzHAbA?T?`@AXAvAAj@?FAl@At@Ad@EnCCjAAl@Al@AX?RCxAEdCEfCCfBANChB?PExDCfAAp@?HAz@?PCpBAn@Av@?t@?`@?V@r@Bv@?BBr@Bv@BXBXDr@Ht@Jx@@LFb@DVDZLr@Ln@F\^~AFRNf@BHJ\Nh@Xt@LZHRTf@Rf@`@x@LTvBhElBvDtCzFlD`HtCzFj@fA~@lBbBdDFLtAnCv@zArBbEnJdRBD|@dBr@xAv@zAjBpDb@|@R^z@dBxQr^Tb@zFbL~MdX|BnEjBtDhAzBzLdV~BxEbIzOh[ln@xKlTfJzQzDvHtGpM`GpL`b@ry@jBtD|G|MtB`E|CdG\v@p@pANX`CvEl@lALVR\Vh@fAvBLXvCzFjA~BLTrEbJ^p@HPnBxDfBnDlBxDhUhd@bEdItCxF^t@zKlT|FhLTb@zAzCd@z@Rd@Tb@Tb@h@hAjBpD`CvEr@vAlA`C@BR^Rb@j@fAHPt@xA`AjBtAnCh@fATb@vEhJ`AjBjBrDxI`QbApBd@|@rAlC~D|Hv@bBnAbClA`CR`@R^R`@`B`D~D`IVd@P^@@Xj@pCnF|@fBHRzA~Cp@rA`@|@`@|@b@~@`@z@`@|@`@|@r@|AbA|B`@z@JVb@bA`@bAb@`A?@`@~@Tj@LVHTP`@DLLVHTFNJRBH`@~@HPd@jADHXp@BDVn@Rd@JXDJh@nAb@bAl@vAVl@Vl@Tj@Tj@n@xA`@bAv@hBZv@JRPd@JR^~@\t@DJRd@HRJTl@xA\x@HRDHhAjCFP\z@DFd@jAVj@\x@?@DHpAzCHRDJRb@b@bAvBhF@@v@jB|@tBdHtPfCfG~AtDBFf@jAPb@b@dApA|CRb@Rf@dGrNXp@BDZv@vCdHN^JXZr@lDjIDLd@jAZv@`DtHv@hBDLRb@Vj@Rd@BHXl@tB`FfAjCl@vAHT|EfLJT@FJTFJN`@nAvCx@nBLXbExJnHfQTh@Pd@HPL^HVHVHXHVHXFTHXFXFVFXFXFXDXFVDZDXDVDZBVDZBZBXBXBZBVBZ@N?LBV@Z@Z?X@^@j@?Z@HAfCAnA?r@?ZAX?X?@?@?N?F?t@AlBAdC?d@GnN?l@C~EAtDAj@AlBArDAvCC`HAvB?DAfEA|BCvGGlMAzEClA?H?J?HCfJ?j@Ah@?h@AjFAD?\?N?N?D?VAv@?X?nAExJAl@?Z?NAz@?j@AxA?xAAhBAxC?HA|ACfIArD?p@?D?F?J?LAl@?H@z@@j@?B@r@@RB^Bb@@ZDh@@JB\BLBXDd@DVDXHp@DRBPBN?@DRF^Lj@FP?@J^Lj@V~@J^`@xAh@jB@DNh@jAhE?@|@`DHVDN?@zCtKZhAp@dCbCvIZfATv@`@zADLBJl@vB\nARr@J`@DNJZzArFJ`@DLNh@@DL`@Tz@HXh@fB?BHVBHV|@Rv@Lb@L`@?BHVBJh@jBh@hBXdAHVh@pBHXh@nBRp@ZbAb@|Ap@`Cx@xCNf@BLv@rCd@~AHZDJ?@V`A^pAVz@x@xCx@tC`@|AhA|D?BZfABFLb@BHf@hBXbARx@Lf@@HLh@F`@H`@Lr@Ht@Ff@?@BJ?@?@JfABVF`A@P@V?N?@Br@B`A@v@?X?F?T?T?N?@AhAC`FEjKAt@IpN?tA?NA@?XAtDAN?@?XAzA?N?@?l@AdA?N?@?LAz@?~@A`A?n@Ad@AdCEdIAjBEtH?H?DIxQ?j@?@A`AMtUAnDAfC?TAl@C|D?`@AxA?V?R?@A~BIbOCrFClGAdCAtAAjBAjAArA?RAxB?x@AjDEnNAvEA~D?bEAt@AvEAjGAlGAhHClIAxE?l@AnDAtB?p@?NC`K?bCAxAA~E?v@?l@?@Ah@?b@AzD?|BAxA?R?~CAnB?@AnC?HA\?@?~A?fBAxHArC?NAp@?|A?f@ChM?f@A`EIr]E`Q?dAA`GAv@?l@?j@?xAAbA?T?l@?j@A|@?dA?BAj@?l@AjAAx@?h@?BCxDEjGCxE?@CdC?j@Al@AxA?j@AzACrDGrJCjCC~DGdICnGA~@A|BCfC?r@?l@AbAArBElFEnGAxB?rACzA?l@EvD?T?RAj@ExGE~DEdECfDErFAt@MnP?NQ`SE`FIzI?FCxECzCAdAIzHAhCKtKEvF?PElGAxAC|EG~IEnH?rAA\?L?^?XGtLIlNGvLAj@?lAAXA`B?lAAnA?ZCvB?lA?HApAChDCjEAxA?T?RArA?dAA`AAxAAxA?n@CbCAhAEhE?z@?t@E|FIpG?`BCjCAn@A~BCvBC~DA^?R?l@?NAB?dAAj@?l@?DAf@?RAh@?\CvA?J?F?FAZ?H?b@?FCfCCfCA|@?ZCxA?F?ZA`BAl@?F?ZCdC?H?FItI?H?j@GrHCdC?PAZ?NCvDOrR?H?NCdBGpJAdA?j@Al@EpE?`@AhAIdK?@?\E~ECjC?h@?@?@GnHGrHCbC?@?|@KfNChBCnD?l@ArAExFEjFAbBA^?j@AVMfRIlLEtFCpFA`AAvAAz@Al@?HC~D?TAT?j@AdAAj@?LMhREtDCtB?vAAx@CrDCxDA|BArAAX?j@Al@CbCEbFAxBErFCzDEfDCfEAfBCzDAf@ArB?HAf@AzAAv@ApB?j@CzBAf@?\?NAl@?LApBCdC?XAlBCnDAD?j@CxCA`ACjC?j@A|@?PAnBCxAAvA?B?j@AbA?f@AZAvA?@CxCAdAIbMClCC|C?FAhAGdH?JA`@?J?p@IbJC~EArACzDAlAAj@CrC?h@EbFA~AEzECfDC~C[~d@GzI?FI~J?@C~E?@C|CEbGApBSnWA~@IbNAfAChBGdLAlA?DArAE`F?@?H?`@AF?|@EfE?r@AlA?NC~A?jAA`@?~@E`EEnHEfGCtCEzE?`@AfBCvBCnECfEAj@Aj@?l@CfCGfJAnAAlBI~JIlNEvFApAC~DI|KG~JAv@MxSAxAAj@CbFAh@?n@AvAAf@A~AElG?@Ah@?@GtKAj@?j@?@MrQEfIIrMM~QG~IIjLCvBGdLEtEO~VGdIEvGEfFAdACrFEdE?b@ApBAbA?`@Af@?^AfEAzKAv@?N?F?T?XAjGAjEAjE?rB?fBChMCdM?`A?vC?vBAnCAhHE~YEzZC|HCvRGte@?xAAnGA`F?l@?DAfGEz[CbJ?fAAlG?`AA~C?dA?zCAzCAlE?zDCzQCrKAzLAxFA|DA|D?tDEzW?bIAbCAtKAbB?rBA`CCzA@rD?l@?lG?r@A|AA~HCbM?lA?nAAlGAlHC~M?lG?l@CnMKhx@AzH?l@E`_@C`M?j@Irq@?rA?t@?t@?r@CxK</points>
    </polyline>
    <duration>
     <value>6451</value>
     <text>1 hour 48 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-44&lt;/b&gt;</html_instructions>
    <distance>
     <value>199918</value>
     <text>124 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0822984</lat>
     <lng>-94.3601995</lng>
    </start_location>
    <end_location>
     <lat>37.0828531</lat>
     <lng>-94.3631622</lng>
    </end_location>
    <polyline>
     <points>ksiaFfv|~PKTA@Ct@Gt@AFCXe@pEg@vE</points>
    </polyline>
    <duration>
     <value>12</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Take exit &lt;b&gt;15&lt;/b&gt; toward &lt;b&gt;Duenweg&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Joplin&lt;/b&gt;</html_instructions>
    <distance>
     <value>271</value>
     <text>0.2 mi</text>
    </distance>
    <maneuver>ramp-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0828531</lat>
     <lng>-94.3631622</lng>
    </start_location>
    <end_location>
     <lat>37.0839082</lat>
     <lng>-94.4627819</lng>
    </end_location>
    <polyline>
     <points>yviaFvh}~PEl@AHGz@A\Cl@CbA?`A?L@\CxA?h@CvB?z@?^?V@b@?NBn@Bn@HlAHlA@HPnCDt@@\B\@z@?^?R?z@?R?tDArDArBAdHA|EAjCAnDAjGAbF?l@?DAvFA`@?v@?l@?j@?l@?l@A`FAdC?j@Al@?fCAxB?\CjEAj@?xAAl@?Z?NCtD?j@CrD?n@?v@AzAAz@?hACjC?bBAl@?fAAf@CjE?XA`CArA?~AAzAAxA?p@ArAA`FAj@?v@CjEChGChC?JAvFIdKB`DAhD?pA?zBAvAArIAjFArFCtKArD?vCAhDA~J?bC?L?l@Ah@@R?b@?d@@vA?HEjB?xA?l@?lC?zC?^AX?h@?L?fACpBCxA?TA~@?JA~@CxAGnFGhHEpE?`@?f@AhB?j@?dCAfC?j@AfCAfCAnBA~EAxCEvOCrEAzEC`F?tAArACtKEzOEnGAfF?^ElH?pBAhBA`F?l@AdC?j@AfC?`A?j@?^A^?n@AjAC~A?p@A~@K|L</points>
    </polyline>
    <duration>
     <value>475</value>
     <text>8 mins</text>
    </duration>
    <html_instructions>Continue onto &lt;b&gt;I-44BL W&lt;/b&gt;</html_instructions>
    <distance>
     <value>8842</value>
     <text>5.5 mi</text>
    </distance>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0839082</lat>
     <lng>-94.4627819</lng>
    </start_location>
    <end_location>
     <lat>37.0840469</lat>
     <lng>-94.5134959</lng>
    </end_location>
    <polyline>
     <points>m}iaFjwp_QE`ICdCCfDCdDAfCCbCAr@AxAA~AAxAAxACdDA~@CzC?|@Ax@At@A~@AfAGh@ALAR?@?P?bAAdBAfBCbCAtAA|BAb@?n@?tC?~@@n@DxALXH`BLpBBZBl@Fp@HxAHpAHrABv@@DDxA@lA?`F?f@?~AAzA?|@?bA?rB?T?pEC`F?~EA`F?xAAl@?|A?jA?rC?~@AxB?h@?jBA~AAb@?\?~A?pA?r@AbA?TApA?xEAr@?fAAv@@`@AP?JIV?x@?vACxDAvE?|BH^A|@?tBAfB?hC?pAAtA?tACnG?j@?N?lA?RAx@?zB?T?hAAhAAj@A`BAnAA\ClB</points>
    </polyline>
    <duration>
     <value>412</value>
     <text>7 mins</text>
    </duration>
    <html_instructions>Continue straight onto &lt;b&gt;I-44BL W&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;E 7th St&lt;/b&gt;</html_instructions>
    <distance>
     <value>4508</value>
     <text>2.8 mi</text>
    </distance>
    <maneuver>straight</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0840469</lat>
     <lng>-94.5134959</lng>
    </start_location>
    <end_location>
     <lat>37.0844619</lat>
     <lng>-94.5134815</lng>
    </end_location>
    <polyline>
     <points>i~iaFjtz_QcACM?</points>
    </polyline>
    <duration>
     <value>10</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt; after Arvest Bank (on the left)</html_instructions>
    <distance>
     <value>46</value>
     <text>151 ft</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0844619</lat>
     <lng>-94.5134815</lng>
    </start_location>
    <end_location>
     <lat>37.0844602</lat>
     <lng>-94.5132756</lng>
    </end_location>
    <polyline>
     <points>{`jaFftz_Q?g@</points>
    </polyline>
    <duration>
     <value>4</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt;</html_instructions>
    <distance>
     <value>18</value>
     <text>59 ft</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0844602</lat>
     <lng>-94.5132756</lng>
    </start_location>
    <end_location>
     <lat>37.0842449</lat>
     <lng>-94.5132840</lng>
    </end_location>
    <polyline>
     <points>{`jaF~rz_Qj@?</points>
    </polyline>
    <duration>
     <value>12</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt;</html_instructions>
    <distance>
     <value>24</value>
     <text>79 ft</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <duration>
    <value>31653</value>
    <text>8 hours 48 mins</text>
   </duration>
   <distance>
    <value>932311</value>
    <text>579 mi</text>
   </distance>
   <start_location>
    <lat>41.8781139</lat>
    <lng>-87.6297872</lng>
   </start_location>
   <end_location>
    <lat>37.0842449</lat>
    <lng>-94.5132840</lng>
   </end_location>
   <start_address>Chicago, IL, USA</start_address>
   <end_address>Joplin, MO, USA</end_address>
  </leg>
  <leg>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0842449</lat>
     <lng>-94.5132840</lng>
    </start_location>
    <end_location>
     <lat>37.0844602</lat>
     <lng>-94.5132756</lng>
    </end_location>
    <polyline>
     <points>o_jaF~rz_Qk@?</points>
    </polyline>
    <duration>
     <value>8</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Head &lt;b&gt;north&lt;/b&gt; toward &lt;b&gt;S Main St&lt;/b&gt;</html_instructions>
    <distance>
     <value>24</value>
     <text>79 ft</text>
    </distance>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0844602</lat>
     <lng>-94.5132756</lng>
    </start_location>
    <end_location>
     <lat>37.0844619</lat>
     <lng>-94.5134815</lng>
    </end_location>
    <polyline>
     <points>{`jaF~rz_Q?f@</points>
    </polyline>
    <duration>
     <value>7</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;left&lt;/b&gt; toward &lt;b&gt;S Main St&lt;/b&gt;</html_instructions>
    <distance>
     <value>18</value>
     <text>59 ft</text>
    </distance>
    <maneuver>turn-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0844619</lat>
     <lng>-94.5134815</lng>
    </start_location>
    <end_location>
     <lat>37.0827841</lat>
     <lng>-94.5135602</lng>
    </end_location>
    <polyline>
     <points>{`jaFftz_QL?bABbABV?`DF</points>
    </polyline>
    <duration>
     <value>65</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;left&lt;/b&gt; onto &lt;b&gt;S Main St&lt;/b&gt;</html_instructions>
    <distance>
     <value>187</value>
     <text>0.1 mi</text>
    </distance>
    <maneuver>turn-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0827841</lat>
     <lng>-94.5135602</lng>
    </start_location>
    <end_location>
     <lat>37.0598499</lat>
     <lng>-94.5146147</lng>
    </end_location>
    <polyline>
     <points>kviaFvtz_QjABdABdBBbFHtA@bA@R@R?nAB|@Bb@@f@@~DF|CDx@@V?f@@t@@~@@`A@`ABb@@~AB~CF^?|CFvABpABj@@H?jABb@?^@x@@T@L?N@T?z@@fABZ@r@@V@nAB^@rABnABr@@zAB^@xA@pABx@BlCDZ@nABV?rBDbEHJ?`AB`@@~CF^?X@v@BbABb@@</points>
    </polyline>
    <duration>
     <value>240</value>
     <text>4 mins</text>
    </duration>
    <html_instructions>Continue straight to stay on &lt;b&gt;S Main St&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Pass by Hardee's (on the right in 0.8&amp;nbsp;mi)&lt;/div&gt;</html_instructions>
    <distance>
     <value>2552</value>
     <text>1.6 mi</text>
    </distance>
    <maneuver>straight</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0598499</lat>
     <lng>-94.5146147</lng>
    </start_location>
    <end_location>
     <lat>37.0571337</lat>
     <lng>-94.5147455</lng>
    </end_location>
    <polyline>
     <points>ageaFh{z_Q`ABh@@x@@r@B\?p@Bd@?nABlABp@B</points>
    </polyline>
    <duration>
     <value>21</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Continue straight to stay on &lt;b&gt;S Main St&lt;/b&gt;</html_instructions>
    <distance>
     <value>302</value>
     <text>0.2 mi</text>
    </distance>
    <maneuver>straight</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0571337</lat>
     <lng>-94.5147455</lng>
    </start_location>
    <end_location>
     <lat>37.0381852</lat>
     <lng>-94.5148996</lng>
    </end_location>
    <polyline>
     <points>avdaFd|z_Q~@@bCDv@?NHD@F@F?dABt@B|@Bb@@~@Dh@?T?J?rA?z@Eh@Cd@CH?`AKp@I|B[zAQf@G|@ITCt@E|@AXAxEFzBDx@@jBDxAB|EFnGJjBDbCDnFH~BDjBB|EHjDFZ@fAB</points>
    </polyline>
    <duration>
     <value>159</value>
     <text>3 mins</text>
    </duration>
    <html_instructions>Continue straight to stay on &lt;b&gt;S Main St&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Pass by Jimmy John's (on the right)&lt;/div&gt;</html_instructions>
    <distance>
     <value>2113</value>
     <text>1.3 mi</text>
    </distance>
    <maneuver>straight</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>37.0381852</lat>
     <lng>-94.5148996</lng>
    </start_location>
    <end_location>
     <lat>36.1678313</lat>
     <lng>-95.7322449</lng>
    </end_location>
    <polyline>
     <points>u_aaFb}z_QTJF@vABJDNJHFBBVVJTLPPRFBNJXJnA\l@R@?pAv@t@z@@?@?H?l@`AlGbLh@z@Xd@f@~@zH~Mh@`AvAhCJPt@nADH\n@HJT`@bAfBXf@Vb@P\bA`Bj@dAXd@b@p@LP`@l@f@r@RV`ApA`AjAn@t@d@d@BDTVRRdAbAjAbAPN`DrC|IzHxTtRB@ZXfErDvBlBv@p@|@v@ZXvAnAvAnAZXtBfBhC|BdA`A`A~@r@t@p@v@r@x@n@v@`CfDrEhIb@x@^z@d@fA^~@j@zA`@hAPl@JV\jAV|@Nj@Pl@Nn@Rz@ZpARdANv@f@xCDZBPLt@H|@lArLjBlRzAzOPfBtAnNdAdKFj@TzBH`ABR@FDf@Hx@^rDT`CRlBBTDh@DZH~@JbA\pDXjCTbCRnBT`CZxCJbAD`@PhBDb@BNZbDVlCRhBRzBBLDf@h@pFRjBDh@VfC?@n@tG@Fb@fERvBFb@?DD\Z`DZfDj@vFTfCNrAl@lGLrAHr@@RJ|@B\J~@PdBLpA@F@LXtCJfA@DJdAJbAH|@@@@N@H@PLfAJhA@H@D?HPhBNzANtAN|AJ`ALnAb@jEH|@@DHv@RrBPfB@ND^JbA@N@?Bb@BLFv@BL?BD\Fn@Fn@Db@@JPfB@JDZ@HD`@?@BZJbAFh@?DDVJ|@N|ANzA@Fb@pEVhCRjBVfC?FHl@NpAJt@NpADXXjBPnAXhBDRXjBJl@Hd@Z~AHb@Hb@@HFZH\Jb@FXXhANl@HXLf@BLl@`C~AfGJ^HRBLNb@Jb@L\Ph@Tp@f@vAFPLZ?@Vp@HTRl@Tj@Vl@@Bb@fAf@lAv@jBJRP\`@z@JTPZP`@BBJTLVXl@Zl@Xh@LXFHFLLTJPTb@@BNVNVJTHNBB?@Zh@NTBDDFLTDHJPd@t@Zf@DHDDn@bADHPVd@r@@@xB~CLNxAnBV\V\`@d@p@v@p@z@nBvBXXJJLNb@d@hAhAv@x@rAvABBt@r@BDNN`@b@ZZB@VXDDp@r@@@XXDBDFj@j@VXBBj@j@JJX\DBTVjClCv@v@rAtAZZZZNPfBhBRRZZRRf@h@p@r@TVDDX\DBVXt@v@X\@?LPJJNRHHBDjApA\^PRFF\`@BDn@v@d@h@JL^d@X\@@JNRTJNX^TXBBRXLNd@j@DFf@n@r@`Ax@fA`@j@Zb@h@t@DHBBLPFHLP\b@DHp@~@DDJPFHNTJNJPNRPTV^PR?@FHPTZd@TX\d@LPd@n@PXFFV`@Zb@LRFFLPJNV^DFLPDDPTDHbAvABBt@dAV^DFJNv@dA@@hA~AX`@h@v@X^l@|@BBDFPTh@p@z@nApAhBbAvAnD`FNRPTNTjBhCbAvADFPVX^bB`CDFPVX^|B`D^h@lCvDrHjKbLzOV^rAhBPVV^vF|Hz@lARV|@lAJNn@~@z@jA`@j@h@r@BDLNDHFHHJJL`@n@JNDDV^Z`@RXd@p@X^LPd@p@V\RXJNPTJPb@h@j@z@FH\d@f@r@l@x@tBvC`B|BzFbIdB`CbI`LV^X^JPf@p@h@v@`ApA~@pAXb@RTr@bA|@nA`@j@HJDHNP`@l@j@v@z@lAd@n@HLX^~AzB\b@V^X^p@`AhA~AFFPVX^FHhA`BNTX^?@\f@~@vAh@|@f@v@r@nAXd@\j@h@dAT`@j@fAVb@DJLVTb@Rb@Tb@LVDLTf@dAzBdAbCn@~AFRPb@BDZx@`@hAz@~BlAvDZdAx@jCn@bCV|@Lh@Rr@Px@p@pCv@rDf@dCP`AZ`B\jB^lBH`@BRRdAdArFhAbGNt@dAtFJf@Jj@@DlApGP~@n@bDbBbJDRPz@VtAF\FZHZFX?@BNFV?@BNj@xCJf@H`@Nv@@JTdAF^X|ADNPbADP@Hb@~BZ`B@@BNFXr@xDvCpOfAzF\jB@DP|@^pBNv@BNFXZ~AF^VrADN^nBn@hDf@lC|AbIHf@\dBj@zCJf@Jh@BNh@vCJh@DP@DBR`@tBH\Nx@F\VrAXvAh@nCNv@j@xCJj@Jh@Nv@TjAh@vCFZNx@F\Jd@Lp@FXPz@TrAPx@n@lD@?VrAFXBPVpABNFZJh@VrAJj@BLFZ~@`FR~@j@bDFZXxAbBvI\fBFZF\bBzI?@Jf@rAfHHb@XtAJn@Jh@H\@Ld@|BVtAVrAhA`GTpAVpAhA|FJh@p@nDPz@DX`AfFFZpA~GJd@zEbWfAzFp@lDLr@TjAd@~BFXRfAVjAFZFX\bBFVFTPt@DRH\^bBPp@VjAdAfEf@lB^xAl@zBb@~ARp@XbARt@HVX`AZ`A`@tAf@~AFT|@tCPf@Nf@Nf@vAtE`GpRNf@fCfIl@nBNf@`A~CNf@p@vBjD~KlEtNpBrG@B`BnFNf@bBlF`A~CNf@f@bBjBbGPf@dE~MPl@pC`J^nA`@nA`A~CvGfTp@zB`AzC`@tAN`@~@|CFRJZfDvK`DjKnA|DHXRl@f@`BRn@HXPl@Rp@\dAJXPl@Pn@Nf@Pd@HTbAfDf@bB^lANb@x@hCrAjEn@tBh@fBbA~CBHX`Ah@~A^jAZdATp@jAzDNf@Z|@FTd@xAj@bB`@hA^fATn@JRv@rB\z@Zt@Xn@Vl@FLLZjAdCz@hBh@bAv@|An@lAPXJRHLXh@RZdAdBl@bAV`@V`@RZBDdAzAT\X^LRNPxC~DnA~A`BjBr@v@|@bA`AbALNf@f@lAjAx@v@ZXNNXTLN@?ZVb@^t@n@b@^n@f@TR`@Zr@h@h@^PLn@d@?@tA~@j@^z@h@`@VTNLHbAl@n@^TLbCrARJf@V`@P@@ZRLDRHd@T`SzHx@Vt@Tx@XZLnDpArDrA@?j@THBHBXJv@V^N^NtDpAfHdClDnAB@THVHLD|JlDp@VfBn@~Aj@B@FBr@T~EdBdC|@d@Nh@N`Bp@n@Rj@V^Lx@XbCz@xG~BrAf@z@XZL|@ZDBlA`@z@XNFB@d@P\L\Lx@X`@NnC~@v@X|@Z@?PHnAb@ZLz@ZnAb@vFnBbC~@dCx@xAf@b@N`MlE`FfB`Bn@pBr@jBt@zAj@XLjAb@`A`@LFRF`@NNHVH`A`@XJ^NlAf@lCdALD@@`@N`@N`C~@NFvAh@VJDBpBv@RH@@^N@?`A`@^L@@`@NLF~ClAn@VlAf@dE`BbA^`A^dC`AbA`@b@P\L@@`@N`Bp@@?^N@?zAl@hAb@`A^@@~@^@?jEdBdC`AzBx@n@VVJb@P@?VLf@P^L@@bBn@`@L?@p@T`ItCrBr@zEfBb@P~@\bA^fDlAbA^@@^L^N@?^N`@NbA\bBn@@?zAj@lBp@xBv@tEbBbA^dC~@n@TtAl@r@VxCdA\L`@N|@\B@ZJn@TRF`A\F@v@Zr@Tj@XhE~A^L@?`@N`@NfHhCF@ZLd@PdBl@h@Rb@P`@LbC~@fC~@`@Lv@Xl@T`@N^L`@Nl@TTHHDlDpAtAd@hE|ArAh@vDvApFnBLDpAd@XJ`@PzFnB|Bz@bA\LDRHlG|B~Bz@f@PnMzEhBn@zBv@jAd@jE~A|FvBhFlBtAf@`@N`@L`@NbBn@d@NhE|ArJlD\L^NbA^~Bx@pBt@~@\d@RhBp@|DtAbA^dA`@THJDdDjAtMzE`@NnC`AzLnE~GfCd@PvK|DfHhCpAd@nQrGFBx@ZnHlCpE`B|VdJ`Cz@LDzVdJHB`EzA`@LjAb@~ChAlCbArOvFlBp@~CjAnIzCjC`AvBv@xAh@`Bj@vDtArBv@rCfAx@ZbAd@`Bt@xBhAzAv@dAl@fAn@z@h@d@ZxBxAtA`A@?lA`AjElD|@x@bB~Ap@p@bAbAxA~AfAlARRV\bAlAv@`A^j@`@f@dAxArAnBtAxBhBzCb@t@dCtE@@~AjDx@hB~AvDn@~Ax@|Bl@`BZbAx@hCt@fClAnEz@hDx@hD^tAJ^DPJ`@XdAlBpHXhAz@bDv@zC^xAh@tBj@xB|B|IXfADRFTLh@J^r@nCb@bB~@pDrAfFDNx@bD~AnGp@hCHZ`@~AFRDP\rABH`@zA`@|A^zABLf@jB?@j@zBr@lCbA~DJd@Lb@V`Av@~Cd@bBXfAXhAXdARz@d@hBJ^V~@d@lBdBzGRv@rAfFbCnJtM~g@v@zCzEdR\pAxKxb@Nh@t@zClArENj@pCvKxAnFf@fBJ\J\Pl@h@fBv@jC\dAd@|A\hA|AfF@DnEvNRp@vD~LdAhDNh@dBtFt@bC@DpBpGLd@pAfEHVDNbA`D^pApBpGb@vA~EbPrEdONf@`@nANf@pAfEdFnPhAtDv@fCPf@Nf@jA|D`O~e@^nAlPli@Nf@^nAdG`Sb@tAnBrG`AzC^lA^nA`@nArAhEt@bCjBfGJXd@zAPl@Tt@X|@Nf@FNHXNd@~@~CNd@lEtNpKn]Nh@ZbAzEpOdBzF|AbFNd@Nf@b@xA\dAPh@Pl@lDdLdAhDDNzA|EpBtG`@pA^nATt@Tt@JX^pA`@nAJZTt@Tt@`@pAv@fC^nATt@Vx@^lA`@nATt@Tv@JZTr@`@pAHZTr@`@nATt@Tt@DLp@xBTt@HZ`@nA`@pAL`@Rn@Tr@Tt@^pATr@Vv@Tt@Tt@Tt@BJPh@Tt@Tt@`@pATt@`@nATt@Tt@J^h@fBJXPj@BHJ\HXVt@Tt@Tt@Tt@Tt@Tt@Tt@Tt@Tt@`@nATt@Tt@`@pATt@JZHXTt@`@pATr@Tv@HT`@nAJ^Tt@v@dC`@rAJ\Rp@DNZ`ATt@Nf@Pf@Tv@Tt@bA`D^nA`@pATr@ZfADHJ\vAtE^nA`@pAb@vA`@pAVx@`A`DTt@FPL^Pl@Tr@Tv@Vx@L`@Rl@Tt@Tt@Tt@J\Rp@Vt@Tt@Tt@Vt@Vt@Vr@Vt@Vr@Vr@Xr@Vr@Xr@Zr@@DVj@JXBBHTLVLXLVXp@Zp@NXJVFLRb@\n@\r@b@x@bAjBJP`AdBxBnDl@~@PXDDJNDJDDJNr@fApAlBV^X^V`@JNV`@T^jAbBp@bAHLx@lAz@pAz@pALPLRNR\f@j@|@jAbBb@n@HLj@z@l@z@jAdBRZV^NTj@z@\f@`@l@LNZf@^h@Zd@z@pAl@z@l@|@\f@\f@\h@LRj@x@|@pA\f@LR^h@Zd@^j@hA`Bh@v@PXjAdBBBXb@V\DJn@|@j@z@j@z@\d@l@~@l@z@z@pAhBjC\h@^j@j@v@hAbB\h@l@|@Zd@l@|@l@|@\d@\h@\f@l@z@\h@d@r@DFl@|@z@nAl@z@\f@HL`@n@\f@HHR\l@|@l@z@\f@\f@\h@\f@vAtBbFrH\h@\f@|AzBPZn@~@xDxFh@v@h@x@vApBzAvB`AzAlFbIv@jA~BlDJNLTh@v@Zf@\h@h@~@T\T^Zh@Zh@Zh@Xj@Zh@j@`AVj@~CvG~B`F|DlIZr@Vf@Xr@HRLXJVHVJVJTJVHVJTJXHTJVJVHTj@~AHTTn@Rn@Tl@HXHVJVHVRn@Rn@Vt@Pl@Rn@HVLd@DJPn@HXHTRr@b@~AV~@BJHZXfALd@BJHVPr@Nn@?@HXNn@Rt@`@bBr@rCXjAXhAPr@XhAXlAPp@Pn@FXPp@Pp@FXPp@FXHVNp@Pp@Pp@Pr@Nn@V`Ab@fBDP\vA\pAh@zB\pAf@pBn@lCBJt@vCNl@XjAPp@Np@BHDNh@xBf@nBLh@Pp@Pr@J^Lh@XhAHXPp@HXHVFVHXHVHXFVHXDLBFHZHRRp@Rp@Pn@Tn@Rn@Tp@Rl@Tn@Rn@Tn@Vn@Tn@`@dATn@Tl@Vl@Vl@Vn@Tl@JT@BHPHR@BVl@Xl@Vl@Xj@Vl@Xj@Xj@Vl@B@Th@Xj@Zj@JTPZFJv@zA@Bd@x@NXXf@f@|@NTLTLRZh@Zh@\f@Zh@Zh@\f@\h@\f@\f@\f@RX`CfDt@`Al@x@n@v@\b@l@v@^b@Z^RV`@b@`@d@n@r@`@b@`@b@^b@bAdAPP`@`@`@`@`@`@b@`@`@`@b@^`@`@d@b@z@v@`@\n@h@^Z`@Zn@h@p@h@\Xf@\VRbDbCDBx@j@d@Zz@h@PLRLRLTNd@Xd@XTLPLRLPJTNTNd@XZRHFRJTNx@f@d@Xz@h@f@Zf@Zx@f@f@Zz@h@f@XRLx@h@f@Xf@Zf@ZXPLHRLPLh@Zd@Xf@ZRJPLTNPJz@h@d@XRLf@Xf@ZRLRLRLPLRLTJPLf@Xz@h@d@ZRJRLf@ZPLz@f@f@Zf@Zz@f@d@Zh@Zf@ZRL^TDB`BbAnA|@PLh@Zd@XRLRLRJRLVNbAn@ZR`@Vj@\|@h@JFf@ZJFVPd@XRLRJd@XRNZPHFf@XbCzAf@XRLd@Xd@Zf@XPL@?b@XRLTLb@XJFDB~A`ATNd@Xd@Zx@d@pBnADB^Tf@Zd@Xf@Zd@Xv@f@f@Xd@Xh@\b@Xf@X\TFBd@Zf@XPJPLRLd@Xf@XPLd@Xf@Zd@Xd@ZRJPLRJf@Zb@Xf@Xd@ZRLPJd@XRLd@Zd@Xf@XPLf@XPLRJd@Xf@Zd@XRLd@Xd@ZjAr@x@f@x@f@f@Zz@f@jDvBPJRNd@VRLPJd@ZRJRLx@f@p@`@XPRLDB^TTNd@Xz@h@`@VRJVNf@ZNJb@Vd@Zd@Xf@Xd@Xd@Zd@XnBlAfAp@`I|EJFv@f@XNh@\t@d@jAr@x@h@|@h@PJbCzA~A`Af@ZjAr@`Al@JFx@f@tAz@HDx@f@RLh@ZjAt@f@XnBlA~AbApBjAv@f@d@Xx@f@RLd@Xv@f@RLPLv@f@NHf@\v@h@d@\b@Zd@\b@Zb@\d@\NLRNb@\PLPNb@\PNPNPLPNPN`@^PNd@`@B@^^b@^dB~A|B|BhDlDt@v@X\nAxAnAxA^`@rDnEX\f@l@pCdDhBxBfEbF`BnBvEvFxBhCX\|@bApJnLj@n@r@|@dDzDRThBxBnAxAv@~@p@x@t@z@pCfDfNnPX\Z\|KzMjBxBdGjHZ^tDnE~AjBfAtAPP\^^d@^b@^b@n@x@^b@T\HH\`@`AfAl@r@RTDFhBvBnAzAnElFlGtHtSrVX\X^xObR~@jAnCbD\`@X\FFfApAr@|@Z\fBvBZ^DD^d@nCbD|DzE^b@RT\`@^b@^d@^b@^b@^b@^d@\b@HHDF^`@j@p@PT^`@@@\b@hCzCvDpE@@|AjB\b@FHHH^d@\d@|@jA^d@NRZd@^f@\d@LT\f@LPNVDFV`@V^DFhAbBZf@JPNTFJ?@RXZh@Zh@PXJP^n@HLLVJPZh@Zj@Vf@Zl@Xh@\n@@@FNJP?@r@vAXh@f@`Af@`AtBbErBbEbEfIzAxCZl@d@|@r@xAVf@f@`AfBlDr@tAJTBDTd@t@vAr@tAd@~@f@`AZl@JRp@rAf@`AZn@jA~BdBlDjCfFTf@Td@dAnBLVNXpB~DxAtCrBbE`@v@nBvDN\Tb@\p@v@|Aj@dAN\Xh@|A|C`CvE|@jBTb@Tb@h@dAj@hA~@hBTb@tAnCTb@BFNZn@nAf@bA|@fBh@bAbCzEXj@f@bAVf@\n@p@rAVd@DHHNZn@d@~@Vj@Zl@Xf@Td@BDN\HLXj@Zl@?Bb@z@Zl@Tb@NXXj@Xj@f@`Af@`AVh@@B^r@FLTd@BDFLHNFJBDTd@Xj@r@tAPZTd@d@~@Xj@Zl@hBnDp@rAzAxCLT?@Vf@P^FJJV\l@Vh@Xh@Xj@Vh@Zl@Zl@Xj@b@z@^r@Tb@Zn@Vh@Zj@JT@?Td@DH~@hBN\FNLRJTLTLTLVVb@@DP\FJVh@LXd@|@Zl@NXRb@Xj@f@dALRJRLTJRJTLTZl@Vh@b@z@NVJVLVd@~@LT@?Xj@Vj@JRLVLTd@~@LRFJDHJVLTLTHRLVZh@FNTb@FLLTJTd@~@v@|AJP^t@DHt@zAb@v@HRR^Td@Zl@Xl@HNR\LTJVf@`Ab@|@`AjBFLP\@DJPHPNXXh@Xj@Xh@Xl@d@~@h@dAXh@Xh@r@vAf@bAJRxArCPZVh@Zl@Rb@BFHLTb@FL`@x@BDLTXj@Rb@`@t@Xh@Xl@@@Rb@NXXj@Tb@BDP\HNh@fAT`@JTT`@DFNZHPXj@Zl@JRHN|A~CJRj@fAHPJPLXf@~@\r@HPXf@LVd@~@h@bATd@T`@?@R`@|AzCLV?@HNHPLTFLj@fABDN\Tb@DFZn@BF~AzCFLJTb@z@dArBh@bAr@xAd@z@@DHPJPBDNXTd@Xh@P^^v@Xj@LVZl@b@x@Zn@Zj@b@|@Zj@Xl@t@vAj@hAP^LTLVJRLVLTJTXf@NXTf@LTJTNXHNLVLTXj@Xj@Xh@Xj@|@fBDFLZ@?r@xAz@bBb@z@P^BBb@|@Zl@JTf@|@f@~@r@rAHLPXf@z@`A`Bl@`A\j@f@r@j@|@b@l@\f@\b@b@l@\f@l@t@TXFHPT@BJJJLVZp@z@l@r@d@h@BBBBNPBB@BJHPT`@`@~@bAVVVXNLRRXVl@l@NNTRXXVTb@`@d@`@`@`@XVDBPPb@`@b@`@RPFFZVTRJJb@^HHTTDD\Xb@`@RRTR\X^^d@`@`@^PPTP^\xAtAp@j@b@^`@^PPPNB@?@VTh@h@lAdAdA~@ZZZXl@h@XXh@d@PNFDd@d@DDz@v@f@d@j@d@PPVTJJb@^^ZNNPN?@TRRPFFVVtAnArAjAt@r@DDhB`B`@\JHNNrAnA`@^JJDBVTBBHFLLb@^TTZV@@v@t@\X`@^`@`@DB^\`@^b@`@LHZZHHDB\Zr@n@PNb@`@LLDDNNDDHFLJf@d@r@n@TT@?JJNL\XDDDFNLNLPPNNv@r@p@n@`@\dA`ANLJJJHPNZZBBFDTRFFNLPNt@p@rAlAPPZXBBDDn@j@@B\Vv@r@\Zb@`@p@l@x@t@~AxAnDbDl@h@ZXFDRRFFp@l@\ZFDRRFDjBdB|ArAZZf@`@b@b@bA~@fA~@dB~A@@v@r@ZX~AvArAnA\Zx@t@x@r@ZZlAfA\ZFDZZ\Xv@t@lAfAFFRP\ZFFrBhBx@r@x@v@tAlALLj@f@lAhAFDZZZXTRFD`A|@n@l@rAlA?@^ZZXTRFDXX\XnAjAv@r@^Zv@r@\Zx@t@pBfB@@tApAZXx@t@pCdCNLh@d@t@r@ZV`@^ZXZZ`@\r@n@d@b@TRl@j@xBnBRPdA`A@?r@n@xArA\ZZZJHPNZZZXx@t@\Xx@t@tAnApBhBrBjBrBhBx@t@fExDd@b@vApA@@ZV@@XX\XFFRP\XXX\Z\ZNLJJ\XZZLJfAbA\XZXZZFDjBbBrBjB@@XV\XtAnAx@t@@BXV\XhKlJ`A|@\XZXx@t@ZXtAnAx@t@TRb@`@\X^\p@n@rAjA\\DBr@p@BBPLFFZZ\X@@XV^\JJh@d@\ZPNHHx@t@^\XV@?XX\XZZ\XpBhBRRHFv@r@h@d@dA`ARPbA~@b@^FFZXp@l@FFvAnAZZx@r@ZZrBhBnCdClD~CRPb@b@\XtAnAnCdCh@f@hA`AtAnAvApAtApAZVZXZZz@t@nCbCZZdCzBxEhElBbB`HjGv@r@t@p@t@p@tAnAFDn@l@FF~@x@hB`B\ZnCdCx@r@zBrB|W`Vj@h@nOfNnAlAd@d@ZZj@j@JJf@h@p@t@p@v@p@v@|BrClDvEpAhBV^n@`Ah@x@DHl@bA`@n@dAhBdB~Cj@dAdAvBr@xAj@nAR`@zApDp@`B^`AVr@z@zBx@bCj@fBf@~Ax@rCPr@HTv@xCXjAT`AZtAVjADRXrANr@`@|Bf@nCRlApAlIr@lE\xB`A~FbAtGt@tEPjARfAr@tEt@vEHf@rAlIv@~E~@zFh@hDh@hD@Hf@~CLv@f@|CV`Bl@tDBN|@vFf@zCd@~CN~@b@lCXhBJh@@HRjADXBN@DFb@Hj@F\BJ?DHd@?@Hf@Jh@?DH`@?BHh@TrAJj@?BHd@BPx@dFt@jENz@Jh@H^b@zBNx@d@vBVdAPv@ZrA\xAv@vC`@|AXdAVx@n@xBh@bB?@p@tB`@lAtAbElDfKf@|Al@dBp@rB@@Nf@dAzCNd@@@p@rBHTFPl@fBf@zANd@@@pGpR@?Nd@f@zAhAfDL\d@vAn@jBRn@L\~@pCzAnE^fARl@~BbHXz@r@rBPh@`@lARl@dDvJjBrFPf@@DL^Nb@bAzCPd@DLHVt@vBLb@bAxCdA~Cp@nBd@rAvCxIRl@^fA@B?@h@|AXx@@BNf@FPz@dCPj@Pf@^fAPf@Pf@Ph@`@jADLHVdA|CBFL`@h@~A^bAh@~AzAnETt@nAtD@@bAxCDNhAfDVr@Rl@f@zAHPPf@`@nApAzD|CfJ^fAf@vAxC~IlAnDRh@Rl@Tn@Tr@JXVv@l@bBNf@bAtCPl@Xx@hBtFlBrFNf@Pf@Nb@vAdENf@Pd@dAzCNf@Pf@|@lC~B~GNd@@?r@tBNf@Pd@X|@FPtA`E@B^jAb@lARj@^fAf@zAJX`@lAb@nANd@N`@Pj@FNx@`Ch@~Ar@vB~@pCf@xAhAfDLZPh@j@dBDLBHn@jB@BZ~@Nd@f@vA@FNb@Nb@Rh@JZ|@hC@DFNNd@HRDLtAfEZ~@L^l@bBFPl@fBj@`BL^`@lABJj@fB@Bd@rANd@r@vBJV@D@BDL`@jAf@xAHTL^@DHVFLJXLb@nApD|DlLtCvIXv@j@`B?@@BNb@Lb@Rh@HVb@nABJ@@FRXv@?@Rl@`@fANb@L^BFL\@FTr@b@nAZ~@N^Pj@L^DJLb@@?Nd@Rl@h@~ABDZ|@HPNb@@@Zx@JVl@xAXr@Xn@Zr@DJ@??BP`@@@Zp@d@~@NZTf@R^?@T`@?@b@x@h@`Af@|@f@|@x@tAh@z@z@rAXb@RZBDV^JNLP\f@|AvBv@`Af@p@pA|AZ^~@fAbAfAdBfBpAtAt@v@\^`@b@|@~@ZZHHPRVVv@x@\^j@j@LNNLPTn@n@z@|@z@|@bAdAdBhBLLLNJJNNf@h@RTp@p@ZZVXBBXZZZ@@Z\XXBBXXr@v@ZZDDTTZZFHl@n@TTVVHHj@n@BBr@r@v@x@h@j@JLrAtA^`@|@~@Z\NLXZXZz@|@zA|ApAtAd@d@~@bAdAdAd@f@HHXZh@h@d@f@rBvBfAhAZ\^`@zA|AXX?@r@t@dBfBJL`CdClAnA~@`A^`@XZf@f@b@b@pBtBjCpCrBvBhAjAj@j@JJPRRRzEdFbAbAb@d@x@z@j@l@f@f@dAhAx@|@lDpDt@x@ZZrAtAj@l@`@^|BbCNPx@z@v@x@bEhERRhBlBz@|@x@z@XXNNv@z@\\r@t@rH|HrI~I`OrOz@|@j@l@x@z@xAxAtAzA`B`Bt@v@fAjAfBhBv@z@tAvAz@|@XZfAjAbCdCvCzC~EhFfAfA`AdAjBnBv@x@zE`Fx@z@VVNPLJhBnBh@d@DF^`@vB~Bd@d@\^pCtChBlB~AbBxC|CFF`D`DlL`Ml@n@rAtAvBzBjAlAh@j@JJ`@b@^^`@d@x@z@bAfAbAfAbAhAJLjAtADD`AhA`AjA~@hApA~AhAxAfAvAr@~@`ApANPHLPTtCvDjA|AzCbE`@f@LNJNLN|B|CjEzFJLf@p@~@lAbDjE@@vAjBpAbBtAhBhAzAJL`BxBv@`ALPDFPX|DjFJLLNZb@d@l@l@x@|ApBp@z@p@~@FHv@`AxAnBvCzDdB|B\b@TZf@p@bDfE?@nA~An@z@jA|Ap@~@\b@dBzBbArAX^Zb@RVDHf@n@FHZ`@RVr@z@nA`BFHNRLPJLf@n@l@z@NRLPNT^f@?@~AtBJLl@v@HHjA`Br@|@X^r@~@x@jA@@V^TZh@v@PV@@V^d@r@\b@l@z@X`@\f@p@|@NRFHp@|@?@`AlA`@h@DFHJ@?VZRXLLLLnBnCr@~@V\LNHJNTJLJNDDHLLRJLJN@@V\PTLP`@f@~@lAV\HJh@n@\b@`AjALNV\d@h@b@j@FFh@p@hAtAJLV\BDFFf@n@BDl@v@j@v@FFp@|@@@V\d@n@|@jADDfAxA`BvB\d@JNLNHL\b@n@x@bAtAj@t@nGlI@@b@j@f@p@BDDFh@p@z@hAf@r@X\HLZ`@bBxBNRHJTXZb@jA|AjA|Ar@~@X^X^X^jA|Ar@|@r@`ALNb@j@dB|BLRHJhChDJL\d@FHDFHLj@r@z@hA|@lAx@hANRZb@hAzALPX`@h@r@TZHLLPJLVZ`@d@l@n@`@`@TRVRj@`@p@d@j@\t@^l@Vr@XnA^hAThAPjAHlAD`BBl@?pB@xB?pB?`B?\?`B@`D?zA@fA?tB?L?d@?v@?b@@fBBhC?V?vB?rBBdLDpD@tDEx@@dA?</points>
    </polyline>
    <duration>
     <value>4807</value>
     <text>1 hour 20 mins</text>
    </duration>
    <html_instructions>Merge onto &lt;b&gt;I-44 W&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;MO-43 S&lt;/b&gt; via the ramp to &lt;b&gt;Tulsa&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Continue to follow I-44 W&lt;/div&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Toll road&lt;/div&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Entering Oklahoma&lt;/div&gt;</html_instructions>
    <distance>
     <value>151786</value>
     <text>94.3 mi</text>
    </distance>
    <maneuver>ramp-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>36.1678313</lat>
     <lng>-95.7322449</lng>
    </start_location>
    <end_location>
     <lat>36.1631556</lat>
     <lng>-95.7376342</lng>
    </end_location>
    <polyline>
     <points>}_w{EnuhgQTLB@B?pAF\Bj@DVBZFPBD@VDRD@?PFNFd@P^PFBJDHDHFXPZVVRB@PNRPVR^d@\b@PPR^NXRZXl@@BRb@JRDPFPN`@J`@L`@DRJ`@F^FTHp@D`@Dd@@FL`C@FJT</points>
    </polyline>
    <duration>
     <value>30</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Take exit &lt;b&gt;34&lt;/b&gt; for &lt;b&gt;I-44 W&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;US-412 W&lt;/b&gt; toward &lt;b&gt;OK-66&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Tulsa&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Toll road&lt;/div&gt;</html_instructions>
    <distance>
     <value>782</value>
     <text>0.5 mi</text>
    </distance>
    <maneuver>ramp-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>36.1631556</lat>
     <lng>-95.7376342</lng>
    </start_location>
    <end_location>
     <lat>36.1626445</lat>
     <lng>-95.8197485</lng>
    </end_location>
    <polyline>
     <points>wbv{EdwigQJ~ULzZBdFBvA@jC?f@?pCA`@Cv@CT?DE\E^CNKf@EVGPEPK\]dAa@rAELGXI\CJCNCNAHIp@AVE`@Ad@Cj@?N?j@?HBd@@P@TDl@?@F\ZjBBDJf@DNd@tBd@nB\vANv@L|@Dh@Dn@DfC?L@p@?z@@r@?xA@bBBbC@fB?d@?D?rA@J?@?L?B?B?tB@lAB~DBtBBvG@vB@lABpCBjH@jB@pI?~B?xE?nC?l@?|E?|E?@?vH?`G?fA?D?B?dB?lI?lS?~A?X?fB?j@?V?rC?vACrU?`@?tCAdG@xA?pA?@?D?DAlA?xC@fK@`F?hB?`A?J?tA?n@?J?fD?^AnC?zA?\?x@AzBA`CAl@?j@?j@?hB?X?f@?j@?p@?pD?@?nD?f@?B?pD?B?zE?~E?|BAp@?dC?j@?xA?dC?nE?N?`F?Z?F?H?|C@pGB|C</points>
    </polyline>
    <duration>
     <value>265</value>
     <text>4 mins</text>
    </duration>
    <html_instructions>Merge onto &lt;b&gt;I-44&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;US-412 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>7414</value>
     <text>4.6 mi</text>
    </distance>
    <maneuver>merge</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>36.1626445</lat>
     <lng>-95.8197485</lng>
    </start_location>
    <end_location>
     <lat>36.0890137</lat>
     <lng>-96.0278856</lng>
    </end_location>
    <polyline>
     <points>o_v{ElxygQAx@@tBJjEBx@FjA@LHxABj@JtA?@Dh@?@Dh@T~BHx@@HBPNlAHh@Hp@FX?BJf@?@Hf@FX?D@?VtA@@?@Jb@@Fb@fBNj@Pp@X~@L`@@B^hA@D@@FP\fAFJN^d@jA~@vBpApCb@v@p@pAr@jAx@pAl@`A@@T`@HJ?@nAnBn@~@~@|A~@xAb@n@FJT^\f@`AbBp@fA`CtD`F~H@@PXBDJLDFnAnBbDfF`A`BnGbKZd@f@v@bCzDFHVb@`BfC@BhBtCdAdBXb@?@l@~@Xb@BD`A|Al@bAtBdDHPdAzAp@hAp@dAHJ@Bd@t@b@p@`@n@nB|ChCfEfCxDh@x@b@r@d@r@pCnEDFvA|B?@nAjBzGpK\h@@BXb@FJxBhD|@vAdFbIvA|BhDnFr@hAj@|@n@dAl@`Av@pAr@fA`@l@dA~AfAbBXb@BDBBPZ@@l@`Az@tAV`@dAbB`@r@LR`AzAR\p@tA^d@l@t@h@z@FJ`@n@h@z@d@t@V`@@?d@v@`AzAvCrEv@pAXb@z@rAfBrCZf@Zf@FJj@|@fC~Dx@nAPZr@hAh@z@pApBb@p@|AbC~AfC`@n@vAzBXd@n@`AV`@n@`APVr@jA|@tAx@pAT`@HJtAxBl@`A?@JNHJ@Bb@r@JPb@r@FJJNJRX`@BDBD@B@@LRRXh@z@|AbClAnBRZPVfAdBx@pAnAlBDFbA|A@DTZVb@p@bAdEvG|AbC|AfChCbEdA`B?@@@?@T\r@hA|DjGhCbE|AdChFnIHHR^T\@Bl@~@rBdDV`@tAvB\j@f@v@BDh@z@xAxBJNhA`BV`@vBdDfAjBbC|DdDlFb@n@B@jFfIt@lAPXBFLR~@rANT`AzAnApBPXbA|AJTvAzBV^fAbBNVbBlC?@FHlB|C|@xAnAnBJN\h@`A|AV^@Bl@~@Xd@bA|APZ\f@d@t@\l@jAhBJNb@p@@@l@~@JPb@r@`@n@z@tAp@bAlAxB^r@jA`CfArCb@fA`@lAVz@ZbAp@|Br@nC\|AF^b@bCT`BBRLbARjBFf@?HPrBNjCFpAVnGDnD@FL|F@b@@j@HxCPlI?P@f@?LBpBFxDF|D@bABvABrABfF?`@@X?zA?@@vF@hA?l@AnB?^?V?vA@nD?pD?h@?@?hG@p@?vA?pD?\?z@?vA?xAA|EAfH?d@@bA?dB?fB?j@@R@dA@j@@J@^Bb@@F@^DbAB^HbA@RJtADl@Dn@b@pGTtDRtD@d@@h@?@@h@@j@?t@@jA?F?b@?dC?dI@jBAtF?bC?l@?|D?dD?H?zA?l@?~@?n@?p@?hA?PAF@rC?J?nB?l@?J?~@@`C?fCAv@A\?TATA^An@WjEC`@Ch@Cx@EvAClA?n@?pA?tB?D?b@?x@?F?n@?|@AnG?dCAjA?z@?rB?d@?\?F?^AxO?J?D?L@\?N?D?V?hB?xB?`B?jA@rB?f@?d@@jB@`ADhADl@B\BZPvBb@xDFd@X~Bb@tDP`BHv@Fl@?BDf@@NBj@@ZBf@@xA@zA?j@AvI?~A?p@?`B?l@?`@@\C~K?j@?j@?bD?jF?@?BA|I?hG?zF?zCAfC?|@A~@@rD?rC?rA?R?p@?rD?bCApKApDAtN?@ApA</points>
    </polyline>
    <duration>
     <value>781</value>
     <text>13 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; at the fork to continue on &lt;b&gt;I-44&lt;/b&gt;</html_instructions>
    <distance>
     <value>21608</value>
     <text>13.4 mi</text>
    </distance>
    <maneuver>fork-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>36.0890137</lat>
     <lng>-96.0278856</lng>
    </start_location>
    <end_location>
     <lat>36.0890420</lat>
     <lng>-96.0370057</lng>
    </end_location>
    <polyline>
     <points>isg{EhmbiQ?bC?pC?n@?D?@?f@AhG?|C?dA?zA?p@AvB@jBAhBCrE?z@?@?x@?H@d@Aj@@v@</points>
    </polyline>
    <duration>
     <value>32</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-44&lt;/b&gt;</html_instructions>
    <distance>
     <value>820</value>
     <text>0.5 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>36.0890420</lat>
     <lng>-96.0370057</lng>
    </start_location>
    <end_location>
     <lat>36.0870794</lat>
     <lng>-96.0417449</lng>
    </end_location>
    <polyline>
     <points>osg{EhfdiQAfD?nABx@F|@BRBVHh@@B@H@BF\Lf@Tn@BBVl@FHR`@RXHJFHDFLLNPNLLL^Zr@l@JFp@h@FT</points>
    </polyline>
    <duration>
     <value>21</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Take the &lt;b&gt;OK-66 W&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Interstate 44 W&lt;/b&gt; exit on the &lt;b&gt;left&lt;/b&gt; toward &lt;b&gt;Sapulpa&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Okla. City&lt;/b&gt;</html_instructions>
    <distance>
     <value>513</value>
     <text>0.3 mi</text>
    </distance>
    <maneuver>ramp-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>36.0870794</lat>
     <lng>-96.0417449</lng>
    </start_location>
    <end_location>
     <lat>36.0757441</lat>
     <lng>-96.0534505</lng>
    </end_location>
    <polyline>
     <points>ggg{EzceiQhCnBNJ`BlAb@\fBxAx@z@@@XVx@t@bA|@bCxBx@p@vAnAf@d@l@f@dCzBHHdCvBnAhA~@z@f@`@zBnBJJh@d@BBNNn@j@RPfAfAl@n@V\`@h@PVvB`EvB|D\l@t@vAt@vA</points>
    </polyline>
    <duration>
     <value>63</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Merge onto &lt;b&gt;I-44&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;OK-66 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>1653</value>
     <text>1.0 mi</text>
    </distance>
    <maneuver>merge</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>36.0757441</lat>
     <lng>-96.0534505</lng>
    </start_location>
    <end_location>
     <lat>35.5999421</lat>
     <lng>-97.4260288</lng>
    </end_location>
    <polyline>
     <points>k`e{E`mgiQnBrDh@`AbAjB`BxClAvBj@bAf@bABDz@dBBDh@dAlBxDxArC~ClG~@hB~@jBJR^r@|@fBj@fA`A`Bv@lAJN^j@NRpAhBt@~@@?X\t@x@Z\vAvAJJt@r@z@t@PLfBvAh@`@B@z@l@hBhARJl@\p@^NHpAn@\P@@~@b@`Af@VJHD`CjAz@`@dBz@jAj@vAr@nB~@pBbAh@TzE`CVL`Ad@fBz@`Ad@\PbAd@TLnB~@ZP^Pt@^vAr@LFjAj@|@b@~@b@`Ad@^Rj@VvBdADBZNj@X~GfDv@^hD`BRJd@TjCpAzGbD^RlB~@`Ad@l@Z~@b@dClAbAd@?@n@XvAr@XN|@b@B@`Bv@lAj@r@^~@b@`Af@`Bv@tHrDjCrADB\T~BnA^T~A~@\R@?@@zBpA\R@?~@h@|@f@@@`CtAXN@@dB`AvAx@~@l@h@ZPL@@RNHFhAz@RPVTBBNNp@r@LLh@n@HJDFTZpAfBNRhA|A`@h@j@x@v@dAp@~@b@j@LPNPRV@?VXPPRR`@\\Vp@d@^TVLj@XTJVHl@Tp@PTDVFt@N|@PdARb@HdDn@tB`@n@LVFjATh@LZHzA`@TFZLbAZ~@\ZLd@PLDLFf@V\Nf@Vb@RZPPJ^R^T~@h@DBXN|@h@XNdAn@nAt@\V|@l@FDnAdAx@t@r@t@XZXZBDVXNRX\TZTZ`AxAl@dAHNJPTb@\p@HNHR@@P`@HNHTBFN\FNHTPd@@BLb@HTFNJ^BFNf@Lf@HZDLLj@Jd@BHH\Hd@FZ@BP~@@@TlA^pB|@vEDTP`A`@pBBJf@nCLr@Lj@BPF\DP?@p@jDLl@rEhUl@fDLl@Nv@BPf@bCf@pC?@d@bCDLd@jCb@|BNr@P~@Lr@Jh@BH`@rB@HpAzGDTDRJh@Jh@Jh@TpAJh@VrAVrA`@|BZ`BFZX`BFZb@|B@Lv@dEDTThAp@pDz@nEz@pEl@~CbAlFJh@b@|BJh@VrAJh@n@dDz@pEVrAz@pEVrAd@bC`CdMVrAVrAn@fDZbBFXJh@n@fDJh@~AlIb@|BJh@n@fDJh@VpAJj@Z~Av@dE`C`M|@zE@HN~@n@`ED\Z~BBLD\X`CFh@PtAZ`CX`CX~B|@lHnAbKX`CHh@X`CFh@NjAR`BFh@Hj@Ff@Hh@Fj@BNDX@PDXFh@Hj@Fj@PtAPtAPtAPtAX`CX~BdAxIPtAZ~BX`CFj@j@tEj@vEPtAb@jDr@|Fh@dE`@jCf@xCDXv@`Ej@jC?@Jd@n@jCV~@?B\lA\nANh@j@lBb@nA`@rAn@hBDJhArCDN|ArDx@fBvAxCv@zA`AfB`C~D`@n@T^DFRXZf@j@z@Zd@j@z@Zf@HHLTX`@h@z@fA`Bp@dAlAjB`AxAV`@T\p@bARXl@~@BD@@BB?@?@BBDHHLDDDF~OhVrEbHd@r@vIxM~BlD|BlDp@dAt@jAPVfAbBV^`BbCzCtEJPvBbD\f@`AzAlBvCHLxBbDvKpP|A`C`G`J^l@pCdEbD`F~AbCp@`AnCdE`@l@dF|HfBnChCzDpHdL\f@xA|Bh\fg@`BbCZd@bAzARZrApBf@v@HL|A`C`@j@DJx@lA|@vAp@bA~@vA|@rAf@x@NRpAlBb@r@b@n@Xb@dBhCnBxCRZjAdBVb@pAnBNRf@v@bAxAz@pAfBlCpB|Cv@lALPzBjDxCrE\\Xd@f@z@d@x@t@dAxD|F~A`C~AbCt@jAt@jAhAbBHLpAnB|@rA?@~@tA^j@V`@DF\h@n@~@b@p@V`@lAhBPVz@pAb@p@h@v@jAfB~@vAvAxBhAdB`AxA^h@d@t@f@t@^l@V^|@rAt@jAh@v@v@jANVn@`AbAzA~@vAnAlBDDvBdDDHvAvBXb@Zd@zA|BlBvC|A`C~AbCfBjCt@jAJNzA~BdA|A`AzAn@`A~@tAFJfAbBrArBJNjAdBj@~@V^|A~Bl@~@n@l@?@`AzAzD`GV^fAbBV^V`@n@`AhGnJv@dAnFhIp@dAn@bAV^dA~AzBfDj@|@|EpH|A~BBDRXfDfFnDpFd@r@vKpPBB|@rAjN`Tn@`ATZp@dA~@vAFJTZrChE~DfGtEbHZd@HLd@r@j@|@Zb@tB`D@BTZ@BfAbBTZhAdBl@|@r@dAbA~A~A~BhAdBXd@dA|AXd@|A~B@BxBdDrB~CBBRZhDfF@BPVlAjBdA|AXd@nFdIT^BBbA~AZb@bA~ABB|A~BXb@dFxHT^rGvJ@BJLjIfM~@tAV`@V^V`@nIlMV^Zb@HNx@nAV`@r@bAHNn@~@JNV^fAbB@BJLHL~AbCV`@Zb@HNzRfZLPBDHJ|A~BV`@JPLPzL~QJLV`@@BHLrApB@BJLpApBLPT\JP@BdAzAdBbCzBxC|AlBxAbBt@z@hApA|A~AnAlAv@x@fAbAlAfAB@@@|ArARPXVB@ZV`@ZZTz@l@\VbCdBpBxAt@l@DBFDRN@@ZV\TRP`BjA@B@?XR@@@@HFTNVR~@r@^VVTb@ZVRB@`@\ZRXRBBZVx@l@@@@?v@l@BBtAdAHFRN@@@@~ArAx@r@nAhAXVZZ@@VVNNj@h@VV\^@?XZ?@VVNLLPZ^t@x@VV@BTTDD`AhAvAhBp@x@r@bAX^@@?@rAhBJPX^@@@@R\@@d@t@FFl@bA@@@@n@bAPZBDT^R^@@R^BB?@tAdCBB~@fB?@R\@B?@n@pAb@|@dBxDPb@P`@@@N`@Pb@BDPd@b@dA@BFLFNBHvBfG`@hA`@pATv@ZdAL`@HZTx@`BjGp@hCvApFLh@Nf@Lf@|@lDx@|CLf@tAnFlD~Mf@lB~@pDXdAHXLn@~@nDb@bBlBnHnAzEZpAZpABHDP`@~ADNNh@@@Nh@j@xBBHH\\pALf@FT`ArD\pAfAjEvApFLf@Nf@Nl@DPFR@BDNPv@HXFRDR\pAFRTz@Lh@DP@@DRDP@?BP@BBHHZ?BBHHX?BFTDRLj@XnADRDTLf@n@bD?BBH@HDTBF@JTjAd@dCP|@BH@HH^P`AFZr@tD@D@HBJF\Nv@Pz@DTDRHb@@D@HBJF\H`@VpAJd@@JBJDR@HBJH`@R~@Jh@F^BH?DBHF^DR^jBRhAZbB@Bh@nC?BJh@BNDRDTFX?DVjADRBL@FFVZdBHb@@D?@F\Nr@l@bDn@dD@FDN@HVtANp@?BDP@BHh@DPVpADTDR?BDRh@nCJh@Jh@?@DPt@zD?BBLdB~In@bDd@fCVrA@@@DTnATnA@@?BHb@@@PbAf@hC@@?@Hd@~AlI@B@JFXJh@p@hDHf@@??@H`@?Db@|BLj@ThA@FHf@H`@f@fCHb@@DJh@Hb@X`BFV@FFZBL@HTfA@JH\FZBL@HJh@l@|CH`@BPZ`B^jBn@hDRdAd@`C@HH^@HH^b@|BLp@H^@HH^Lr@H^Lr@XvAHd@z@nEHd@p@jDr@rD^pBpAzGrAbHTnA~@zEJh@TjAb@zB@HBLFZ`@rBXzA~@zEDTJh@@H~AjIH`@BHj@|CBFn@fDtBvK@Hl@|C@HZ~ADRXzAZ~ADRh@vCBN@Hn@lDp@pDd@lCl@hDf@rCBRLr@ZdBBL`@|BBHF^BRf@pCFZd@jCF`@Lr@@@Hh@FXBLHh@Jj@VpAJj@Lv@r@`EJf@l@fDdBvJl@lD?@Hf@DPf@tCLp@H`@Jj@Hf@`@|BTtAJj@H^VzAJh@VtATpAJj@`@|BHf@`@~BbAzFPbABN@@TpAHh@H\Lv@Jf@Hh@F^BJTpAJj@Jf@DVZdB~@rF~@dFd@pCZ~A?@Hf@H^b@fC?B@BH`@TpATtA@BLt@^tBHb@Jh@?@Hf@\pBBJJh@?@Nv@VxAN|@@BRjAf@pCd@pCLp@Jh@?@j@dD@@F\@H`@|B@BHd@r@~Dp@zD@@BPDV`@|BTlAJl@Jj@j@dDPbADR^rBtAdIDRJh@DTDRN`AP|@DRHh@Jl@Jf@BRP~@BRDTDR\hBF\z@~EDPf@rCN~@f@pC?@Nx@?BN`ALn@Lv@\dBJn@VtANx@Lx@VnAb@bCN`AN|@TlAJn@XbBRbAPfAf@nC^nB^xBzArIhC`ObA|Fv@pEJh@j@`DJn@x@pEJh@hBhKDZJh@TrAb@|Bj@fDJh@|CjQz@zEF`@nAdHlA~GBPVrAVvANt@DP@JRx@b@rBNv@BFDP@BDPDRFTFVLh@V`AH\DR^tADNf@`Bt@fCj@jB`@jALb@HRJXd@pAZ|@DJJ\@@FPP`@\dAZx@BH^dABF?@FPb@lAFP^`ABHHRHTHTVt@`@jABFL\HRHT?Bd@lAL\FRL\Xv@DL\`ALZNd@FLVr@^dADHVr@`@nAr@jBb@nAb@lAb@lAb@nAd@nAb@rA\z@HRHTVt@n@jBVn@FPDJ@D`@hAHVFPPd@Pd@@BFPFP@BFNXv@Nb@Z|@?@FNHRFPRj@FNL^Tn@Xt@Vt@Vr@b@jAPf@FRBHLXPf@LZFTBDHXLZTl@Tn@BFDJPh@Vr@Xv@b@jA`@lAd@lA?BPb@Pd@?@FPHTFPHTd@pALZPf@BH`@hAFPFNNb@DJh@xADN`@hA@BJXN`@Tl@Rj@Z|@d@rAn@dBHTJXZv@L`@@@HTJZTn@DNh@xAn@hBp@hBRj@Z|@Ph@\`AJV@Bn@hBp@fBFNDNJXdAvCPd@Rh@Pd@FRjBlFDJx@|BpCxH`BvEtA|D@Bz@bCJTPf@L`@b@nA@@N`@@BNb@`@jA@BNb@LXVt@Pd@bArCPh@Rh@HVz@`CJVBJPd@Rh@FPXv@@BRj@L^^fARh@Rh@HVf@vARh@@Bp@jB`@lA@??@?@Vr@pCzHz@bCBF\`A@BXx@Xx@Vp@\`AFNFRRh@Pf@Nb@Xr@FTd@nAfBdF\`A^`AtAbE~@bCFR`GpPtAvDrAtDRj@rEnMd@pAzBnGTn@t@tBJXJTvAbEjBhFl@bB\`AbAtC`@fA`@hAbArClAhDj@`BjBlF|@fChAlDnAjE~@pDf@pBd@pBPt@l@vC\bBV|A\nBn@rDTnA@HDZtAtHHh@\lB`@`CX~AbAzFj@bDb@|BzBrMJh@nAdHv@pEN~@bBrJn@jDfAlGtA~Hn@vD`ApFJj@Jh@nAlHJj@`@`CJh@zAxIJh@dA`GJj@Jj@`@~BJj@Jh@hCdOJj@zAvIb@`CHh@n@jDPbAN~@P`A\jB@FLr@FZF\PbA`@|BZnBR`ALn@TrANr@RnAb@dCb@dCb@dCr@dEn@vDt@fEx@rEv@pETrAbAzFnAdH@HF^l@hDJh@?Dv@jETfBT`CBj@D~@BhBA|F?f@ClI?~BAdE?fB@z@Bx@@TFp@Dd@B`@Jz@PlAXxARz@V~@\dA\fA\bAv@`C\bAnCnIhA|DLj@VnAPjAHh@Hz@Db@RpC\pEh@hHJxALxAFz@JtAL|AB`@PbC@LPrBDd@XrDRpCBZXnD?FDb@tA`RXlDVnD^xEDj@hAjODh@|BlZt@zJ?@Dh@d@dGDj@Dh@XnDDj@Dh@\zEDh@^xE?@d@bG?@@L~@~Lf@tGF~@H|@~BzZt@xJ@NVlDBZ|@lLDl@@RFj@@N@JPdCr@hJBZ~@bM\hE`BhTDh@vBnYNpBFh@b@dGRbC|@rLnAvPh@`Hn@nIDn@R~BZdEF|@Dj@@NV~CFt@B^LtARnCLvA?DDb@NvADh@LvAFj@VtCd@pEl@hGbAxJN`BrA|MXvCFj@b@vE@FDb@f@vEh@rFT`CNtAjBbR`@lEf@bFFh@XtCnBtRr@hHb@rEnCvX\jDT`C^lDrAzMz@zId@vENtAjCbXnBxRr@hHVfCpAzMxAbO|AjODj@BPBVh@jFnAnMhAlLFl@rBhSx@hId@xE^jDFp@ZfDb@fEjAnL~@nJxCrZFh@NtA\lDpAzMVzBB\d@lEP~AFj@Fb@`AhI`AfIf@pEbAnIFj@PtAFj@NtAPtA`@jDFh@j@vEvCdWHj@h@vEdBdOj@tEFj@fBrOXzBVzBFf@@HNrARdBF^Fr@v@tGR|AD\NpAJ~@Fj@Hn@D\BXBJ\zC^~Cd@zDf@dENtAFj@Hh@BRPzAPtANtAX`CX`CV`CR|AVvBV`CHh@`@jDdAbJ?@Fh@z@lHFh@PtAx@lHD\b@xD`@jDHh@jAbKFj@z@jHFb@lAhKlBnPd@xD`@jDfCjTHz@vAzLJz@r@`GJ`A\rCFj@h@tEd@zDDZFh@p@`Fl@nE`BvLpAlJHh@D^@Jx@|F?@\~BNjAJr@R|APjA@LF\Hh@NhAr@jFv@rFl@tEf@jDPrALx@x@hGVhBThBd@fDRxAT|APnAh@nDPrAPnAbApHlAxIl@nEFb@h@pDd@lDTdBHl@`@pCl@lEXtBDZn@lEBTT~AXrBRtA?B`@pC^rCLz@|@xG\~BtA~Jl@jE@Hd@hDJv@PfAF`@R|At@lFPvAt@hFBPHj@d@hDHh@VhBVjBFh@?@RrAZ~BHh@?@ZvBx@dG?@@@v@zF?@NdAh@vD?@BP`AbH`AhHXrB?@L|@h@vD^hCD^?@XnB`@rC^jCFb@RxAVhBVlBJn@`AbHp@`Fv@tFJt@d@hD@HF^d@jDF`@l@lEBNHh@XtBl@nELx@f@nD^pCRtA^rCLz@RvAL~@RrAXpBL`Al@lEDRBTbAjH@LDZHh@RtAd@hDHj@@DFb@PnARxAHj@Hh@l@nEPpAZxBBPDZHj@Lv@@LBNBPBLTrAJh@BPNz@DT@H@HFXLj@P|@P|@j@pCxAzGVlAVlAJd@Lh@d@zB`CzKt@pDXpAvG|ZLh@VpALh@rBrJlCdMLh@Jf@zCnNzEfUH\FXFXHXH^BLDT@BNr@@DLl@j@nCf@xBb@xBZtAr@dDF\@@DVPx@VlAXnA~@lELh@pDzPt@dDrBtJH\l@rCPt@Pz@`C|KdCjLf@`CLh@Jh@Np@z@|DFVj@lCBLn@tCXvAJb@Ll@XrAhCvL~BrKp@fDrHt]bAxELf@~@lE?@d@zBf@xB`C|KzAfHJf@@@xA~Gd@zBLh@~@lEJh@Lh@r@bDJh@Lh@Jf@Lh@Jh@Lh@XpAd@zBr@dDj@jCh@dCr@dDr@dDR|@^dBd@zBDPR~@BHThADNR`AXrABH@DR`ALh@h@bChAnFb@rB`AtE^`BFXPx@l@rCDNFXBNJd@TfAd@tBLj@DNVjAThAR|@XlAP~@@@P~@bAvEDLv@vDBNnAxFb@pBDRPz@Pz@ZrABNBJFVH^H\FZFZJ`@DVNp@J`@Px@h@fC@FFTH^FX|AlHHZBLDRt@lDDPx@xDDPXpAJh@Jd@VfAPx@ZvAH^H^BLJd@Pv@Nr@BLdBfIDPDLJh@Pt@FXNn@TjADLp@~Cb@vB`@jBjBxILh@lAtFJh@f@zBJh@HZ\`BJd@r@dDJh@r@bDXlA\dBPp@R`ALn@HZHb@Jb@Nr@H^DLBNNt@J^FZXtAP|@Nr@VpAF\XxATtAFXDRPhAx@bFF^Jv@Hd@BTv@xFv@vG`AxJ@N?@l@nHXlDR~B?@@DB^Fr@JxAHx@BT?@?@Df@@H^nEDj@XlDDj@VxCTtCDh@?@@?Dh@JvADf@@BP`CFj@P`CH~@H`A?@h@lGr@zIDj@f@dGDh@hBvTDj@n@tH^vEFj@d@bGhA`Nd@bGJjAFv@HdAD^HfADj@BXFl@PrBZxD@RJfAZzDFv@@FB`@ThCDb@@NB`@LzA?@\xDn@fIh@lGXnD@NFj@@T@H@J@PD`@NdB\nEHt@?D?D@FNlB@LFn@BRJxAPpBDd@@FLbB@JV|CLzATpCHfAJhA@JJnAFr@BT?BTrCBZXlDt@|I^vEXlDNhBDh@@LBZBN?F@DV~CFv@LzAHx@?LBNB^LxAHx@@V@BBb@L|ADf@JhAD^@R@HFz@BX?BDZ?DD`@@LDd@PvB@J?B@JBZH~@B^BPF|@@@Bh@VnCB\PzBFl@@N\nEBLRlCJlAHv@VzC@RFt@Fn@BZ\dEXhDx@~JdA|MD\B\?BFl@Dj@BPDj@Fj@Dh@Dj@JdADh@JvALtARbCl@nHFj@TnCB\XlDDh@@LPtBZlDj@|FFl@?B?@p@xFrBlPj@tEd@vDtCvUv@fGVlBFh@Ff@BTVlBTfBBXF`@PzADXFd@b@hDD`@DV?B@HL`AJx@\pCPtAJx@Jz@Jx@l@vEz@fHFb@XtBTjB`@fDL~@f@`EBRtCnUp@tFHp@XvBTnBF\D^Fl@XzBXtBTjBD`@Jv@Jz@ZlCnCjTdAnIl@|E`@jDHh@b@jDj@tE`@bD@FHp@b@dDLjA@FL~@jC`TNnAFf@Fd@LbAL`AHn@t@`G?@\hCNhARbBl@bFr@tFb@lDrBhPt@~FJv@f@~DHr@b@jD\jCD\~@tHNjANtAL`ABP?@Hj@X|B?@NnABTv@xGFj@h@tEHj@^jDX~BFj@X~Bx@jH?@X~Bh@tE?@f@lEpEz`@@?n@~F@?x@jH|AhNh@tE?@f@tE?@Hh@?DtBtQh@tE?@X~Bp@`G@?Fj@RbBBZF\r@nGHj@^jDHj@l@rFBLFh@?@Hh@?BFf@RjBBRRhBBRHn@NtA@H^`DHh@Hx@`@fDP|Ad@dE@DDd@Hh@b@zDDZFj@Fh@`@jDFj@PxA`ArIHj@h@vEFh@h@vEFj@bAvINtAz@lHL`AB`@Fb@Jv@XbCBRD^BTNrAR~ATtBJv@Jz@LlA@HF^Ht@NxALfA@FF`@Jz@`@nDNvAPrAZnCXjCFf@Ht@^`DBLNrANvAVpBVzBTrBTrB^~CNhALrABLX`CDZ@L`@jDBPHx@P|AHl@Fj@NpAh@xEBTHp@D^D\Fj@Fh@H~@PvABNFj@Hx@Jx@Hv@L~@Ht@NjA\vCBRh@xE|@zHTvBPvAVtBBXHt@Jx@PxAJ|@@JFh@D^PxAP|ABVBPP|AtCxV\xCDd@J|@^jDnC|UHh@Fj@p@`G|AvM`AxI^jDHj@?@Ff@NfBHz@Dl@?FBZDf@LdCD|@?@J~BThDZnDHl@BRBVB\dAdJn@zFf@nDv@pHDZL|@RnAHj@@B\hBNv@?@VnABLJj@H^Jj@TjAHf@Hh@DTDTRtA@NLfABPRfBFn@d@|DFh@DZFj@RdBXdCt@lGd@rEFt@BX?^@vBErBIxAKn@Kp@Oz@</points>
    </polyline>
    <duration>
     <value>4378</value>
     <text>1 hour 13 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;right&lt;/b&gt; to continue on &lt;b&gt;I-44&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Toll road&lt;/div&gt;</html_instructions>
    <distance>
     <value>138740</value>
     <text>86.2 mi</text>
    </distance>
    <maneuver>keep-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.5999421</lat>
     <lng>-97.4260288</lng>
    </start_location>
    <end_location>
     <lat>35.5971399</lat>
     <lng>-97.4316540</lng>
    </end_location>
    <polyline>
     <points>sbhxEtosqQBR?@?@Kd@Qx@Qx@AH[tAAJEPCNCPAHANARARA\?@?V?D@\@RHr@BZBL@@H^BLBFNj@DLVr@T`@Xb@LRFFJLNNXPVR@?RJ\NjBh@^JnBh@z@V`@LXR</points>
    </polyline>
    <duration>
     <value>35</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Take the &lt;b&gt;I-35 S&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;I-44 W&lt;/b&gt; exit on the &lt;b&gt;left&lt;/b&gt; toward &lt;b&gt;Okla. City&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Downtown&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Kilpatrick Turnpike&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Toll road&lt;/div&gt;</html_instructions>
    <distance>
     <value>733</value>
     <text>0.5 mi</text>
    </distance>
    <maneuver>ramp-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.5971399</lat>
     <lng>-97.4316540</lng>
    </start_location>
    <end_location>
     <lat>35.5419621</lat>
     <lng>-97.4595098</lng>
    </end_location>
    <polyline>
     <points>cqgxExrtqQt@R@?RHVJb@PLHj@Xx@^`@TVPVLj@XrBhAfCtAzBpATLTLPHLF~@h@\R`@T~@f@FBp@`@`@RtAv@bAj@@@bAh@zDvBPJVLfB`AlEbCLF@@dGdDd@XNFBBJF|BnANHBB@?HFpBhAJFNFDDHDtAt@fFrC\RbE|BhB~@VNrBhATLzAz@JDfBbAvBjAf@X~@f@`@TDBNHj@ZXPjAl@f@\nDlBVNd@V^R~GvD`@RdDjBvC~ATLv@d@vAt@p@^BBJFfAj@j@ZDBPJ`@T@?b@V^RNHhAn@LFvBjAdCvApAr@x@d@TLRLPJB@bAh@|DrBv@b@LFBBPJLF^T\Pj@Z`@TRJHF@?FBTLB@x@^ZLHB?@^LTHXHl@NFB@?@@TFB?f@Lb@HVDn@NdF|@bARdBZ\H|@N^HH@RDJB@?n@L^F^HF@^FB@n@L^FF@\HD?nB^rDr@D@B?bB\lCf@\FVDVDbBXl@J~FdApAVb@HTFt@N~@Px@Nj@JB@H@TFZFlPxCj@Pt@Nh@HrAZhB\tFbANBPDNBF@fDp@XHb@Jv@Vp@Tb@P@@z@`@TLDBRLnBnA</points>
    </polyline>
    <duration>
     <value>224</value>
     <text>4 mins</text>
    </duration>
    <html_instructions>Merge onto &lt;b&gt;I-35 S&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;I-44&lt;/b&gt;</html_instructions>
    <distance>
     <value>6679</value>
     <text>4.2 mi</text>
    </distance>
    <maneuver>merge</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.5419621</lat>
     <lng>-97.4595098</lng>
    </start_location>
    <end_location>
     <lat>35.4629807</lat>
     <lng>-97.4902443</lng>
    </end_location>
    <polyline>
     <points>gx|wE|`zqQJ?@?@@FBpClBn@^`@Tl@XVN^NNFr@VFBVHTFn@Pl@L\D`@FJ@|@FB?\@XDp@Bp@?@?l@Ah@CVANANAl@GRClAUz@On@Ol@MRGdCm@vA]nCq@ZIh@M`@IJEb@Kj@M~@Qb@GF?PCF?^CB?l@CPAbA?N?fI@hB?r@?f@?fBA~A?R?jB@nC?bCAL?D?rB@|K?p@?@?@?r@@pD?vA@r@?nC?lL@xF?t@?P?H?H?F?L@zA?f@?H?r@A|B?D?F?z@?@?H?xA?nDBL?xCFL@P?nCTL?VBXDp@FTDfAN`@FLBTDNBPDfFfAd@L@?~@Tj@NjCn@bEbAPDr@PnM`DfAXd@Jd@N@?LBjInBl@ND@?@d@JxCv@NBxBh@j@NdBb@xA\~FvAHBv@Pv@P|Cj@x@JbAJ`@B`@DB?h@Db@@D?z@@T?tA?l@Ah@@~A?hA?nB@hDAnC?|G@j@?pBA`CAT?f@ARAl@AvEQpBI~@EXAdAAvFGX@lADB?R@N@B?jAFp@FtAJdAJvBT`AJ`AHzHv@b@DLBd@DjBRjAJ`AHlAJrD^j@F\Dv@H\BdAJv@HfBP`@Dd@DD@XBN@jBRh@Ft@Hz@NPDr@Nv@PjAZfA\XJVHjAf@~@b@f@Vf@Vn@`@r@d@\TjAz@ZVRRDBx@v@NN`AfALJdAtAPZl@bARb@\r@FP`@jA@BDJd@jB?@FPDTLx@D^Ff@Jt@HhADd@LzD@l@FhBHzBD|@@XBj@Bh@NnD@F@b@?FNfD?FBb@Bj@?HLbE?lCCrECnICxEEpJKvJAn@C|B?|@</points>
    </polyline>
    <duration>
     <value>383</value>
     <text>6 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; at the fork to continue on &lt;b&gt;I-35 S&lt;/b&gt;, follow signs for &lt;b&gt;Okla. City&lt;/b&gt;/&lt;wbr/&gt;&lt;b&gt;Dallas&lt;/b&gt;</html_instructions>
    <distance>
     <value>10645</value>
     <text>6.6 mi</text>
    </distance>
    <maneuver>fork-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4629807</lat>
     <lng>-97.4902443</lng>
    </start_location>
    <end_location>
     <lat>35.4629005</lat>
     <lng>-97.4965552</lng>
    </end_location>
    <polyline>
     <points>sjmwE~``rQ?B?~@ApA?h@@j@CjDAxDAr@?F?z@Av@?zAB~A@j@B|@JjC@^@Z</points>
    </polyline>
    <duration>
     <value>20</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Continue onto &lt;b&gt;I-40 W&lt;/b&gt; (signs for &lt;b&gt;Amarillo&lt;/b&gt;)</html_instructions>
    <distance>
     <value>572</value>
     <text>0.4 mi</text>
    </distance>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4629005</lat>
     <lng>-97.4965552</lng>
    </start_location>
    <end_location>
     <lat>35.4623125</lat>
     <lng>-97.5161835</lng>
    </end_location>
    <polyline>
     <points>cjmwEnharQKN?@?H@\@h@?F@XFrADt@L`BBVRfCDj@L`BDb@@n@F|ABzA@nAAnA@|A?fAAz@Ej@Cj@?F@FBDB~C?P@R?T?P?B?H?V?H?`@?F?P?X?bA?R?j@?dC?j@?j@?j@?j@?j@?b@?F@j@?j@?BBf@@\@HBn@Dj@Bj@?X?P@j@?f@?n@CdB?J?f@?R?V?N?F?hA?F?Z?d@?n@?V?\?vA@j@?N?NBvA?@?j@?D@bB@dA?`@AvA?^</points>
    </polyline>
    <duration>
     <value>144</value>
     <text>2 mins</text>
    </duration>
    <html_instructions>Take exit &lt;b&gt;151A&lt;/b&gt; to merge onto &lt;b&gt;Oklahoma City Blvd&lt;/b&gt;</html_instructions>
    <distance>
     <value>1786</value>
     <text>1.1 mi</text>
    </distance>
    <maneuver>ramp-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4623125</lat>
     <lng>-97.5161835</lng>
    </start_location>
    <end_location>
     <lat>35.4642458</lat>
     <lng>-97.5162095</lng>
    </end_location>
    <polyline>
     <points>mfmwEbcerQg@?[@U?e@?OCKAUAqEJ</points>
    </polyline>
    <duration>
     <value>42</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt; onto &lt;b&gt;Thunder Dr&lt;/b&gt;</html_instructions>
    <distance>
     <value>215</value>
     <text>0.1 mi</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4642458</lat>
     <lng>-97.5162095</lng>
    </start_location>
    <end_location>
     <lat>35.4664193</lat>
     <lng>-97.5163277</lng>
    </end_location>
    <polyline>
     <points>qrmwEhcerQiJNo@@WD</points>
    </polyline>
    <duration>
     <value>53</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Continue straight onto &lt;b&gt;Ron Norick Blvd&lt;/b&gt;</html_instructions>
    <distance>
     <value>242</value>
     <text>0.2 mi</text>
    </distance>
    <maneuver>straight</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4664193</lat>
     <lng>-97.5163277</lng>
    </start_location>
    <end_location>
     <lat>35.4670278</lat>
     <lng>-97.5163219</lng>
    </end_location>
    <polyline>
     <points>c`nwE`derQyBA</points>
    </polyline>
    <duration>
     <value>14</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Continue onto &lt;b&gt;N Robinson Ave&lt;/b&gt;</html_instructions>
    <distance>
     <value>68</value>
     <text>223 ft</text>
    </distance>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4670278</lat>
     <lng>-97.5163219</lng>
    </start_location>
    <end_location>
     <lat>35.4675612</lat>
     <lng>-97.5164077</lng>
    </end_location>
    <polyline>
     <points>}cnwE~cerQKDQ@M@K@M@O@Q@A?</points>
    </polyline>
    <duration>
     <value>7</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;N Robinson Ave&lt;/b&gt;</html_instructions>
    <distance>
     <value>60</value>
     <text>197 ft</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <duration>
    <value>11799</value>
    <text>3 hours 17 mins</text>
   </duration>
   <distance>
    <value>349512</value>
    <text>217 mi</text>
   </distance>
   <start_location>
    <lat>37.0842449</lat>
    <lng>-94.5132840</lng>
   </start_location>
   <end_location>
    <lat>35.4675612</lat>
    <lng>-97.5164077</lng>
   </end_location>
   <start_address>Joplin, MO, USA</start_address>
   <end_address>Oklahoma City, OK, USA</end_address>
  </leg>
  <leg>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4675612</lat>
     <lng>-97.5164077</lng>
    </start_location>
    <end_location>
     <lat>35.4677346</lat>
     <lng>-97.5164804</lng>
    </end_location>
    <polyline>
     <points>ggnwEpderQA?MJQ@</points>
    </polyline>
    <duration>
     <value>4</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Head &lt;b&gt;northwest&lt;/b&gt; on &lt;b&gt;N Robinson Ave&lt;/b&gt; toward &lt;b&gt;W Main St&lt;/b&gt;</html_instructions>
    <distance>
     <value>21</value>
     <text>69 ft</text>
    </distance>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4677346</lat>
     <lng>-97.5164804</lng>
    </start_location>
    <end_location>
     <lat>35.4675748</lat>
     <lng>-97.5128869</lng>
    </end_location>
    <polyline>
     <points>ihnwE~derQ?I@QD}BD_@@_C?gABU@M?G@K?C@q@@[AaBD_B</points>
    </polyline>
    <duration>
     <value>91</value>
     <text>2 mins</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt; onto &lt;b&gt;W Main St&lt;/b&gt;</html_instructions>
    <distance>
     <value>327</value>
     <text>0.2 mi</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4675748</lat>
     <lng>-97.5128869</lng>
    </start_location>
    <end_location>
     <lat>35.4664669</lat>
     <lng>-97.5130464</lng>
    </end_location>
    <polyline>
     <points>ignwEpndrQ`@Ab@@J?RBtBZ</points>
    </polyline>
    <duration>
     <value>27</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Turn &lt;b&gt;right&lt;/b&gt; onto &lt;b&gt;N E K Gaylord Blvd&lt;/b&gt;</html_instructions>
    <distance>
     <value>125</value>
     <text>410 ft</text>
    </distance>
    <maneuver>turn-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4664669</lat>
     <lng>-97.5130464</lng>
    </start_location>
    <end_location>
     <lat>35.4621308</lat>
     <lng>-97.5130486</lng>
    </end_location>
    <polyline>
     <points>m`nwEpodrQdBVVBX@nA?x@?V?~BFp@@J?@?HAZALAHAd@Gn@Kd@GFALAJAXAj@?@?R@@?B?B?T?P@</points>
    </polyline>
    <duration>
     <value>88</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Continue straight onto &lt;b&gt;S E K Gaylord Blvd&lt;/b&gt;</html_instructions>
    <distance>
     <value>485</value>
     <text>0.3 mi</text>
    </distance>
    <maneuver>straight</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4621308</lat>
     <lng>-97.5130486</lng>
    </start_location>
    <end_location>
     <lat>35.4578767</lat>
     <lng>-97.5133626</lng>
    </end_location>
    <polyline>
     <points>iemwEpodrQ\?fABjBBtEFV@n@B@?hAD|AHl@DbBLX@B@F?</points>
    </polyline>
    <duration>
     <value>40</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Continue onto &lt;b&gt;S Shields Blvd&lt;/b&gt;</html_instructions>
    <distance>
     <value>474</value>
     <text>0.3 mi</text>
    </distance>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4578767</lat>
     <lng>-97.5133626</lng>
    </start_location>
    <end_location>
     <lat>35.4619173</lat>
     <lng>-97.5489404</lng>
    </end_location>
    <polyline>
     <points>wjlwEnqdrQHH@@B@@@@@B@F@J@N@V@R@H@V@F@P@HBD@FBFDDBBB@@DFBDBDBF@B?@@FBLBLDZ?h@?@Aj@?j@Aj@?j@?j@A^?\?XB~DL`EBrA@hA?@Pd@ArCA|B?z@A`@A~AAb@Ax@GjAGvAATC^I`AGl@Gv@OhA?D_@jCKbAeBdLqBzMYjBGZIh@cDjTEX?D}@rFyChSCLAHABALG\AJOz@QjAG\?@CLCLoBpMQdAQhAAFObAY`CAFAJOzAU~CGjAEzAAtB?|@?zAAbH</points>
    </polyline>
    <duration>
     <value>136</value>
     <text>2 mins</text>
    </duration>
    <html_instructions>Take the ramp onto &lt;b&gt;I-40 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>3405</value>
     <text>2.1 mi</text>
    </distance>
    <maneuver>ramp-right</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4619173</lat>
     <lng>-97.5489404</lng>
    </start_location>
    <end_location>
     <lat>35.4607928</lat>
     <lng>-97.5702782</lng>
    </end_location>
    <polyline>
     <points>_dmwEzokrQ?bC?pB?`@?j@@`H?j@@nC@\?L?F@b@B`C@d@L|EB|@?N@TBt@PdEHvAFvAd@fIFl@PzC@DNxE`@`R@`ADjD?@@n@@B?h@?DFpDFrFB~BBlE</points>
    </polyline>
    <duration>
     <value>67</value>
     <text>1 min</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-40 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>1939</value>
     <text>1.2 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4607928</lat>
     <lng>-97.5702782</lng>
    </start_location>
    <end_location>
     <lat>35.4602233</lat>
     <lng>-97.5974548</lng>
    </end_location>
    <polyline>
     <points>}|lwEfuorQBjF?zAB|A?JB~A@p@B|AHnEBxA@n@?@@d@?PBfA?@?DB`BB`B@b@?J@n@@T?@?V@V?V@n@?D@b@?HDzB@|@F~DLbHFnDD~A?@?B?N@P?JBvA@lB?LBjC@t@?t@?B?j@?f@?B?\?H?B?vAAhE?tJ?tB?~@?nF?lB?vB?J?dG?zCAbA?RAlB?T@fF</points>
    </polyline>
    <duration>
     <value>90</value>
     <text>2 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-40 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>2463</value>
     <text>1.5 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4602233</lat>
     <lng>-97.5974548</lng>
    </start_location>
    <end_location>
     <lat>35.4846502</lat>
     <lng>-97.7559067</lng>
    </end_location>
    <polyline>
     <points>kylwE`_urQ?fB@|B?dA?j@@|C?B?bC?T?F?x@?bC?xF?`A?L?jB?|@?nM?lB?bB?n@?P?zD?xB?zJ?L?bS?P?b@?r@Ah@@~B?Z?B?`A?nC?v@?j@?JAbD?v@?r@@pE?H?@ApE?VC~B?@Aj@AvCEtGEfEIpHa@na@CtAAvC?T?rC?bG@hC@z@?PAH@xG?dE?~@?p@?Z?J@z@@bN?nD?pA?L@f@@pJ?vE?tD?n@?X@hB?jD?N@lG@tM?l@?B?^?F?@?~A@pC?|A?nA?n@?b@?h@?R?R?R?zA?l@@t@?R?N?x@?x@?p@?n@?B@tK@fG?vB@`J?vA@zI?V?V@`E@xCArC?bCD``@@d@?`@?dA?l@@lC?TAtBDbU?r@?B?N?J?lD@`E?@?hD?rC@lE?fA?bD@zA?xA?H?R?B?N?@@tB?j@?hA@jH?fE@|B?xC?fA?@?^?N?^?~@@hD?B?N?x@@vH?lA?`@?~@?p@?z@?x@AxBCvAAj@?LErAI`DE`AGrAOhDQtCGfAEb@OjBI~@QlBCP?@QnA]dDc@~C]|BKl@UzA]hBOv@CJCNGXCLI`@YpASbASv@YpAMf@Md@Oj@Ol@[hAm@vBW|@[bAg@zAm@dBKZ_@dAM^O^KXABA@Qd@?@A@a@fAc@hAy@pBe@bAa@|@MXYl@Wf@_@x@}@hBe@`AoAjC{@tAiC`GqAtCWh@ABMVWn@IPwA`D}AnDWl@kBlEM\GJwCnHIP[v@IRQd@[v@eInTQd@EL]|@]|@]|@IRg@tAM^?@Ul@e@nA[z@ABYv@KZe@lAe@pAO`@u@pBQd@e@pAu@rBQd@O^e@pAa@lA]`ACFs@fBABGPELITGNCHELe@fAoGnOmAlCUh@Yp@g@fAgAbCSd@Ud@w@`Bg@dAYj@y@`BMVKTu@xAoBrDoAbCq@lAaAhBaAjBKRMTU`@Yl@o@pAg@bAWb@e@z@k@jAS`@</points>
    </polyline>
    <duration>
     <value>520</value>
     <text>9 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-40 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>15107</value>
     <text>9.4 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.4846502</lat>
     <lng>-97.7559067</lng>
    </start_location>
    <end_location>
     <lat>35.5008876</lat>
     <lng>-97.8963328</lng>
    </end_location>
    <polyline>
     <points>arqwEl}ssQQ\m@rAIN]p@]t@c@|@Sb@}@jBS`@?@y@dBCFQ`@Sb@A@Uj@y@fBWl@EJCFGPA@ADUf@y@pBa@|@yAhDkBhEIPaA~Be@jA[x@wAnDSf@Qd@Qd@qCjHITM^MZeAxCKZyA~DgAtCqB~FgAxCGPIROd@Ul@m@`Ba@jA_AfCk@~AGR}@bCITAB{@~BYz@a@dAUp@_DxIQd@a@lAgAvCwA`EO`@ABo@hBo@lBm@nBk@nBi@nBUx@Sv@g@rBg@tBc@nBc@xB]rBYfBEP]tBG`@If@Ij@c@jDIh@Gd@]jDYzCq@~JCp@ANC^KpBIdCGdCCzAEtBAjB?bCAxJ?|A?j@?fGAlIAnFAvE?x@ApD?f@?N?l@@xD?fF?jAAbA?rB?bB?r@AxI?tA?`@?vBA|C?nJ?XApC@hCBpI?H@vBDlD?h@@fA@`@BpB@vA@vA@x@@hAF|EFrE?FDnDF|EN|MHvFJjIJ`J@j@@j@?XHxGNpL@vA@bABjAB`B?f@@x@@j@BbB?f@FjFBjC@b@?BJzIDdCJ~IFdFHxGBjC?J@L?L?L?b@@hC?zD?rDC~CA`BAn@Az@Ar@?r@Ab@Aj@At@C`A?DC|@CdAAZEdBGtB?NGzBGvB?BI~CCbAGzBKpDQbICf@EzACp@I|CCnACh@QvHG`BEpA?PAF?NEzA?DCbAAf@QvGObGALMfFAXMxFAjA?F?F?HE|C?D?J?VAhAAvCAbD?fD?nB@f@?h@@fA@nBB~A@nA?d@@R@~@@RBfAF`CFbC?F@`@@h@TvGRbG@RFhBDzADvA?JDdAB~@BnAF|BDlD</points>
    </polyline>
    <duration>
     <value>417</value>
     <text>7 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-40 W&lt;/b&gt;</html_instructions>
    <distance>
     <value>13195</value>
     <text>8.2 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.5008876</lat>
     <lng>-97.8963328</lng>
    </start_location>
    <end_location>
     <lat>35.0978089</lat>
     <lng>-106.7231231</lng>
    </end_location>
    <polyline>
     <points>qwtwE`kotQFtC@j@@x@BjC@n@@~@@nB?^@nC@rB?jA?dA?~@A~C?vB?b@?d@?l@AjAApAInDGlE_@|OA\UxIALGjBAr@Ct@E|ACbAAlAAb@Ah@?NCxACnCAv@?V?\?Z?ZAZ?^?\?X?\?Z?\?pB@~GBnG?rB?bD@dD?hCBzF?\?f@AdA@hD?bG?xA?lK?`C@vA?j@?b@?Z?X?fC?vA?lC?lA?l@?jA?lJ@fD?`C?l@@bG?nB?h@?`@?xD?z@?`D?@?JAt@?|A?T?xB?hB?nA@fB?t@?d@?l@?j@?pA?rC?H@H?X?vB?P?b@?H?l@?j@?D?f@?l@?dA@dA?bA?|@?VA|A?t@ExBA^A\Cn@Ab@ABA`@Cb@G|@En@C`@Gj@?BGt@CVIp@EZANK~@SrAMz@Mt@Mn@Mn@I`@[zAS~@Of@Qp@CJYbA}@dDGRuD~M{@~CaAlDY~@_AfD_@vAg@fBeAxD}AvFUx@Sr@o@zBGVSr@_@rAg@dBADMf@ELIXm@zBy@rCQp@K^CHELu@pCsAzEWz@?@ENW~@EN?@KZERKZk@pBw@tCQp@Qn@]rAMj@I\U`AYpAQx@I\Kh@[`B]fBOx@WdBKj@Gb@AFMv@Kx@SxAIj@OlAMlACVK`AI|@I|@MvAGt@Iz@QjCKrAIlAOnBUhCKnAYfDOvAObBGl@Gj@UtBWhCUjBK~@MjAY~BQpAIh@Eb@Gd@UdBYnB_@jCWhBOz@SxAk@pDs@bEG^]jBg@vC]lBOv@a@rBYtAADi@nC_@fBI`@Mj@[vAADm@lCYrA_@~AKb@K`@U`AIXc@fBq@lCg@nBAF]nAe@fBSr@iB`HeA~D_@tAq@fCIXg@nBm@zBQl@Ol@_@vAs@lCADMb@ADgA`Em@~BCH]tAe@dBs@jCeA`Eu@pCSr@[nAeA|DK`@St@c@~Aa@zASv@Mb@i@tBYdACHk@tB_@zA[fAKb@Ql@g@lBOj@s@jCU|@m@|B{@`D]nAMf@}@jD_AhDGTc@dBqAzEe@fBoAxE[lA]rA[hACJUz@Sz@Sz@SbAGXKd@ETI`@Kj@Ih@Kv@O`ACNIn@KbAK~@I|@E\ALI`AGfAG`AGvAGrAAx@C~@CxA?tB?b@?D?`B?xB?`B?vB?bA?bE@nB?bE?rC?`F?H?hA?rL@|L?p@?hE?pC?rF@|J?xA?xC?zA@zJ?bD?lF?jBBny@?jC@xK?fT@lF?bA@tA?|ABxC?bA@j@@|B@|@@z@@z@@vBBxBBxAFbDHdFFbCBlABzABx@FvBHfDLrENnJBvCBvABzEBdIApD?jB?t@AtBAlBAnAC|CEfC?@C`B?b@EhBAx@C|@?JSzHIzDMjGMzIAjACzAAz@AdBEdF?L?PAxCA|A?f@AbB?|B?|A?vA?Z?j@?jA?`A?`C?`A?j@@l@?dM@|E?j@?dH?rB?lE?bA?vAA^?b@?j@?b@CpDAp@Aj@CdC?@CzB?DExCIhEOxEAj@Aj@GvBEvAIbCKnDGbCAHIdDEvAAHErAKhD?HEpAStHOtE?HKtDEhAE`BCf@MjFIpDKxFCtBElD?~B?fBArB?bC@|A@~B@zABfCDjD?@@P?V@TBvABbA@`AF`C@VBl@FdCPjFLlDHhCd@nOLnDLnEDbBBj@HpCFlBTxHDxAFnBHxCHnD@f@?BH`ED`E@dA?TBtBBzC@dB@xE@vD@bJA|BBpR?j@?j@?d@?vA?vA?vA@vA?`@?nC@bG?j@?D?vA?fG@xA?f@?B?f@?B?lF@zC?bC@hG?Z?Z?N?F?X@fG?pDDre@?dC@nD?pD?zE@`@?~DA|BCzCCjAIdEOrEIrAAVGhAKdBEj@Et@M|AMtAGz@UvBCVEb@OpAQxASvAQtAWtBSxAYtBWtBWnBSvAQvAYrBQvAQtA_@rCUbB{@vGETOjAOhAMfACNM|@aApHOjAS~Ac@jDc@hDStAQtAOlAIj@SzACT]lCGb@ALObAIj@YtBY~Bc@jDg@zDQlA_@xCWnB[|BOnA_@rCe@nDOjAaAjHGh@Ij@Gh@EZIj@Ih@Gj@Ih@Gh@Gd@ADQnA?BE\CLGf@?@QtAIh@CPAJALM|@SvA?FCJE\OdAMfACL_@tCIp@Gb@SzAIr@YtBKz@StAMbACPK~@In@Eb@E\ARAHE`@C^Ef@ANC^A\Ev@?JEt@AXA~@CxA?v@?\?zA@^?^@t@@@@r@Bh@HfB@PHxALvADZH|@PxAN|@BVTrAPz@FXDRH`@\xAHZPr@^rATr@J\Vr@Vr@JXLXLZLXLXJVx@`Bl@pA~CpG`EfI@@pCvFrCxFVh@bBjDx@`Bd@~@Td@Td@NXLVZl@LVHNRd@DFFNZl@bArBj@jAv@zAZn@BFNZFJv@|A`ApB`AlBz@`BnDhHzAzCt@|ATb@jBxDhAzBn@rA`@~@f@lAd@hAb@nABDNf@Pb@?@J^Nf@JXZfAFR\pAZrAPv@BHDV@DDNNv@X~APhAJr@F^R|ANtAD^BXB\BXFz@Fz@F~@?B?B@PDz@Dv@@`@Bv@@f@DjC?zCAvAAx@Av@A^Ar@Cb@AZCv@CZA\Gt@C\ARAHC^ATCTEb@AFGl@Iz@Iv@?@SrA?DMx@CTCJQfAGf@A@Mz@CJUrAIj@G\Mt@Ih@i@hDi@fDKj@Ij@_AzFIh@}AzJUrAIh@_CzNs@pEu@rEW~AoA|Hu@zEIh@UrA_@|BaAhGG`@CPKr@StAM~@i@tE]vDW~CKpBK|AGpACb@Cn@Af@Cn@Cn@Cv@ErBAR?V?r@C|B?XAhB?j@?B?j@?fDAtF?lE?|AAtI?l@?rE?r@?F?~A?z@ApC?`J?j@?vB?hB?`D?xAAnD?pB?P?~A?|EApA@pDAtD?R?B?hC?b@?~@?dC?`@?t@?xA?vA?l@?j@?b@AdC?~A?d@?bC?rDAtH?F?H?`@?nE?D?H?t@?lA?l@?nA?r@Av@?lA?nK?nA?lB?`@AvA?nA?t@?nC?V?bB?pGA|P?hG?j@?@?|@Cp_@?nD?@?nE?tA?@?h@?j@?z@?j@?vAAxA?bC?dA?PAbC?\CxEGlF?BKjH?DEnBC~@?\GvBAXE~ASlHCj@Aj@?BCxAGvDCrC?xB?xB?xA?|@@\?L@|@?l@D`CBhBD`B?NF~BL~EBj@@x@DfBFlD@P?\DlD@z@?@BpCBzC@pE@|@?x@?hA?Z?rC?Z?N?fA?|@?h@?xA?j@AdN?j@?dC?nD?@?dAAlF?@?rH?nDAzE?jD?@?lD?@?zDAlL?xA?zAAv`@?j@?dC?HAxBAbC?j@?j@AbAAvA?vAAlAAv@CzCARChCCzBEpBEzCCtA?FChB?bAA~@AlA?hAAx@?|B?nD@pC@rB@f@?l@?NBbC@ZDrDFzEH~I?`@BlC@fC@hF?bK?rN?bAAnF?dE?V?j@?Z?R?~@?`C?vA?tA?pL?vB?hHA~A?@?zE?l@Ajh@?jD?rD?V?vC?fD?vCAfJ?nGAj_@?lNArB?h]?zHAzH?tE?rJ?fP?f@A`@@R?hAAbA?rB?zC?~D?L?dS?dCAvF?Z?lBAvB?TA`CA`BExBC~AEbCGnBMlECr@ALE`AKbCA\Ez@MrBALKtBOvBM|A_@xEw@rIo@`G[zBGh@In@YxBQdAWlBc@pCOx@Mt@Kh@CNMz@Mr@]rBWvACPCPs@dEOv@G`@aClNOx@Mx@Oz@UvAOt@Mz@SfAYfBe@pCs@~Di@dDw@hFKt@SxASzAUvB_@`DU`COxAIjAKhAKtA[pEOlCMnCKbCE`AKvDInCEvCC~CApBArG?jF?Z?zA@`C?nA?x@Az@@jD?D?j@?L?zB?@?\?nA?nB@vF?xB?H?pF?v@?@?`A?~@?hE?R@|D?`F?dJ?dA@`K?|A?V?~@?vB?pD?B?d@?l@?p@?lF@xC?jA?pC?bN?tC?b@A`@@fA?pB?rC?l@?n@?t@?n@?t@?J?bD?nD?l@?j@?~A?rD?^?^?x@?~@?nB?DAxC?nC?|A?`B?`@?F?b@?L?lC?hA?jB?`E?nBA`S?\?lE?hA?fM?bLAnC?xI?zH?~F?pF?lH?vE?fNAvC?zB?zI?`B?|D?rF?p@?^?J?X?D@f@?hC?J?^?j@?bB?jA?J?^?F?|A?fG@hI?~C?lE?B?F?Z?j@?z@?jA?J?`@?J?j@?nD?dA?L?`@?^?@?V?@?j@?h@?j@?j@?`@?^?n@?R?j@?T?@?Z?D?b@?@?L?B?T?P?@?J?^?z@?X?Z?v@?x@?b@?t@?tA?nA?tA?jA?@?x@?f@?f@?hA?P?bA?nE@pA?R?~@?zA?~A?bA?x@?jA?J?~A?bD?P?X?Z@xD?V?pA?l@?X?X?bB?@?N?zA?xA?bE?xA?R?tB@zE?t@?`@?rC?nB?BAd@?fD@vI?N?h@?J?`@?vA?dA?@?D?^?h@?t@?hI?dC?x@?xF@zC?vA?V?z@?J@nA@x@BlBBhA?FBx@Bt@Br@@JJjB@LFl@Hz@@HPrANbAJh@F`@VjAXfAZjAVt@Xx@`@dAh@lAh@fAdAlBrA|BxA`Cn@fA`@p@vAzBf@x@h@~@jBxC\l@j@~@DJZf@r@jA`@n@pAvBbA|AJLX`@NTp@~@LNFJFFJJPRHHXXt@v@lAfANNp@n@|@x@r@p@fA~@JJj@h@j@f@l@h@t@l@v@l@`Av@jAbAp@n@PPDDj@n@`@d@j@r@`@h@RZFJDDJPNVXh@BBXj@LTRf@P`@LZd@pA`@pAPl@FV`@jBZ~AJp@Jv@Hv@LrADn@FfBBlA@~@?~@?|B@jE?`B?|E?~A?dB?bA?vA?P?rB?pC?\?zC?`B?tA?dA?zB?n@?pA?rA?F?b@?p@?d@?^@J?dA?P@j@?~@@hABdA?L@j@?HBlABvABb@@l@?DBf@B~@PfE@NLpBHvAFx@@XDj@JrAPpB@FRzBNpBDh@HhANzABf@TtC@DP`CFdAFlB?H@H@Z?B?PBv@@l@?n@?rA@DCjCAvBCj@EzAE|@Et@Ev@ATGj@?BC`@OzAEh@CRCZMpAEj@ADS~BMpACZAJGf@C`@KlAc@xECRATE\ARQpB?BIx@?BGr@Ef@Gz@AJ?@MhBEp@Ev@ADEr@Ev@El@AVC`@AP?PAF?BEjAAPCdACd@?LG`B?ZAV?R?D?DCpAA|@?ZAP?@?NAfBAfD?\?vD?bAAdE?j@?pB?tBAdD?j@?j@?r@?b@?j@?l@?tA?pA?FAnF?xJ?lAAnC?zEAlH?zF?xCAj@?b@?F?j@?h@?l@?vA?P?ZAtE?hC?^?|EAfG?x@AnH?`F?j@?vA?bCAj@?j@?@?j@?xFAnJ?j@?bC?dC?j@AbB?bD?l@?fEAfG?pFArB?`@?tC?t@?zEAjB?jB?vA?vDA~A?vA?\?tDAd@?xC?VAbD?dDEbb@?j@AhG?vACxVAdD?j@CfYAP?|C?dC?vAAzE?|EAhRAhG?`JAlVAtH?tGJ`GHtCR|EVhEB`@JzAd@|E`@vDl@dFx@vFbAdGl@hDp@vDDXNt@Hb@TxAH`@@FLt@TrAJh@Lx@FXBJPfAF\FZN|@@DHb@TxAJf@d@pCP`ATtAz@`F\nB\tB^rBXbBRfAj@jD@FHh@b@lCd@hDBPTlBF`@TpBLxALlALzAFv@B^@@HnAHjAFpAH~AJtBF`BFlBDrBDpD@~@?d@@j@?H?`@?j@?j@?j@?B?fA?x@?vA?J?^?B?f@?l@?V?vA?B?N?bA?F?n@?`@?F?z@?^?^?t@?`B?H?L?lB?~B?J?vB?P?pB?pB?B?jAAtC?|@?dA?X?B?R?h@?d@?T?R?fBAxC?R?V?xC?T?j@?j@?j@?N?\?p@?J?j@?j@?v@?^?z@?hA?N?|@?bA?tB?P?xBAjH?P?zG?bA?nB?fA?dB?x@?`A?z@ArA?Z@h@A~A?H?P?X?P?~@?fB?z@?dA?z@?bA?|@?z@?vA?dA?@?j@?j@?xA?|C?p@AbE?bC?j@?nD?rI?z@?fG?`J?j@?dC?tA?j@AtE?r@?vC?nB?nD?h@?@?l@?r@?bB?xA?bB?dA?\?n@?fC?dBA`A?v@?~B?lA?xA@xC@|@@x@BpA@hAJbDFhAPzDHjALlBNhBNdBNtALjATfBHh@Hl@pBvLBLDNTfABFNp@DRFVDPFVBFRx@h@nBFR\nAJ^Z~@Rn@Vv@Tp@Vt@Vt@r@nBf@pAn@hBnAfD^fAfBvEJXp@hBRl@b@lAb@jAPb@?@xA~Dr@nB~BlG?@Pd@Tn@fAvCnDvJhBbFb@jA`DxInCpH^dAJXZx@FPFRb@jA|ClIRl@~@fCr@nBr@nB~@fCb@jAj@zAb@lAl@bBx@fCt@fCRx@Rt@H^H\Nn@Px@FZF\P~@@DBRF\Jr@Hh@Jp@Fh@BRHr@Hx@Hz@D\F~@Ft@@TDd@D|@FzAHtCBv@?Z@x@?|@?\AvB?f@Ar@Cx@?NAj@Cn@IpCEdACd@OxEGbBAf@Cf@ExAA\C`@Af@GbBI|B?FA^?DATATE`BCv@AjAAHCfB?N?@AnA?H?`AA~@?pB@tBDxC@l@DfC@\D|A?NJtCNzB?HB^HpAX~EBRJjA@JJhAJhAJ|@Dd@D^Hn@V`CNjAFn@Hh@^jDXfCb@xDb@~DNfA?@l@pFBZHh@RlBJ|@BTPzAL|@Jx@NrAZjC@?NrANtABNJbAFh@D\Ht@F`@LrAHj@BTHx@Hz@JdABRJx@Fr@DXb@zD@PNpAFj@BRX~BJfA@BBTFh@BV?@BNDZHx@Jz@R~AFj@?DBNFl@Hh@@JJt@PtAF^BTHh@RrANz@FXLz@`@pBPz@P~@DPZtANn@Jd@Pt@\tAJ^^pAZhATt@J\`@pAJZVv@JXPf@t@rBd@lAXt@Xr@t@dBf@hAh@jAZn@NZf@bAP^Zj@n@lAf@|@r@jA^l@^l@^j@NVv@nAHL`@j@`@j@`@j@`@j@b@j@`@j@`@h@`@h@r@`A`@h@b@j@r@`A`@h@T\JLbAvAj@x@T\`@n@^j@t@lAr@nAz@zA?@FJVf@jAzBfA~Bj@pADHv@jB`A~BrAvDVt@^hA@Dn@pBr@bCr@fCzB~J\`Bb@hCFZRjAXpBPnARxAJdAFd@?@Fh@VbCNbBNjB?JHhADl@L|BDx@FvA@^JnCD~B@l@?V@l@@x@?f@@tA?|A?vE?tB?p@?pB?v@?j@?r@AhD?p@?xE?xE?B?f@?zA?f@?bC?hCA|K?V?p@?xI?j@Al@?j@?bA?V?lB?@?h@?f@?tB?l@?pA?~B?`B?dC?T?`A?J?jAAN?`C?jA?`@?`A?hB?lB?r@?`A?x@AjH?F?j@?fL?vDAjB@pDAxH?~FAdM?nJ@T?VAx@?nI?fTAzB?fCAnZ?tE?vE?xG?jE?fG?B?f@?B?jEAhN?vK?F?vEA|L?|A?hA?L?t@?nA?j@?@?rC?J?N?Z?N?fA?dA?tA?h@?rH?nBA|C?R?j@?nD?R?V?dC?j@?j@?j@?R?jB?pB?t@?N?j@?xA?x@?hA?rB?NApG@`B?vA@X?`@@r@BfA@PBbAFvA@RDx@HpAJjALvAFj@Fh@Jz@LbAPlAZnBNv@TlAPx@R|@Nj@\tAZlA^jA^lAJZL^Ph@L^DJBHDJx@jCVx@^fA@BPf@BLt@zBvBxGjAjD`@rAXv@pAbEFLjApDNb@?@|@pCb@nAdAdDnAxDTp@HVBH\fATp@dA`Db@nAVr@b@nAPd@Pd@DJn@`BVn@\t@d@jAXn@Xn@Vj@R`@bAtBP\h@fAx@|AZj@^r@Xd@BDlAtB|@xATZ?@\h@n@`A`AvAhA~AFFd@n@\d@X\l@v@x@bAHLNN~@fA~@hA\`@VZ@@`@f@zAfB@@VZpAzAVXZ^jAtAnAzAlFjGhBvBt@|@fBtBpDhEz@bAZ\nAxAtA`B`CrCfApAzAfBbAjAv@~@xAdBl@r@b@h@HHdAlA?@tA~AfArA@?PRpDhEbBpBnAxAp@x@hBtBx@`AjBzBf@l@LNxAfBr@z@b@j@bAtA`ApArAnB~@vA`A|A|@|A`@n@v@vAdAjBhAxBv@|AbAzBlBlEhAnC@B@BJVRf@f@pAh@`BDJHTJ\DNFN?BJVTv@Rp@FR@BL`@FVHVFNNd@Pn@Rt@DPRt@BHRv@T~@DR@@Jd@J`@Pv@BLRx@XxAXpARfAj@vCp@nE\lCVrBNx@ZlCb@lDJ`ANhAFh@BXb@lDLdAXfCL`AVzB\vCLfAL~@XzB`@`DF\NlAV`BLx@`@`CNt@^rBP|@XpAXtAXlARx@Pv@l@`CV|@V|@XdAb@vA\dAX~@Z`AZ|@Rj@v@|B^~@|A|DP`@x@pBx@dBRb@LV|BrEzCfGJRHL|A|ClIfPT`@Tb@@B|@fBR`@fC`FbFxJTb@R`@@@zCbGv@|ArAjCzBjE@?bArBb@|@\p@Pb@N\dB~Dd@nAFNr@hBf@zABHh@~ATz@L^Lb@Rt@Nf@f@hBLd@v@bDn@tCTfA^pBZdBj@lDx@`Gb@`E^nEH`ADj@HpAF`AJpBN|DFzBB`ABdB@xA@tA@dCAnO@|E?zE?rF?pH?fE?r@?fD?|E?dY?zE?pJ?dA?hG?hR?j@?xB?zF?T?~F?dF?j@?|G?XA~BCj@C`ACr@CbAKdBGjAMvAKhAKjAUfBa@zCWrAALG\Qv@Ox@YlA_@|AgAfE]nAMf@m@xB}@jDi@rBW`AW~@s@tC_@xAi@xBYzAKh@SjAQjAIj@QfASrAGh@Kt@[hCU`CKlAYnDGlAMhCK|BCbAEzAAt@AzBA|A?pA?~A@lBFjCD~AFvB@NPtD@H@TJ~ANdBJhAH`APxAFf@Hz@T~ABTHj@T|Ab@fCd@dCLp@R|@`@hBbA~DLb@d@bB`A~Cx@dCNf@p@tBDJHXt@jCf@nBLj@Nn@BJTjAP`AVxANbAVdBBXFf@TrBPrBFbAFbAHfB@FFbBBvA@nA@dA?N?@?j@@zC@nQ?^?~@?j@?dC@x@?Z?N?X?R?`CBt^?@?j@@fG?n@Bdd@?B?@?l@?|B?D@rC?`J?T?j@?H?xB?j@?j@@z@?hB?dC?J?`@?H?jA@nD?zD?jA?@?H?j@@xB?v@?j@?L?lE?j@?lA?nD?j@?H?`@?hG?F?P@X?j@?nA?xC?`A?jC@rH?l@?hD?|A?j@?bG?B?f@?B@jK?f@?nD?dN?xA@bC?@?j@?vE?bJ?fA?dEJbIBdANjC@RLjB@DDd@Df@LxANnANlAN`ABNHh@@DHb@Nz@DVTjAZvADPJb@FXHVDNJ^`@vAH\Tr@Tr@DJFPHVJZ@Bh@xALXFPHRRd@j@tAp@tADHTb@HN`@t@d@z@\l@DFd@t@`@l@l@|@JLLR\d@RVX\PTBDRTJJNPdAjA|@~@j@l@rBtB|@~@VVpCvCxA|At@t@rArApBrBp@r@lDrD~GdH|A`BrCvCVVNNf@h@|@~@v@v@dAfAf@h@fChC@BVVBB\\hBjBrAvAfBhB~AbBjBnB|A~AzB|Bd@d@b@d@lBpBZZvAxATTt@v@v@x@f@h@j@j@ZZVX@@ZZXXt@t@?@v@v@v@v@t@x@v@v@pAtArArAf@h@RRj@l@JJ|A~Ah@j@@@vBzBNPv@v@XZnBpB`BbBv@x@|A~Az@~@fAjAh@f@DDNNd@f@@@`@`@NPXX^`@VX^b@\`@b@j@FJl@v@\d@NTn@~@FJXb@V`@PZ@BRZ\n@PZR`@n@nANZ`AxBLXp@fBVn@@F`@nAt@zB`@xA`@fBRx@l@rCNbAP`AJj@LbAF\Hl@@HNvAD^B\PpBD`@BX?DFz@?DDn@@`@Bb@Bt@@`@@\Bt@@^?Z@X?~@@\?|@?|@?v@?z@?pG?`@?rA?zA?p@?`A?N?j@?j@?r@?rA?`A?z@?n@?J?^?XApD?z@?rE?tD?~J?fB?pB?xA?pD?jF?@?h@?j@?`A?bA?P?X?f@?vA?B?j@?h@?l@?jA?bB?j@?~@?Z?|A?hG?|AAx@?x@?vA?`AAzA?v@?FAfBA`BAz@ApAC|C?TA`ACxACzAErCAvAC|@CtBExBEtA?LCj@A|@C|@EvACr@?BAf@EnAEnACdAC|@ANAj@E|@An@Cf@EbAIhDMfFCrAAj@Aj@ChAAfBCnA?FAtA?t@At@?T?nBAV?R?P?B?X?`@@|@?j@?D@|B?^?JBnD?T@f@BrB@n@BlB@PBzADnBFdCFpBJlDDlAF|ABjAHnCFrAD`BDdCDtABvA?PJbFFnE@x@@j@@nABtB@vABbCBnD@pC@lA?fA?jC@bC?v@?|@?fB?hB?F?pC?lI?~@?j@?|@?xA?bC?bC?nB?R?`D?x@?l@?fD?F?rH?nQ?d@?zC?bA?d@@~L?lB?zD?d@?xD?d@CdS@bG?pB?H?dD?x@?z@?V?nE?xA?zA?nH?fC?j@@`C?n@@b@@v@@\@H?LBd@@\BZF|@Ft@D`@Fh@Hl@F^BN@HH^?DLj@Lj@Lh@J`@Lf@Nb@@HPh@Vt@HRDLd@fALXTh@Zr@P^N^JRTh@d@dA`CnFr@~AvCtGrClGBDbA|BnArCv@fBdCvF@BXp@Zn@Xl@Zt@Zp@h@pAz@nB@B^x@HPHRZr@LVf@jADJRd@Zr@h@hAh@nAd@bAHNHTHNHRBFBDlAnCdA~Br@`BXp@^t@`AxBv@fBJVXn@\t@v@dBn@vAFLHP@BRd@Tf@Xn@JVN\BDRd@x@fBPb@b@`An@vADHLX@Bx@hBDJLV?@BDf@hA@BXl@h@lAt@bBd@dALV?@l@rAh@hAd@fAJVZp@h@jAZp@\t@Xj@DJTb@?@R^Vf@R^JRZl@LV\l@@BLTpAzBj@~@NTpB~Cn@`ApB`DjBtCl@~@V`@`BfCn@bA`@n@x@nAxA|Bl@`A\f@|DfGdCxDxBfDt@hA`@n@\h@n@`ADFdBlCHNHJbIbMR\z@rAdA~AJPzAdCn@hAhAtB^t@fAvBx@bBfA~Bj@nArBtERb@vBzEf@fApAvCx@hBf@hAHRbBrDnArC\t@n@tAt@dBNZvBxERd@JTfDrHzC|GjAhCbCpFnArCFL~AnDN\Vf@N\Xp@j@lAdAbCpBlE~@rBhB`EzDzIj@lApArCnArCbBvDj@rA~CbHxA|CFJVf@Zl@R^PZT`@`@r@t@nA@Bl@`Aj@~@Vd@f@x@~@tAXb@lAfB\f@f@r@\d@|A|BX`@\f@d@n@PR`@f@~AhBRTz@z@\XFFn@h@VTt@n@@@~@v@r@j@t@j@tBbBjFhEB@XT@B`@Zl@d@v@n@~BjBz@p@@@XT@@@@dAx@NL\X@@\Vh@b@XTRP\VtBdBrEpDf@b@hA~@hAz@b@^rDvClA`AtAhAlCvBbBrA~@r@dBnArA`A|@l@`@XbAp@DB?@TLf@Zj@^~@h@z@f@vAt@RLDB@?`Bx@B@vBbAr@\FBdBt@dBr@t@Z`@NxAh@pBt@xAf@fBn@D@|Bn@tCx@dCn@lAXz@R~Bb@nAVfHxA|ObDtAXrCl@~A\h@Jb@J~@R|MnCjCj@|Bd@RD|@R`Cd@TFdARfAT@?VFlSfEJ@vAZdAR`@J|Bd@jCh@fB^bB\bATbB\h@Lj@Lr@LjGrAbAPr@NnAV~Bf@zGtAnE~@rAVlB`@bB\F@`B\vDv@xBd@d@Jt@NzA\\HfAV^J^Jr@T~@Xf@NbA\XJl@Tf@PTJn@V^NdAf@t@ZbAf@`Bz@zAx@`Aj@v@d@dAp@lAx@lA|@~@r@t@l@|@r@b@`@|@v@r@p@t@r@`B`B@@|@~@x@~@DFb@f@|@jAf@l@DF|ClEdA`BdA`Bf@x@p@lAFHDHFNFHb@z@j@fArBjEj@rADLJVDJZv@Tj@Pd@pAzDv@bCv@jC`@~AZfAx@lDJd@Pz@R~@d@dCX`BPfAL|@T`BRlBb@~D@FT~CPfCR`EPfFHtDBrD?r@?tAAzO?R?t@AbOAjJAnP?j@AxI?~L?j@?j@Aj@?~NAlJ?rD?j@AfH?nC?j@ArH?PA~YAfC?f@?bEC|[?bNC|[AxY?xC?`A?bC?vA@xABrCFpEDrCDrA@d@@bABn@DtADvADhAJjCLtCLpCNrCZ|ER`DXlDPvBXlDRtB^nDNvAZlCTrBVrBj@jEf@jDZrBVvAJz@PlAXzATrA\rBTlALp@Ln@j@tCZtAf@dCl@pCb@lBv@dDXjAz@fDnAzEjA`EdAjDX~@dBlFBH~@tCzAhE@BxBbG~B`GvAlDz@nBz@pBv@dBXn@v@`Bv@dBp@xAx@fB`AtBfA~BbA|BzB|EpAnClDvHhAfCRb@b@`AVf@d@bAj@pAjB~DrCbGx@fBJV\r@@Bn@xAJTx@hBdCnFz@hBfB~Db@`ABBtClGVj@bFtKnD~HdAzBP^Tf@nAlClAhCnCdG|@lBZp@P`@Rb@bBrDPd@|ArD@BN\Rf@d@pAr@nBn@bBbB~EL`@pAbEfAzDx@`D@D\pAJ`@Lf@^zAb@nBXpAz@lENn@Fb@Jh@|@hFN~@T`Bd@fDdAnIPxAPdBHz@PjB@PL|AHz@VnDT|D@FJzBBd@JlC?@@R?PBz@VtNFvD?`A?nE?F?b@?|E?lD?@?|F?zF?V?tG?tD?nA?vF?|MBpLBhFDhFJrI@lAXhOFvCFnB@h@NfGBjAVrGHtB?JHlBL|C@JZ~Gl@tLDj@D|@HrAL`CFvAL`CZdGh@hKFfAt@xNvBfb@V|EBd@Bl@D~@@VDj@Dx@Dz@FvAJbCHxBLnDHnBVhJB^?RJzEH~CFtCFlD@x@DbDFfEBdDD`GDrK?tFAj[C`O?dC?f@?r@AzB@lJ?F?B?PA|A?fB?B?pB?tB?^AfG?zA?XAhFAxC?jKAvWChH?hH?zC?xPA|T?zC?j@AfG?xFAzE?vA?j@CnZ?|AAtM?F?|D?dAAvC?|B?vB?nA?xBAtF?nB?bE?F?pB?b@A`CAxA?v@AvBCbCK`F_@tOElAGbBKnBOxCGnAEbACZEr@IlAIvAGx@CZEj@Ej@ARCRQ`CS`CS~BEb@MjAU`CQdBS~ASdBQbBE^uAtLoAtKqB|PGj@y@hHIj@cB`OY|BW|Bc@fE]tDUpC]rEOrBI~ACTAXK~AIzAGxAMzCIlCIfCCl@Al@EfCEvB?BAt@A`BCjB?dAAx@?l@?D?`B?tA?b@@tCBpB@vAB|A?\HtDF|BD~A@j@@BDnAFdBFzAJvBNrCLjB?@JbBRvCd@lGb@fGZpERfCJbBXrDBZVjDDh@JrADh@vD`i@Dj@?BpBtXVjDVzDL~AXdEVdDVhDf@lHHjAF~@Dl@Dv@@HBd@LlBNnCRfEJzBD|@FrBLdDR~GLhEBz@@t@H`EBjBBrBBvA@rADxF@jF?hG?h@?B@|E?jD?b@?lU@jD?fG?zA?hF?b@?dI@xS?\?~D?B?rA?fC?J?rA@pH?bJ?vA?@?d@?p@?D@hY?T?T?l@?j@?l@?|B@vO@dK?j@?j@?nD?|@?|C?bC@nD?bF?nD?j@?hA?x@?j@@bC?~K?V?zE?@?~A@zB?`O?`I?vA?j@@vA?vA?nD?B?f@?nD?nA?@?|A?j@?b@?j@?NA~N?H?`@?bC?H?`@?`B?`@?|B?vOAnD?F?b@?t@?tI?vA?bC?F?bA?J?nD?F?b@?H?`@?`BAtE?rA?H?`@?H?rD?jBAD?dB?jF?`D?pA?R?Z?D?H?`@?H?j@?J?L?n@@h@?j@?P?X?h@?@?P?J?L?j@?h@@bC?dC?jD?~E?d@?D?rA?xA?jD?p@?pD?h@?j@?`CAxA?`B?r@?`C?Z?~A?X?`B?D?X?J?|E?B?hE?nC?\?rCAj@?X?P?|I?dC?|@?jF?nC?rA?bB?lA?r@?vB?n@A`G?D?j@?R?nB?d@?p@?`E?tA?hC?pF?hG?|C?tCApH?~C?tC?F?P?`E?F?fO?D?N?T?D?rQAfE?xE?`@?xB?RAz@?rB?nD?j@?`E?r@?hB?Z?@?L?jA?pA?|@?dR?fHAjD?~A?vF?tB?z@?L?`C?rA?vC?hB?bB?P?rG?f@?bTAjC?p@?~I?n@?~E?zD?`AAt@?zK?lC@zBAnC?p@?zA?dC?l@?p@?rA?|B?|F?zD?fC?~B?jC?zA?hAAxB?t@?zD?nB?nH?|@?d@?lA?dA@xA?rCAV?d@?`D?D?X?B?BAl@?@?b@?L?bA?p@?j@?h@?B?b@?D?rA?pB?nC?H?j@?\?fB?jC?nB?dD?vF?XAX?tC?xD?F?bF?fB?Z?rB?xA?j@?\?jF?PAzC?j@@nBAlC?rA?zD?rB?zD?D@~E?dB?lB?tB?|@?T@`F?|@@fB?tA?BApB?lC?nB?pB?rB?fA?|A?zA?D?~C?|A?hB?nB?x@?v@?l@?~CAr@?rB?r@?hE?hC?~@?pA?\?dB?B?d@?lB?d@?\?~@?j@?bA?Z?N?nA?|@?rA?nB?z@?h@?J?pB?bE?xC?fA?~@?hA?fA?lAKlFAP?HCf@C^Cl@CR?HCX?FAPCPAHC`@Eh@CXE\CZA@Gj@CXCNAHCXAFCPE\Kp@QnAG`@CLKp@CRE\ETE\EXEXEVEZEXEVCRADMz@OfAAJGb@ADCREVCPEVAJGZ?@Ih@?BCNCVABEZAHIh@Gb@ADG`@AFCREVKr@AFEXSpAANG^Gd@G\Gj@GZG`@AHIn@QlACPMz@_@dCg@fDi@vDGh@CJCPAJc@zCg@jDCNgAbIc@zCY~BQnBIhAOxBAHInACf@InC?HCjACrC?t@@fA@z@BlBDhBB`@FnAFbABl@PlCJ`BRfDJtANdCHnAJdBHnABh@JvAL|BN~B^bGDf@HrAHtAF~@BVLrBHvAJ`BDt@JvAHrAP|CFr@Dv@@TDd@Dp@JlBFz@J~AJhBV|DDh@PbCDr@T|CP`CRdCZlEVvDRdCThDLzAHlAP|B?BP`CLdBHfALjBPxBPhCJxAJzA\pEB`@NlBNpBDl@HhAFx@Dp@Db@JfBHtABn@?DFpBB~@BhA@hB?lA?b@?fB?fA?F?zB?j@?N?lB?|C?nB?N?~C?X?lB?vE?hA?`C?tE?TAtEAbD?hB?V?RAnBAhBAbCAjBArB?L?pA?jBAbB?~C?~@?j@?lAA|D?vE?l@?zD?xD?vC?~D?vN?xM?~M?bR?hF?~H?dH?~H?bL?|DAxH?nC?nA?jA?v@?vA?lA?t@?Z?|E?bB?bA?dA?rC?d@?hA?rA?nB?jF?|A?xA?l@?B@jC?f@?l@?v@?`A?r@@l@?jA?^?d@?fA@rC?`@?t@?r@?nA?X@~C?nA?tA?R?xA?xB?`B?^AfC?`B?x@?jB?t@?j@?d@AdG?vAApD?jAEjBCbAQlCE^AJMbAKz@g@xCOz@QdAMv@a@vCCZAFEl@IlAAn@GlAGhBGzAEbAIbCEt@MtD?@M|COtDMxDM`DSlFKvCQrEOrESnFWpGGhBKpBCd@IdCE~@GdCAPA|A?zA@r@DjBHlBD~@Df@@LBZFp@Hv@Hj@Fj@F`@f@rCThAn@jCf@nB@Fx@~C?@J^Pp@h@tBJ`@@FZ|A\|BLjAJdAF~@DdAB|@BdA?z@?f@?nA?dA?X?vA?vA?b@?F?j@?j@?bC?j@?P?pBAnL?F?b@?F?fJAzJ?dA?hB?jB?|C?xDAbC?vDAvDC~CAvBAh@AzCCfCCbCAbCAjBAbC?|C?V?xD?dC?~C?pE?~C?tD?vE?dG?lB?l@?j@?f@?B?t@@vA?P@dA@nD?BBrC?V@n@@|C@D?pABhD?R@h@@|B@~A@|B@~D@`@?lE?L?`D?P?xA?rA?lA?\?Z?nA?R?V?vA?P?dA?pB?PArB?fB?v@?vBAd@?fC?l@?|D?hA?bC?`@?vA?xE?|H?p@?L?r@?nC?Z?jB@tB?N?V?nA?jB?pA?j@?D?d@?vB@nF?zB?n@?j@?dC?~B?zA?l@?hC?rE?B?tD?rE?B?zE?tE?`B?h@?l@Aj@?f@?D?hCAxEAtFAbDCtEAhCClGC`H?f@?FCzC?lB?h@A`A?lC?z@?j@?hC?nF?R?\?J?n@?nD?h@?jC?fC?`D?hD@lA@dCBhE@fA?J?B?\@zA@t@?v@@jB?L@^?~@@pA@rA?V?V?^@pA@fC@pF?rA?f@?B?zAA`E?`B?bB@|GA~I?dC@vB?fF?T?j@?B?pC?lA?rAA`D?P?vA@v@?x@?`A?n@?rA?x@@lA?`B?tE?xE?~A?j@?p@?pA?V?jB?\?dB?bC?j@?l@?rC?dA?lG?zK?lB?~F?J?D?nD?R?n@?`@?pA?xB?dA?V?X?vAAz@?R?D?|@Az@AvA?X?F?f@AP?\?x@ElEApEArC?t@?b@AdB?p@AvG?~A@zAAzB?tF?\?`@@zA?fAB|A?t@@B?p@@f@D`D@^@tABzA@zAH~EB`C@j@BdC@d@D|A@n@?X@T@\FvDH~FBtA@l@@nA?r@?j@?`AAjA?lA?p@AnD?hA?d@AxC?hAAlA?N?~BAn@?l@?`C?fA?N?xA?fD?lF?jD?`@?H?`B?hI?X?rF?H?jA?D?|M@lB?zA?hC?vA?fC?B?h@?xA?rA?`D?~F?h@?B?nF?dD?@@rG?pD?h@?@?tD@J?^?@?dB?lA?j@?@@bJ@`I?B?j@?`A@fO?@?@?h@?B@~F?fB?h@?n@?r@@`C?dA?V?fD?dB?j@?L?d@@N?t@@f@@t@?@?D?b@?j@?bC@vA?dA?|@?zE@tC?|C@|E?|A@rD?lA?pA?xA?^?P?n@?n@?t@@bA?X?X?X?Z?t@?`@?HAb@?jA?PCrACzAAx@Ar@Cz@Ap@An@A\A`@An@A^Ar@CnAAv@CrAE~AAj@EbBAjACvACjA?|@A`B?V?|@AlC?bE?zB?F?@A|B?b@?x@?rB?`@?x@?F?lB?p@?hA?zD?@?j@AdC?f@?zA?j@?VAtC?@?j@?j@?xA?rA?@?j@?xA?N?\?bCAfA?bB?bC?F?nB@v@?XA`BAlA?RAvACr@AXElA?@Ev@C`@Er@Gr@Er@Gl@Eh@AJC^Cd@En@AXGz@?@AJMtBCPG`AEh@Gn@Ef@Gx@Gz@IdAC\Cf@Gp@IhAEp@Er@CXCXCZCZAXCXCXCZCXAXCX?DCRCXAXCXCXC\CXAXCZCXCXCXAZGr@Et@Gr@CXC^?HCNEt@CRC`@CZAXCXCT?BCXAZCXCZAHANAXCXCZCXAZCXCXCXAXCXAZEl@A`@CZAX?XAXAXA\?RAX?X?`@?Z?X?Z?X?Z@r@?@@t@@P?Z@X@Z@Z@XBX@ZBX@XBb@BXBXBX@RBXBL?JDXBVDZBXDZDVDXBXDX@DDRDVDXFXBR@DFVDXFXFV@BDRFXDVFXBHBNFVFVFXFVFVDXFXFV?@FTFZFVFVFXFVDXFVH^Lh@FZHZDRFVDVH`@H^Jb@FVFXFVFZDVLj@Pt@H^Jh@Np@Np@FXFVDVFXH`@@BDRFVFXDVHXDVFVFVBLBJFVDXFVFXFXFVFXFVFVFZFXDVFVPr@FXDVFVFZ@@DTDR@BFVBJ@JH\FVFXLj@FZFVDP@DFXDVDL@JFVFXFVFX@FDPFVFVFXFXFX?BFRFZFVFXDTDP@FFXDR@FFRDXFVFVNp@Ln@FZFVFXFXLl@@@FXFXDVFXFXFVFVFVFZFVDVHZFXDTFXFXNp@FVDVFTFZFVFXFVFXFVDXLf@@HFXFVFXFVFVDXFVFXFXFVFXFXFVFXDXFVFXFVFXFXFVFXDVNp@FXHXLn@FVFXFVBJBLDVFXFVFXFVFXFXDVFVFXFVFVFVDXNp@Nn@FZFTFXFXDVNp@FT@FDPBNJ`@DVDN@HFVFXFT?BFVFVFX?BHXFXFX?BFTLp@BJBJFXFVDR@DFXDNLp@FVFXNp@Nn@?@Np@Np@F^FXDPFZDVLp@DXLr@DVDXDXDZDXBV?@Hr@F`@BXBVBZFl@BXBXFr@Dr@B`@@R@T?DBZ@V@`@@T@TBZBt@@X@X@X@XB\@V@V?H@XBX@V@V@X@X@Z@XBX@X@PB|@BZ@XB~@@VDl@@Z@\B\@TBr@B^@T@Z@V@XBZ@X@X@R?DBX?J@P@^Bl@B`@@X@X@T@V@T@\@XBZ@Z@Z@V@X@Z@XBX@\@V@Z@Z@V@X@XBX@Z@^@Z@XBX@X@ZF`BB`@@X@XBl@@^BX@\Bn@@Z@ZBXBp@?J@L@Z@V@X@Z@XB\@XBr@@FBl@Bt@Br@Dv@Br@?@Bp@BX@X@X@Z@X@XBX@X@Z@ZB\@V@Z@Z@J@d@@XBX@X@X@Z@X@XBX?NBd@?D@T@R?DBf@JpC@PJ~BJfCBd@@V@XBl@@X?D@ZBZBt@Br@Dt@@X@X@Z@XBZ@V@Z@X@ZDr@@\@XBr@Dr@?BBp@Br@Dt@@R@^Bv@Dp@Bp@@V?D@Z@VBZ@Z@XBb@@RBp@@Z@X@X@XBXBt@Bt@BX?P@F@Z@XBr@Bh@Bd@@X@ZDr@Bt@@^Bl@@D@T@T?BBd@@f@Dr@Bv@Bb@?PDt@Br@@X@XDt@@Z@X?F@P@XBX@X@^@T@ZBZ@X@X@Z@V@ZBV@Z@Z@X@Z@T?@BZ@Z@V@Z@ZBX@X@Z@X@XBX@X@Z@X@ZBX@X@Z@X@V@ZBX@Z@Z@X@XBX@X@X@Z@Z@XBXDnA@X@X@J?LBZ@X@X@V@\@XBt@?X@X?Z?X?X?X?Z?\?XARA^?ZA\ATAZAZCZAVCXAZCXCX?@CXCXCXCXEXCXEZEVEXEZEVEXEXEXEVGd@CNEVEXEXEXEVEZEXEXGZCTEXEXCNAHEVEXEXEXEXEVEXET?BEXEXEXEVEXEXEXEXEXCR?FEXCVCXE^APABCXAXCZCXAR?HCVAXAXAZAXAXAX?ZAX?Z?J?LAX?Z?t@?X?X?@?X?X?X?H?P?X?Z?V?b@@F?P?Z?N?H?X?Z?X?X?@?X?X?X?F?b@A^?T?Z?L?R?X?X?l@?z@?@?T?X?\?X?X?V?\?\?X?V?V?\?T?Z?\?V?V?D?t@?p@?X?J@N?p@A\?p@?b@?N?H@l@?Z@X?F?R@X@X@^@T@X@TBb@@TBZ@XBVB\BVBVBXJz@DZBPDXBVFXF^BPDXDXHh@F`@DZDVDX?@DVBN@HF^Hl@DXDXFXDVBXLr@DVDXDXDXDXDXDXBN@HDVDXFXDVDXDX@DBRDXDVDXDXDXDXDVBL@JDXDXDXDXDVDXDXDXDXDXDXDXDVDb@DVBPBXD\BVBXBXHr@Dr@Ft@Dt@Dr@@HBh@Dt@Br@Bt@@r@@t@?X@Z?f@?f@?^?X?r@?ZAr@Av@Al@AT?HAZAXAXAXAZCXAVAZCVCZARCXANEh@CVCZCXCTC\EXCTGr@Ip@EXEZEXCXEVEZETEXAJCHEXEVEXEXGVEXEVGXEVEVG`@EVGXEXKj@E\GXEXCNCFEXEXEVGXEXEVGXEVEXGVEXADCRGXEVERG^EVEXGXEVEXEV?@EXEXCXEXCXCX?@CVCZAXCX?FAPAZAXAXAZAR?^AZ?V?Z?Z?N@H?X?Z@X@X@X@Z@X@P@F@XBZBVBX@LBV@NDXBV@@BXDXDVDTF\BPFXFVDXFVHXFVHXFTHVFVHVDLBHJV@BFPJ\JTJTJV@DHNJTJT@BJPJRJTFHDFHPLTPXLRNRLRNRLPNRBDHJNP\`@RRLNPP?@PNPPNNLLRPNLRRNNLJPNRRLJNPPNPNNNNNPPPNNNPNNNPPNNPNPPPNNNNNPP@?PPLLNNPNNPPNNPNPPNNPNPNPHJDDNPNPNPJNBBLPNPNRLRNRNRLPLRLPNRLRLRLRLTPXLRJPNVLRDFDHJRLRJTLTJTLRJTLTLXHRLVJTJTJTJVHTJTHVJTHTHTJVHRHVRj@Pf@@FJXNd@BDHXHVHVRj@J\Ph@HTHVHVJ\FPRl@DLDNHVFPJ\HTFPHVHVHVBJDJHVFTHVJ\HVHVTn@@BFRHVRn@Nf@JXHVHVHVDLFLLd@Nb@Nb@FRDNPd@HV?B@BRj@Zz@LX\~@BDJTHVBBHPHTNX?@Td@JTJRLVJRLTJTLRBFFLLTLRJRLTLRLRLRLRLTNRLP@BJNNRLRNPLRNP?@NPLPNRNPLPNRHJBDNPNRLPNPLP|@jANPBDJLLN?@NPFJFFPTJLNRJNB@LPFJFFNPLRNPLP@@NPLPNRNRLNn@x@NRNRLPNPNRNPNRLNNRNTNPFHDD^f@^f@NPJLDDHLNPNRNPLRNPNPNRZb@b@h@VZPVRVFHRTNTLNPTNPLPLNNRLPPTPTf@n@@@NRLPNPRVZ`@FHX^\b@NRZ`@NPNRHLBBNR^d@\b@NPLPNRNPLRNPNRZd@NR\f@h@x@v@rAf@|@f@`Ab@|@d@bAb@`AVn@Vj@Tf@Vp@Vl@l@rAHRd@jAJRHRJTJVJTJTHTJTJTLZTh@JXN\P^JVJVHPJTJVJVXn@N`@P^Vl@Tj@Rf@LVJVJVJRJXHPJVLZTf@LXFPRd@N\JTJTLZTj@Th@Rd@N\LZRd@JVHPLXJVJTJVJVLVTh@Tj@b@dAd@dARf@Xp@l@xATf@Tj@NZ\x@JVP`@`@bALXTj@N\Pd@^dAb@nARp@Tr@Ld@Rp@Pp@VdAXlAVnALl@Jl@Lv@H`@Ff@Lt@Fd@Fb@Hr@Hv@NxALxALjBFpAFlADnA@p@@d@@Z@|A@lA?v@A`AAbAA`AC`ACt@Cd@Cj@AREr@QhCARKlAIx@Il@Ir@YtCMlAKx@Ir@It@MpAIr@MjAIt@W~BKdAE^Ip@MjAQbBIv@WfCIj@MnAMjAIx@MlAMdAIt@Ix@MhAK~@Ir@Gj@Gn@CXIt@E`@El@Gl@InAE^En@El@Gr@C\CZCXIlAI`AK|AEb@Cf@KrAIfAGv@Gp@CXm@pIw@nKEd@IdAGbAKtAGt@Gz@Eb@G~@Ef@Cb@Gv@Eh@Ef@AVALCb@CXAXAXC\AVAXCt@Af@Af@AZAr@?f@AbA?t@?t@?n@@bA@d@@b@Bj@@h@@d@Dr@@^Dr@Dp@B^Dn@B\Dp@Ff@B^Fj@Ff@Ff@Fh@NjAF`@Hf@DVLr@F^RbADXFXFXPt@Lj@Pt@Nl@Nj@f@lBf@pBz@hDd@fB\rATz@f@pBd@hB`@|AVfAXhAb@`BLn@Nl@^fBJf@H`@TpAL|@L~@NdAR`BJ|@NfBDr@HjAHnABt@Bv@Br@Br@@pABlA?\?j@?\?^AbA?vA?v@AnEAnF?V?hCApA?t@?dBA~@Al@At@EfBKbCE|@WvDUxBGl@k@nEGZKl@UtAYvASz@cBbIoAbGm@nCs@dDWjAIZOn@Mp@On@Ot@Mn@GXGZMl@GZGb@Ih@Kl@Kx@Gb@Gb@E\Gd@Ed@CXCTE\CVAXE\C^AFC^?BEj@Ez@Ev@Cv@C~@C`AAp@Ab@Ab@?f@?`@?Z?dA?jA?pAAnA?r@?|E?nB?bG?lB?pA?dA?pC?L?tC?jD?`A?f@?xC?nD?xK?|J?tE?vE?hC?\?R?tA@`C@hBAdCA`E?dBA`A@bDD`D@zDAh@ArDAdB?lAAvFAbB@tX?rL?lG?vA?|C?jD?dB?tE?nA?zD?jD?`E?zC?jC?nD?tD?dC?nA?pK?bA?dC?zE?fG?xE?fA?lA?nA?rA?hA?nA?nB?vB?xA?hB?fD?|A?vA?dB?~B?lA?d@?X@x@?p@@r@@r@@x@@d@D~@Bv@DhADp@Dz@B\Fr@HdAHx@JnAFr@Fr@BZFv@Fn@D\Fr@LtAH`AJrAH|@Hx@?BBRb@`FH|@PrBFv@LrAJnAJfAR|BLnBFz@DdADz@BbABr@?H@l@@~@?h@?^?|@?t@Ar@?TAp@An@Ch@Ab@Cl@?LI`BEfAIdBEr@EjAOdDEv@E|@KvBIdBC|@GlAIbB?JGjAGvAEx@APKjCAPGhAGtAK|B?HCj@IbBIbBC\GfBI~A?JGhACt@GlAKnB?BUhFIvBI`BIvBAJUhFIrBIvAG`BWdGE|@E~@IfBGlAAZE|@GhAG|@Cj@Eb@Gt@Eb@U|BEd@Ir@Gb@c@jEMfA_@rDe@pEWbCYhC?D[rCQbBGb@Iv@E\MrAALG`@MrAE`@CNUzBm@bG_@tDCVCRGl@E`@ObBK~@CXEXEf@AHIr@MrAAHK`ACRMbAMdAKp@K~@A@QbBK`AE^MlAAJE^ALK|@Ix@a@xDAHIz@Gj@OvAAFOxAAJK`AE`@CRE`@Iv@K|@ANOxAMdAIv@C\A@Gl@AFGr@Gh@Gh@?@MpAK~@Gj@OxAc@hEQbBWdCWdCCNKfAMfAEf@OrAE^U~BMlAMnAQfBCPK|@Gh@Gl@It@Iz@ADK`AMhA?Bc@|DEh@UrBMdACTEd@UxBIn@CXE\Gn@A@OvAIz@YhCCVMnAWtBI|@Gh@[|CAL]`DYjCE\SlBKdAOvAMrAWbCGj@Q~AKhAWdCE\CRIx@_@lDK~@K`AK`AMpA?@Il@QbB?BMhA[xCMjAIx@Q~AEb@MhA_@jDGt@SdBQfBE^OtAIr@K`AALAJGd@Gl@Gl@?@Gj@Gj@ADE^CXE\CV?@CVEZCZCRCVCVGh@Gd@Gl@?@CPEf@E^E`@AFEZCZE`@E\AJGn@E\EVIt@E\Kn@EXAJKj@G\G`@?@Ov@Ml@Kf@GZI^IXERETENIVMf@GVWz@Md@ADGNEPM`@ELM\Od@MZABKXIRSh@Ul@Wn@KRKXKRIREHS`@MXGLMVOXGLYf@Q\KRGJ_@n@GH_@l@SZYb@EF_@h@?@W^A?MRIJUX[b@a@f@IJUXEDSVSVEDuAdBKLWZw@bAUVY^GFIL[`@_@b@g@n@c@j@IHe@l@u@~@QT]`@A@w@`AQTk@r@QR[`@i@p@ORc@h@GHY\w@bASXMNEFGHMP_@h@SVILORYb@CBMR]d@CDOTSZKN[d@CFU\EF[h@IJWb@s@lACFWb@c@v@GJ_@r@]p@CB]p@Yh@s@zAq@rAWh@y@dB]t@Wf@[p@Wh@c@|@OXOZCFSb@CFOZUb@Uh@KRGJc@~@O\IN_@x@GLc@|@CFk@jAA@Uf@Yj@CHGLMVKPMXMXGLMVKRKV?@KRSf@Q`@EJM\Sh@KXITENKZ[~@IZKZMh@IZMd@Ol@AHK`@ETI\Kl@I`@Kl@M|@A?Kt@E\E\ADIn@E^ALEb@IdAANCRG|@C`@Ct@Cp@Cd@Cv@?VA^?JAV?R?b@AP?P?H?^?F?j@@f@?X@Z?R@N@f@Bt@?LB^Bn@BZ@LFdA@HBb@BZBVHz@NtADb@J|@DVHx@LhADVDb@NtALhANlAB\NnALhA@NJ|@DVDd@DZXlCFb@Fj@XhCh@`FLlATpBJ|@ZtCNtALjAHr@VbCHl@Db@^jDBJP~ABX@LBJ?FDZDd@ZnCTvBRhBD\RdBDb@F`@@P@FHr@BND^Hz@Ht@NpAFj@Fh@Fj@DZ@LDZ@PFb@?D@JL`A@FBZD^J~@Jx@DXD^Fl@D`@DZHx@Jx@Fh@LlA\`DNpATpB?FJ`AJt@X`CRbBFd@JfAZ~C?@PbCFz@Dn@@PBr@@TD|AB`@DhA?LFjADjA@`@B^DvA@t@B|ADjB@~@?`@?x@@j@?\?j@?p@?J?B?B?\?d@?J?F?B?f@?\?b@?D?~A?\?r@?X?\?X?r@?h@?hA?n@?^?\?dA?hA?jA?fA?dD?\?d@?^?\?p@?lA?Z?\?l@?b@Ap@@v@Ap@@t@A~A?dA?T?f@?h@?zA?l@?\?dC?lA?xA?v@?~@?p@AjD?`D?vA?l@?dB?hA?z@?v@?jA?nA?fA?fD?tBA|I?T?vA?fB?h@?rH?xE?jB?zB?tD?pB?~C?nAAfC?rA?dC?jB?p@?r@?hC?fB?t@?T?B?dG?x@?hA?fDA~D?tB?vC?jG?hE?z@?lH?vB?pC?n@?bE?T?nA?FAjE?z@?bF?zA?rA?nA?xC?bB?r@?J?jBAzM?dE?jE?b@?rBAbG?vF?p@?vB?`BAhB?r@?v@?p@AT?\A`@?TAXAXAZAt@Et@Cr@Ch@KlBA`@Cn@C^?ZAXAXAt@Ah@Ab@?ZAt@?t@?t@?t@?t@@X?Z@X?X@Z?X@X@Z@X@X@Z@X@X@Z@XBX@X@ZDr@B\@V@X@X@Z@X?Z@X@t@@bA@dA?n@?r@?x@?zIAtE?nD?zC?p@?`@?nC?F?hC?tB?dC?J?dA?j@?dC?l@?fBAtC?dA?@?jB?nA?t@?r@?dA?Z?h@?bA?p@?xA?`A?nE?zC?pD?j@?`@AnH?fB?fDBzJ?p@@dDAjBAv@Av@?BAdB?tB?~A@rAAX?xC?~D?tI?n[Ab^Ah~@?nGAjl@A|q@Adl@?`k@Ad~@?va@?n[?|M?z@?nD?j@?j@?hEAz@?v@?vB?zC?^?`A?R?d@?Z?~B?b@?|C?nA?V?n@?x@?|A?j@?\?rD?bC?x@?`J?z@?xA?V?`B?dD?zA?f@?\?L?@?h@?zD?rE?nA?nA?X?r@?`A?P?Z?pA?jA?Z?tI?tE?~H?D?fA?hH?lAAlB@TAZ?\?Z?V?ZCpA?\?DAP?VA^ATAZAXAXAXCVAXCZEp@AZCT?BCXCZCVCXCXCTCVCZIr@EXIp@EX?@EVCVEVG\Il@GZETEVGVEZGTGXEVIZGVEVGVGVQp@CHCLGTIVCLCJGRCFEPIV[bACHOf@Oj@IVCFi@jBa@nACJSp@e@|ASr@[bAm@tBgB`GIVc@|ASl@Ql@IViAzDe@zA{BtHGTKZQl@YbAe@~A]dAYbAIXGTKX[fAQn@}CjKOb@Oh@k@nB}AjF]hAK\o@tBW~@[`AQn@K\c@xAq@zBs@`CgAtDq@zBq@zBo@zBA?a@vAQn@Sp@{@pC?BM^IZM^a@rAc@|ASn@Ql@Od@K\K\ENIVOh@ABI\GTOh@?@IZIVGXGVMh@I^ETMl@G\GXEVG^ERETETEZEVKr@EXCRCPE`@E\EZE^Gj@ANC`@CVCTCZCXCd@ALCV?JEh@E~@Cp@ANATAj@C|@CtA?RAh@?nB?n@?r@AdA?hA?FAZ?dA?f@?V?\?Z?r@?\?^@p@?\?V?Z@Z?r@?Z@|A?`B?Z@xB?|@?v@?X?Z?r@?Z?X?Z?\?T?Z?X?x@@p@?\?V?t@?Z?p@?\?`@?fA?Z?p@?Z?Z?t@?X?~@@D?l@?J?~@?Z?bC?hC?N?fB@rD?t@?zG?t@?rB?xA@jA?@AV?@@zC?rD@~B?zC?zC?|C@pD?bG?tH?zC@nA?L?|@?rA?dA?bG@hF?~C?j@?vD@vB?f@?dK@tE?pC?|A?X?nB?|@?fB?x@?hA@rA?v@?V?\?dA@xA?R?jA?t@?x@?p@?J?^?`C?~B@lD?r@?pA@~S@fJ?pA?jA?vD?fB@nA?t@?T?pA?bC?bB?X?r@?N@hC?hB?pA?zC?n@?`@?tD@rE?nF@~A?|@?l@?bD?jB?vF?tA@|@?\?jC?hF@jC?`A?dD?|@@v@?r@?pA?j@?j@?bA?l@?lB?f@?f@@lA@hC?F@tC?v@?r@@r@?pA?lA?n@AxG?T?L?@?dB?bD?zB?|@?bC?nA?vA?bB?nB?Z?r@?p@?hB?fC?r@?nC@dBAzC?\?dD?hA?pA?jB?nA?X?L?L?p@@v@?v@?V?T?v@?B?r@?Z?V?\?X?r@?bF?vC?jA?nA?p@?\@lB@jA?z@@~B?rA@rA?j@?R@dB?h@@`C?N?|@@tA?h@?`@?L?rA@v@@pCBpG@`D@dE@fB@`C@tH@jC@jB@xE@nB@bCBfH@hB?pATjw@Pxh@HzVBdJ@hC@pD@hB@lG?`B@zE?pE@~K@fG@pBAD?x@?HFb\?rD?P?nB?xB@dD?jA?j@@bC?bC@nD@|I?@?zA@~E?@@pK?fE@nC?nB@fI?bABnOBbZ@lA?xB?l@?nA?N?nA@n@?zA?`CAbFAbB?l@?XCpJ?H?fBAlFAJ?j@AjEA|GA~C?v@EvSAjECzF?v@?vAAlB?`BAbB?lAA`B?pAA|A@dCBjBFhAF`AHz@Df@Hr@L~@TlAX|A\rA^lAX|@Nb@b@dAN^x@~AR^Zh@f@v@b@n@Xb@V^\f@zA|BlEpGlAhBV^DFPVn@~@x@hA`@t@fA`BxAvBx@jAr@fAj@x@Xb@X`@l@~@NRf@r@b@n@|CvEf@t@bAxAp@bAZf@X^\f@r@fApAlBvAtB`AzAr@bA^j@^h@p@dAj@bAf@fA^z@Tj@\bAX|@ZlAVdAX|AXfBPnBJlAFrABrA@z@?X@V?Z?V?^?dFAhF?nB?hF?zK?fHAfG?pE?dH?pC?dK?vD?tDAvD?zC?fB?pE?nA?zD?pC?hFAnA?t@?`C?tEAtB?bC?vAA~I?xE?x@?@Az@?dF?t@?v@?nA@`BBvAFvB@b@Dr@@V@LBh@NpB@TNjBDb@Db@@LDh@X|C?F@RBh@JtAFl@HtAD`@ZhEVvDZlEHnANrBV`DB^Fx@@P@FF|@Fz@@HHjADj@Db@RhCDj@Bd@P|BL|AJzARlCP`CTrCZfEF~@LhBLdBLvANvBLrADb@Hh@DZPhALl@P~@FPDTHZPl@Nj@Rl@@@Pd@HXJVJTZt@Zn@d@|@b@v@j@|@b@l@b@h@VZTZx@bAv@`An@x@b@j@~ApBz@bAlA~Av@bAxAhBjAxAJNLNLNJLRVlAzAtBjCh@r@JJPTTXVZZ`@?@JJJP@?Z`@hAtAvAjBLNHHLRPTTZNT\j@RZJTf@~@@?HP\t@Rd@DJVr@Tp@JZL^l@zB^nBLx@PrALlAFl@Dp@FrABbA@p@?`@@x@BrB?hA@nA?t@A^?TB`BAdCCdE?jA@~D@|@?L?R?`A?d@?jA?d@?rB?b@?T?N?|D?Z?\?@?x@?nC?rA?B?j@?j@?bC?h@?l@ArAAzA?DC|CCrAEbFAv@A|AAxA?nA?xE?z@?hA?r@?z@?r@?x@?fAAjAB~C?bA?~@?j@?j@?h@?l@?T?|@?B?X?N?d@?r@@lB?pB?j@?zP?rD?pB@|A?zC@p@?fA?zB?vG@`B?zBAbD?^@tD?zB?|G@nD?j@?n@?hD?D?bC?d@?vA@fG?tAAj@?j@?j@?j@?jB?b@?p@@dB?zC?j@?D?|B?`B@nB?|@@tC?tA?`D?dD?h@?l@@bD?hEArI?|B?R?j@?j@?x@?rB?lC?hA?`@?b@?b@?b@?P@xABpC?b@@`@?bC?@?@?h@?zA?dC?`E?x@?\?R?B?~A?b@?pB?d@AdD?rBB`CAjD?h@?p@?zI?xB?f@?xB@lL?N?lA@bCAb@?D?tA?R?T?x@?|@?X?D?@?b@@x@Ab@?V@dD@n@?h@BxA@zA@zABbD?Z@lB?Z?@?l@?b@?n@?rB@z@?|B?`AAZ?R@rC?bC?nD?pB?fB?N?vA?zF?j@?R?X?dA?~ACxEAdBEhAE\Gv@K~Aa@dGEd@QbCATATALC\Gv@O`CEl@ANAXALA\AHAl@A`@AhA?d@?r@AdD?|@?hF?\?h@@r@?dC?p@?N?h@?^?\?Z?L?`C?l@?`@?nA?t@?dA@Z?p@?^?D?H?L@rAAbE?Z@p@?P?H?J@N?\?BBlA?RDxBB|@@h@ZjKBn@@PRzGZxIB|@@h@@Z@\B|@Bn@@h@NtEB~@LbDB~@BhB@x@@v@Bb@@hB?L@jC?X?^?|B?V?j@@X?pB?D?tB?`A?b@?R?h@?^?`@?~D?`@?Z?JAp@@L?dD?dC?j@?hC?d@?Z?L?j@?pB?P?R?R?B?L?zC?p@?x@?N?`@?t@Al@AR?PALAP?NAFCb@AJQdCEf@CVI~@k@vHE\ALAJC`@Ef@c@nFEl@Gr@Gr@Ef@C\I`AUlCATCTAJC`@YdDEj@?@AVAL?@?@Gp@Ev@IjAIrA?@ARCVItA]jFCn@AD?@ANC^GdAMrBG|@Ep@?BCXEh@?FK`BAPEl@Ej@ATAVE`@Et@O|B?HALIjAEt@CPC^M`BCZK~AAREn@KrAGfAGlACtACf@Av@AZ?F?NAl@?TAV?l@?|@AtF?nA?pA@bIAzA?rA?B?L?pC?V?`F?~B?j@?h@?vA?\?`@?h@@xB?nA?r@?jA@zA@j@?@?J@D@d@Bb@Bl@Dh@@P@BBVBZDb@BJHp@BNb@vB?@Jb@Pl@Tr@DJDNJVN^Rh@Vf@d@bADFZp@p@rA\n@LVLXn@nATd@Td@bApBJVFLJTL\HVJVJXPn@Rt@VnAF\Jp@JbAB`@Fp@Bl@BnA?v@@j@?f@?b@A\?j@?DAvA?~@@~AAZ?rB?xA?T?V?l@?RAzB?pA?fC?tA?vAAbC?hA?L?z@Ad@?N?B?V?^?^?F?V?j@?v@?r@Ad@?B?V?L?L?l@@`A?@?^?f@?T?P?hA?tA@|@@|@DnA@b@Dx@@PFfBL~CBj@@LHrB@j@FbA?@?FDt@@d@@B?NHhBHrBBv@Dr@?PDt@FfB@RBr@Bj@Bl@F|A@J?BHlB?L@H@b@Dn@DpA@L@\@LN|D?NFjA?H?B?@HpADpA@PBd@@l@@F@VF|@F~@?FD`@Df@D`@H`AFb@@J@FFl@Fb@BN@FBZN`AFb@@DNz@FZHb@FXDVLj@H`@Jd@^`B^xA@HNh@b@dBNj@@Dd@hBJb@Pn@d@hBRz@`@xADRTbADPVfA@HP|@BFX|ADZRpAN~@BTDZHj@@HD^BRJbADf@@FDf@Fv@B\Dh@?LB\@V@H?FFjABn@@X?VBz@@|@@l@?p@@n@?tAAl@?`@AtAAhBAb@?f@?BA^AzAA`BCbBAjBAJ?h@A`A?VCzCAtAA`AC|D?BCxBCfC?HA\?VAn@CtA?JE`B?j@AnBApAAdAANAhB?d@?f@AhDCrAAR?^?z@?|@?BAh@Ah@Ap@?t@?DAl@ALC|CAvBAvACnBA|@EfGAz@?v@CtB?FCnDAxBA`AArAATMjQClFE~D?h@CnDAj@?@CtAGrH?LA~A?@?TAd@A`A?@?ZAzBCzB?L?B?@Ab@AlCAbAAtA?@AxAChB?z@AB?DElH?\?TAnAAPAxAA|AChB?\?XAh@Av@?L?t@A`B?`A?t@?b@?F?B@~@@tA?N@z@@RBx@Bf@@PBt@Dt@@T@Z@`@H~AJlCLnCHdBFpAFfBLvCBl@?R@Z@Z?X@Z?r@?v@Ar@ADAj@AZA\CRARCf@ARC\CVE`@Ij@E\Gf@GX?DGXEXGVEVOn@CJCLGVIZIVGVIRSl@_@lAMZADQd@Sl@Oj@q@lCO~@I`@_@xBK`@SpCEn@AXCj@AFAt@AXAZ?V?ZAZ?X?X?ZAX?X?X?\A^?X?X?XAv@?XAXApA?X?ZAp@AlBErEAnAQbXAX?t@CjBAnA?XAnAEjG?TEzEAl@EvFAnACzDAhBApAGhG?t@EnEGpH?t@Af@?z@Az@Al@?p@AXAdBAxBEdD?ZEzEAdBA\EzECdCAvACzE?^?TAXApA?X?XAp@?B?ZAz@?d@ARCtC?r@C`DAjA?H?`@Ah@?|@AdAAdA?x@CdDAX?ZAr@AnA?n@EjD?n@AZ?J?n@Al@Av@?r@AX?t@AX?Z?NA`AAr@?\Ah@?b@?TA\?P?b@?XAX?Z?Z?XAX?X?ZAr@?ZAx@?Z?X?ZAZ?X?XAZ?X?ZAX?X?Z?XAZ?X?ZAX?X?ZAX?X?XAZ?Z?XAX?Z?XAZ?X?XAX?Z?ZAX?X?XAZ?X?Z?XAV?\?XAZ?X?VA\?X?ZAX?Z?XAZ?ZAV?X?X?VAZ?Z?Z?XAX?T?\At@?ZAX?V?\AV?Z?T?\AT?`@AV?Z?TAt@AfCClB?t@AXEhG?XEpFAr@?nAAt@K~MCzDAR?^AjA?r@ExD?^AbBA\?n@Av@EtF?X?ZAhBCjBExHAtAG`IAnAEpE?\?PAt@?F?b@At@Av@?t@C|A?d@?f@AB?p@?TCvB?v@A^AvAAv@AlB?H?j@Av@Ar@AnBAp@?\?^AH?B?^Ab@E|GCvD?R?HAlAA`BAz@?`@?RAvAEtD?jACbCEzF?HGvJAp@A|CAhAAD?lAAZ?\AxAAzAA\?|@CnBAxCAt@AzAAbA?f@A`AAfBAt@?v@AbAAbAAjA?v@Av@ARAjCAt@An@Av@?t@CjBAfBAhB?fAAlA?FAj@?f@A`@?fAAt@Ax@?x@?X?@Aj@At@?r@Ar@At@AnA?pAAdAAz@KjO?RA`@AbBAtCAf@?@An@@DA~@At@?j@A\?LA~@AbAAj@AJAh@Cl@GvAEh@Cd@Er@CXEd@Gl@MfAIt@In@ADCRCRIb@Kp@Mr@WlAERMp@Qr@Op@Or@_@~ASz@CJOr@EVGVCNCJETGZQbAeAzGCNObAu@bFERAF]|Bc@tCMx@SnA_@fCG\_AlGg@bD{@vFi@hDy@vFGZ{AxJi@pDG^SrAIf@m@xDWdBIh@AFe@~Ck@rDi@nDSlAQdAQjA[vBIn@M~@Mr@EZi@|CIh@Mx@]tB[pBq@rEOfAW`BKp@M|@SpACTQlAWdBYfBO~@O|@_@`Cc@rC_@bC]|BoBhMStA{BdO{A|JYhBgDxT]zBYfBeA|G_@bCq@jE_@`C_Ldu@a@hCe@vCU|AM~@Kr@Kl@CXEZG`@CZKbAMnAGv@Gv@G`AG`ACj@Cb@EjAA^An@CvAAzCA|@EfHA`BAn@?BCjC?l@At@CvCArAAdCCbC?l@Al@C`C?@?p@CtCA~@AnAE~F?b@MlQAbCAtBCtB?XChCAfCA`@?RC`FGrH?Z?RAD?d@?J?T?z@?n@?R?f@BnA@t@@l@?DHdCDfBB~@?LBt@@Z@V?V@l@@h@?^?B@j@?d@?h@AnA?n@?FAlAAlAArAAjACvEAfBAlA?RCxB?t@AdAAfAAhCC|BAzAAnA?`AAt@?NAfAAj@A|BA`A?HC`DExGClDAbCAr@?t@ChBAbCA`AAdAAn@C|@?PEz@Cp@Cr@Ch@Cb@?@KfBCt@C\Cl@Cv@ClAClAEtEEbFApCChBAvA?p@?v@AdCAtAAlA?bAA^Az@ChAAzACrBAvAEbFAjBAtAAlAArAC~CCxD?|@AfACdCAfA?r@ArAAt@AvAAx@AtCCdDElFC~FAx@E|FCfFGjIClEAhB?p@CjFElEAhAEdBSzEMtBKnAKtAMlA[nCIp@UnBK|@QhBWvBa@|Dc@vDCXCN?D{@rH}@hIW~B_@jDoBxQ{AjNmCnVcBvOkAvKoAzKc@zDOtAYdCGl@wCfXgA`KGh@mC`W{@zHE`@aEb_@Gj@Q~AwBxRGh@_AvIWvBe@nEa@tDg@pEa@tDW`CShBW`CYbCW`CW`COnAMlASdBSjBMlAMjAOnAW`CMlAIr@It@It@g@lEMnAIr@MhA]`DOlAW`CW`CWbCOlAMjAMnAY`Co@dGSfBGf@W~BANIp@SdBGh@w@jHCNALo@fGe@bEAJQbBShBEZ]xCSnBe@dEAPAB]dDMjAg@pEM`A?JShBgB`PuC~WGh@yCxXyClXwBbSaFpd@Gh@_BbOo@xFMdAMpAuBtRIj@e@rEIj@CV{Hrs@ePpzAi@zEg@jEGt@CROjAc@dESfBE^QbBE`@Gj@EVK`AMbBInAGlAABEjACVAp@EhAAdAAv@AdA?pA?rA@dABdAB~@Bv@Br@Dv@FnAHlALxAPtBJrADZ\jE\xDJfA`AzK`@rE\|D~@|K@PN`Bh@fGRtBNlBVvCJhANlCHnAD`ABx@Bx@@b@?RBhC@fA?j@?HAj@?\Az@Ar@A`AEbAAl@A?Al@Ch@CXIrAC`@El@CXC`@AHEf@Gf@Gp@Gh@Kx@MbAId@?DADEXKp@QfAKd@Mt@S|@ERERYlAWdAWbAIVSr@?@KXMd@ITIVSl@Qf@Qf@w@tBe@fA]x@e@dAk@nAmApCABuBxEq@|Ao@xAg@hASb@O\c@`AeDrH]v@KRCHs@~A_AtB_@z@_AtBYn@IPe@dAq@zAMZc@`AaArBo@tAcA|Bg@fAKT_@|@mAtC_A|Bi@jAu@bB[t@Uf@_@z@e@fA]x@Yx@Wr@Ul@CHIVM\Sp@Of@Mb@W`A[lAUbAWfAOx@Mr@Mp@Mr@Ib@M|@OfAQvAIt@CZEZQ`BK|@YdCK~@W`C_@hDUpBCPe@jEAPMhAc@|D]~COrAc@|DYfC_ArIy@lHE^UzBOnAEZCTALCNANy@jHcAjJ_@pDm@jFa@tD_ArIQ~AwAlMK`AShBoAdLCXIx@S~A]dDUpBKbAM`AIz@MjA]zCk@hFShB_@hDCXGd@Gt@Eh@M~AIfACTAL?HOdBEj@WbDQvBQ|BOdBMbBOlBKvAM|AKrAMrAGr@KbAMfAGd@EZIh@M~@EV[dBQ`Au@bES`AIf@Ox@Mn@Ij@SnAM|@It@MlASfBa@rDIh@Eb@CXE`@Ir@Il@_@hDa@xDo@`GiA`KyEdc@UtBmBdQCPOnAI|@OrAIr@EZCZa@pDEVGr@UjBk@fFEb@_@lD]xCW|BIr@Ef@M`ACXEVIt@CXCXEXAF?FAHEXMnAEVCZE\CVOlAIp@C\EVIr@CXCXEZIr@Ir@MlAE\In@ARGb@Ir@QfBOjAE\?@CVIt@W~BOlAIt@CXCXEXIt@CXIp@EZCVm@nFCXMjAg@pEOlACZCVEZK`ACLIt@Ir@CXIt@Kx@APEXCTE\It@K~@{@zHE`@YhCCZIp@?@E^MdAGd@OtAOvAEXGr@CLGf@Gp@K~@Gh@Gj@AHEXCXK`AEVALC\CTE^Ej@Ev@C\CZAVGz@APAZAZCh@?RGzBA\AXAd@Cl@AVCt@CZAVAXCZGn@Gr@C^CZANGh@APGf@Ef@In@Kt@EZKp@EZEXGXEVEXEPIh@EPGXEVGXGVOp@IZOp@Or@Mj@Or@ADETGZGTE\GZQdAIh@M~@EVAJAJKt@E\CVEZANUrBCVAFCPCVEZGn@CPQ|AIr@K~@ALShBIr@It@WbCKp@MnAWbCIr@EZQbBKx@g@pEEh@G`@CXIr@E\SfBIr@CXIr@Ir@EZARE\It@q@bGWbCOlAEf@Gh@CZOvAG|@I|@MxAG`ACZCj@Et@InAGtAC\Ct@Cr@A^Cl@Cz@CdACd@At@AVAr@Av@?VAZ?Z?v@AX?Z?X?t@?t@?v@?p@@v@?|@@l@@lA@v@@tA@n@BfCDrEBlD@j@@t@?XFnGDnF@x@BlB?T?TBtA?t@HvH?BF`G?f@FrG@X?Z@r@B`DBhCD~D?V@XDtFDxDDpF@j@BtB@hB@ZBfCFfHDfFFdF@hBFnF@jBDxD?^BhBJnL@nABlBBbCBjB@lCBjBBjB@jBl@np@BfC@v@?t@BlBJfL@^?VBnA?~@NvN?r@BpA?t@FlE?b@?v@DhD?TBx@?fABnA@n@@^Bx@@ZB\Bp@JfBDv@Fr@Ft@H|@P~AHr@Jt@NhARpANx@X~A`@|BTvALv@L|@TzANzALrANdBN|BDt@FdBDjA?ZBdA@r@?PBhBB`E@b@@r@?l@?L@R?^@f@@z@?`@@t@@lA@v@@nA@tABfB@x@@|ABrC@l@@pBBhB@hA@f@@pA?V@ZFbG?RBhC@~A?X@Z?X@X?\@r@?Z@X?Z?X@Z?X@X?Z?Z@X?Z@t@?X@Z?X@pA@X?Z@X?Z?X@Z?X@Z?X?Z@X?Z@T?^?Z@nA?X@Z?X?Z?Z?XAX?Z?XAZ?XAZ?XAZAXAZAXAXAZAXAZCXAXCZAXCXCZCXAXCZCXCXEXCZCXEXCXEXCXEXEZEXCXEXEXCXEXEXCXEZEXCXEXCXCZEXCXCXCZCXCXAXCZCXCZAXAXCZAXAXAZAZAXAXAZ?XAZAZ?XAX?pA?Z?X?Z?X?Z?X@Z?X@Z?X?^@V@fBBfB@hBHlHBtC?J?X@Z?X@Z?Z?V@\?X?X@X?\@Z?X?X@X?Z@Z?X?Z@X?X@Z?Z?X@Z?X@Z?Z?V@Z?X?XBjB?Z@X?Z@Z?X?Z@X?X?Z@X?Z@X?P?H?X@Z?X@b@?R?V@Z?\@V?Z?Z@X?Z?X@X@t@?X?Z@X?Z@X?Z?X@Z?Z@X?V?\@Z?X?Z@X?Z@X?Z?X@X?Z@X?Z?X@Z?X@Z?Z?X@Z?X@t@?X@Z?X?Z@X?Z@X?Z?Z@X?Z?X@X?Z@X?Z?X@Z?X@Z?Z?X@Z?X@X?Z?Z@Z?V@b@?R?X@X?Z?X@Z?X@Z?X?Z@X?Z@X?Z?X@Z?X@\?V?Z@X?Z?X@Z?Z@^?R?X@Z?^@X?V?X@X?Z?Z@Z?Z@j@RhT@jB@nA@Z?X@Z?X?Z@X?Z?X@Z?X@Z?t@@X?Z?X@Z?X@Z?X?Z@Z?X@X?Z@T?\@Z@X?Z@X@Z@X@Z@X@Z@X@Z@X@Z@X@XBZ@X@ZBX@Z@XBX@XBZ@ZDp@Dj@?@@NBXBZBXFt@BZBVBZBXBXBXBZDXBZBVBXDZBXDXDZBXBXDXDXBXDXDXDVBP@HBXDXDXDXDXFXDXDZDVDXFXJt@DVFVDXFXBRFXFVDXFXFXDXFVFVFZFVFXFXFVDTFXHZFVDP@FFVHXFVFXHVFXFVHXDRJZFX?@FTHXFVFVHXFVHXFVFVHXDPBJLf@HZ~AlG@B\tAVfAf@pBLf@V~@BLXfADLT~@Nj@Jb@FVXfAZnAHZNn@nA`FPp@Lf@Lf@Lh@Tx@H\FVFPFV@DfAjEj@|Bb@hBZlA~AlGFTLf@Ld@Lf@Rt@FZ\nAXlA\rAp@lC\pAFXHZNl@x@`D\tAXhAXhAZjAFVPp@XfAXjABFBNHXFX^vADPT~@z@dDFTDRHXBHBHDPHZHZFVFXHVFVHXFVHVHXHVHVHVHVHVHVJVHTHVJVHVHVJVHVHTHVJVHVHTJVHVHVJVHVHTJXHTHVJVHVHVJTHVHVJVHVHVJTHVHVJVHVHVFLBJJVHVHTHVHTVr@HVJVHTHVJVHVHTHVJVHVHVJTHVHVJVHVHTHVJVHTHVJVHVHTJVHTHVJXHTHVHTHTJXHVHTJVHTHVFR@BJVHVHTJVHVHVHVHVHTFPJ^HVHVHVFVHVFTFVHXFXHXFVFVFXFVFX?@FTDXFVFXDXDTFXFZDXDV?@DVDXFZBVDZDVDXDZBVBT?DDXBXDXBXBXBXBXBZBX@N@HBXBX@VBVB\BXBZBVFt@BZ?@@VBXBX@XBZBX@ZBX@XBX@X@XBZ@Z@XBX@Z@X@X@Z@Z@X@Z@X@X@Z@X@X@X@ZB\Dp@@RB`@BXBZBXBXDXBXDXBXDXDVBV@@DXDXDVDTFXDTNv@DVFXFVBPH`@DVFXDVFZDVBHBNDRH^Lp@DXH`@Jj@H\P~@H`@DXBHP`AFXBRNv@FXFXDXFVDVFXFXDVFXDVFXDVFXFXDXFVFXDXFV?BDTFXFVDXFZDTFVFXDZFXDTFXFVDXFXDRNv@F\DTDTFZFVDXFVLr@FXDVBNBHDXFVFXDX@BDRFXDXFXDVFVFXDVFXDXFVRhAFZRnADXDXDXBXBXDVBXBZDr@BZ@X@XHhB@Z@X@Z@XBX@Z@X@X@X@\BV@Z@X@X@Z@X@X@XBZ@X@X@Z@\@TB`@HzBL`DPpEHjBDnAHjBBr@Bt@Dv@Bp@Bt@Dv@DlABr@Dr@B~@Bj@FnADnAFpADnABr@BZ@X@Z@V?@BX@XBXBZBXBX@N@JDXBXDXDXDXDXFXBP@DFXDVFXFXFVFXHVFVHVFXFVHVFVHXFVFXHTFXHVFXHVFVFVHXFVHVFXHVFXHVFT?@HXBJ@DFXJ\FVHVFVHVFXDPBDFVFXHVFVFVHVFXFVHVDN@FHXFVHVH\Pp@Jb@J\HZNl@DPJ\Pr@Pn@FVPp@Nn@HZPl@Pr@XhAXfAb@`BPp@XfAHXNn@Pl@Pt@Pn@H\@HT~@V`AHXPr@XjAPn@DLDHNl@ZhAvArFPr@Pn@DNRv@Np@Pn@FTPr@Pn@XhAZhAXhAPp@Nl@Pp@Pp@Pn@DPJ^Pp@Nn@Rp@XhAb@`BXhAXfAj@zBNj@J^Nl@b@bBXfAZjA`@~Ab@bBb@~AXjAb@`BXfAXjAXfAXhAZfAb@bBXfAXhAb@bBPn@Nn@Pp@Pp@FVPn@ZhAFVPp@Pp@Pp@Nn@DLz@hDjFnS`@|Ar@pCb@`Bz@hDj@xBt@pCDRfAfEr@pCt@pCJ`@ZnARv@Pp@Pn@Pn@Pp@Nn@HVNp@Pn@Pp@Pn@FRHZNn@Pp@Pn@Pp@FVNn@Pp@Np@Nn@Lr@Ln@Lp@Lr@PhALr@Jp@FXBPF`@VdBRhA?@d@vCBLJr@ZpBLt@Jn@b@pCD\^|BDRFb@DRZtB`@hCVzAZrB`@fCt@|Ef@|Cb@rC`AhGrAlIt@vEh@lD~@bGRjA|AzJ^dCp@hEV|AZrBBJxAlJhAhHrBlMBV@BBTFVDXDXDXDXDVFXDXDXDV@JBNFXDVBN@FDXDXDVDXFZDVDZDTDXDXFXDVDXDXDXDXFVDXDXDVDXDXFXDVDXDXDXDVFZDVDXDXDVDXFXDVDXDXDXDVDXFXDXDXDXDVFXDXDVDXDXDXDXFVDXJp@DXDXFXDVDXDXFXDVFXFVFVFXFVFVHVHVFVHVHTJVHVHTJVHVHVHTJVHVHTHVJVHTHVHVJTHVHVJVHTHVHTHVJVHVHTJVHVHTJVHVHTRl@JVHVHTJVHVHVHTJVHTHVJVHVHTJVHTHVHVJTHVHVHTJVHVHTHVJVHTHVJVHTHVHVJVHTHVJVHTHVHVJVHTHVJTHVHVHTFNBFHVHTHVJTDLL`@JVHTHVJVHVHTHVJTHVHVHTFLVt@JV^dAHVRl@Tn@HTJVRn@HTHT`@fADLXv@Rl@Tn@Tn@HVL^Rj@Z|@^bA\dALX\bADLL^HTJXRl@\~@`@jAHTHVJVTn@FRTn@Tl@h@|ARl@Tn@\bAJXh@xATn@Rj@JXh@zARn@HVJTHTHVJVRl@Tl@HVRl@JVHVTl@HV^dAHTRn@JVHVJVHTHTHVTl@HV^dARl@JXHTRl@Tn@h@zARh@DNHTj@|AHVHVHT^dAJVRl@HVJV^dA\dAJTRl@HVJVf@|AHVHVHVHXPn@HVFVPn@Np@b@bBPp@FTHZFXHVFVFVHVFXFVFVHVFXHVFXFVHVFVXjAFTHXFXHVFXHVFXHXFVHZFVHVFXFXHVHXFXHXFVHXFVFVFXHVFVHVFXFVHVFVFVFVHXFTFXHVFVFVHXFVFXHVFVFVHVFXFVHXFTFXHVFVFXHVFXFVHTFXFVHVFXFVHVFXHXFTFXHVFVFVHXFVFVHVFXFVHXFTFXHVFVFXHTFXHXFVFXHVFXHVFXFTHXFXHXFVHXFVFVHXFVFVHXFVHXFXHXFVHVFXFVHVFXHXFVDPBFDT@@FVHXFVFVHXFVFVHXFVHXFVFVHXFVHXFVHXFVFVHVFXFVHVFVFXHVFVFVFVHVFXFVHVFXFVHVFVFVHXFVHXFVFVHVFVFVHXFVFXHVFVHXFVFVFVHVFXHVFXFVFVHVFV?@HXFTFVHXFVFVHXFVFVHVFXHVFVFXHVFXFVHVFVFVHVFXFVHVFXFVHVFVFTFXHVFXFVHVFXFVHVFXFVHVFVHXFVFVHVFXFVHXFTFXHVFVFXHVFVFVHXFVFVHXFVFVHVFXFVHVFVFXHVFVHVFXFVHVFXFVHVFVFXHVFVFVHXFVFVHVFXHVFVFXHVFVFVHXFVFVHVFXFVHVFVFVHVFVFXHVFVFXHVFVFVHVFXHVFVFXFVHVFVFXFVFVHXFVFXFVDXFXFVFXDXFVDXFVDXFXDVDZDVFXDXDVBXDXDXDXDXDVBXDXBXDXBXDXBXBXBXBZDXBXBX@XFt@BXBZ@XBX@ZBX@XBX@ZBX?DDp@Bn@Fx@FjAHpABXDv@@N@^Dl@HxAFt@FnAHnA?HRlDf@vIR|CLvBRjDLdCR|CJhBJrBJ|AHrALbCj@nJ@PNlCFt@HzAHtABZFpADt@Ft@XjFLhBFlA@NLtB`@`HJbBDr@@R@L@VBZ@XBX@ZBXBX@XBZ@XBX@XBX@ZBZ@XBX@XBX@XBX@ZBXBX@XBZ@XBX@XBZ@XBXBZ@XBX@XBX?J@NBX@ZBV@ZBX@XBXBZ@VBZ@V?@BX@XBX@ZBX@XBX@ZBX@J?LBX@ZBXBX@ZBX@XBX@XBZ@XBX@ZBXBX@XBZ@P?FBX@XBZ@V@ZBX@Z@X@Z@V@Z@X?Z@X@X?Z?X@T?D?V?Z?Z?X?X?X?Z?XAX?N?JAX?XA\AX?XCr@AXCZAXAZAXCXAZCXCZAXCR?FCXCXCZCZATCXCZAXCXCZCXCXAXCXCXCVC\AXCVCXCZCZCXAP?FCXC\CTAXCZCVCZCXCXAXCZCXCVEt@CXCXCXAZCXCXCXCXAXCZCXCXAXCZCVCZCXCVA\CVCZCXCXAXCXCXAXCZCXA\AVCZAXAXAXAZ?XAXAVAZ?XAZAX?DExDAT?ZAZ?ZAV?ZAX?ZAR?F?XAX?ZAX?LAJ?XAZ?XAZ?XAX?XA\?XAX?VAZ?ZAVAX?ZAZ?XAX?ZAX?ZAX?XAZ?ZAJ?L?ZAX?XAX?ZAXAZ?XAZ?XAX?XAZ?XAX?ZAX?ZAX?XAZ?XAX?XAX?ZAXAZ?XAZ?ZAX?ZAXAZ?XAX?XAZ?XAZ?XAZ?XAZAX?X?XAZ?XAZ?XAN?d@AZAT?B?XAZ?\AV?XAX?XAZ?ZAXAX?L?LAX?XAX?ZAX?XAZ?XAZAX?H?NAZ?XAX?ZAZAt@?XAX?XAZAX?PA`@?t@Ct@At@?^Av@ALAt@AbBAhAAnA?\AdA?v@?X?L@nA?Z?N?j@@p@@n@@x@@\@p@BpABx@DfA@b@DpADx@Bj@P~CJfBJ`BJrAB^BXLnAJlADb@Fh@Ff@Dd@NlALhAPrANdAFf@Hd@h@pD^vBVrA?BHd@Jh@FTDPNt@BJDRFXFXFVFXDVFXFVHXDVFR?DHVFVFXFVFXFV@HDNFVFXFVFVFVFXFV@FDPFVFXFXFVFXFVBFBPFVHXFVDVFXHVFXFVFX?BFRFXFVFXFVFVFXFVFXFXFVFXFVFXFVFVFXFVFXFVFVFXFVFVHXFVFXFXDVHXFXFVDVHXFVFVFXFVFXFV@@DVFVFVFXFVDR@BFXFVFXFVFXFVFXHXFVFXDTHXFXFVDXHXFVFVDXFXFVHVFXFVDVHXFVNp@FXFXFVFVFVFXFVFVFVFZFVFXHVDXFXHVFVFVFXFXDR@DFVFVFVFVFZFTBJBLFXFXFVFVFXFXFVFVHXFVDVFXXhADXHXFVFV?@FVFXFVFVFVFXFXFVFVFV@DDRFXFVFXFXFXFTFXFTFXFXFVFVHXFVFZDVFVHXDVFZFVFVFVHVBPBHDVFVFVFXDR@FFVFVFXDVFXFXDVFVTjAFXDXFVFZBN@FDVFTDXFZDXFXDTFZDZFXDVDTFVDZDXFVDZFTDZDXDXFXDXBL@HFXDXFXDVDTDXF\DXDVFVDXDXDT@BDXFVDXDXDXFZDVDVFVDVF\DXDVDVFZDXDVFXDXFVDZDTFX@JBLDZFVDXDXFXDXDVFVDXDXFXDXDXFXDVDXFXDXDTFZDVDZFVDXDXFXDVDXFXDVDZFXDVDXFXDXDVFXDX@BBRFXDXDXFXDXFXDVFXDZDTDXFTD\FVDXFXDXDVFXDXFXDXFVFXDVFXFVDXFXFXDXFVFXFXDVFVFVFXFXFVDXHXFVFXFVDVHXDVFXFVHXFVFXFVFVFXFVFVHXFVFXHXFVFVFXFVHVFVFXFVHXFVFXFVHXFTDP@FFVHXFVFXFVHVFXFTFXDPBDFVFVH\DTHXFVLd@H`@Nl@HXFZXfAFXFTHXH`@Rx@J`@FXPn@FVJb@BJLh@J`@HZDTPn@Np@FXHVNp@HXFTFZFTPn@Np@HZDTJ\Nl@Lf@@DPr@Nn@Np@Pr@T~@DRLd@Pr@FXFTFXFTHZFTNp@Nl@@DNn@J\Lf@Pt@FXHXJd@Jb@`@~APr@Np@Pn@FZFRXjARx@ZpATbADLPr@Nn@Np@Pn@Np@Pp@Nn@H\DPHZDTJ\DRJ^DPFXPp@?@Nl@Pp@Np@Pp@Nn@Np@Pp@Nl@Pt@Pn@Nr@Nl@Pn@HZDTPr@Pp@Ll@Rr@Nn@Pr@XjAXjANl@Pt@FVNp@Pp@Nn@Pp@Pp@Np@Pp@Nr@Pn@FVFXNn@Pr@FTHXDRH^Pp@Np@Pn@FZFTPp@XdANn@FZHVNl@?@Np@HZNn@HXFTFVFXHVFVFXPp@Np@Np@FTHXPp@Np@Pr@Nn@Nn@HVFXNp@Pp@XjAFZFRPr@Nn@HVNn@Np@Pr@Np@HXFVFVPp@FTPp@@DDRFTPt@Nl@Nr@T|@Ld@FVNn@HXFVFZHVNn@FZFTPp@FVFXPn@Np@Np@Rr@Nn@FVFVPp@VhAPn@Np@Pp@?@Nn@Pp@Np@Pp@Np@Pn@FX@@FVFVFTHZDVHXFXNn@@BNl@Rx@Ld@FXPn@Nr@FXPl@FZFVHXFRFXFXPp@FXPr@FVHVBNT~@^zAH^Pn@Pt@^zA^~AZpAFVDNJ^FZNn@Nl@J^VfAHVFZZlADRH\DRHXHZDPH\XfAZtAv@~CNp@HVDTXfAH^Lh@Rv@H^FRPv@h@vBNn@FXPl@VhAFXJ^Lf@H\FTNn@HZNp@Tz@T~@`@`BFVDTH\`@`BNp@HVFZh@xBFVXdAH\BJLd@Nn@FXNp@HVjA~EPn@Np@DPZnA?@Rv@FZLf@Rx@DNLj@J\FXFXNn@J^?@ZnAJ`@FXPn@Np@HXFVFXFVHXNn@J^DPFTPr@FVNr@`@`BFVL`@Lf@Jh@Lf@Lh@Lh@Tx@FTNr@Pp@FXJ^H^Pp@BHFV\vAJb@Pp@Nr@HXNl@H^FRFVFVHXHZDRDTPr@HXFXXhAFVFZHVXjALl@Pr@HVDVHVNn@b@dBDTH\Nn@Pp@XhAFZLd@Pv@HZHXFTHZNn@FXHXFVFVFXPn@FXBLJ^HXDTPt@HVFXFTFXFVHXFVHZFTFXHXFXFVHZFRFVNp@H\Nn@XdAFXFXJ\DPFVFXHXFXXhAFXFTFVXhAFVJ`@?@BFRx@Jh@Pl@Jf@FXHVFVFXPn@Pr@Pr@d@pBNl@XnANl@Rv@T~@Lf@VbADPHXJ`@Tz@Rx@Pl@`@~AZjAp@zBp@~Bf@dBt@bCh@bBj@bB^hARl@`@hA`@lA`@hAd@pAXv@Xx@jAbDtAzDp@jBr@rB~@lCjAbDf@tAN`@Ph@b@pAFLbA~CJXb@vATp@HVNf@b@xAj@lBZfAHXVz@j@rBDP@DDNPn@J^^vAJ^Nj@DPb@dB^|A\zARv@ZrA\`BR|@DTDPH\BJJf@XtAH^Z|AXzAJh@H^Lr@Jf@BNFXJh@Jh@@FH^VrA@FNp@h@tCP~@Nv@@BJh@Lp@Lr@DTJh@BL^lBJh@Jh@ThALl@`@tBDTRfA@Bh@tCZ~A?BNt@j@tCLn@l@|C`@xBDVPz@Jh@TlAv@~DNx@\fBVjAP`ABJZ~AP~@h@pC@HPx@Lt@FVFZDRF\DVNr@DXHb@Lj@Jn@Lj@Pv@Jl@Nt@Z~AZfBd@|BLp@TlAF\\`BDVFXDX\dBDVNt@P|@XvALt@FXNr@DRF\FZDVLn@Jj@Ln@Jb@DXFVPz@Jj@DXFXDVDVF\Jr@Lp@DXDXJt@PhADZDZNlADZD\Hl@Hp@JbA@JFr@DXPfBBZBZFr@BZJpADt@Dn@HpADr@@XJhBDtAFlABt@DpABnA@Z@lABrA@nA?V@Z?X?x@@V?bA?L@p@?\@xC@jC@z@?dA@nB?v@@t@@bB?|@?Z@X@`D?Z?x@?T@rA?X@P?F?V?\?R?F?V@Z?d@?L?\?Z@r@?Z?X?P@b@?v@?r@@b@?J?z@@hB?X?^@X@zD?x@?V@lA?Z@pA@fC@p@?v@?t@@X?\?X?X?T?^@Z?X?t@@Z?r@?Z?@@\?jA?Z@t@?X?X?t@@X?X?z@?R@\?\?f@?TBzB?fCBfB?rB@l@@pB?~BD`H@xB?f@?^BfE@jB?t@FvN@tD@xA?l@@zABnG?lABvF@v@?r@@d@?j@?t@@Z?p@@fCBxE?t@@bC@zB?F?b@@j@@bE@h@?j@?j@?@@xA?n@@tA?h@BrD?x@@bC?|@?f@?n@?P@\@T@tB?~@@j@?lA?Z@|A?N?Z@N?f@@jA?dA@|@?xB?R@rA?T@d@@hB?j@?~@@h@?Z@bA?`B@t@?nA@Z?v@?p@?r@B~B?zA@bC@bDDpF?pA@jB?V@hC@r@?t@@pA@hC?lA?Z?n@ApACpAA\At@Cl@AZCZAXAXCZA\Ep@C\OfBGt@In@Ix@In@E\CTEVEXEZEVGZEZMx@GTEVMl@EXCJENERIZG\ERIVGVGTAFGTGVKZIVOh@I\IRIVIXGTIXITIXCHEJIVGVMZEPKVGXIVGPITAFIVIXITIVIVIXITGVGLAFIRIZIVIVIXITIVIVM`@Od@IVIV?BGRIVIVIVIVIVIXADGNIVGVKVK^ENIXITIXITIXITIVGRABIXITGVIVIVIVIVIVIXIVADGPITIVGVKZIXIVITK\Of@KZIVSp@GVIVCHELITIVQh@KZGVADGPIVIVGRKXMb@CJKXGTITIVGVKXGTIXIVGN?BKXIXIVGRKXGVIVITIXADGPITIVGVIVITIZITIVIVIVGVITIX]fAADGPIVGRIX]fAIVIXITGTKVGXIVIVIVIVITCHEPIVIVIVIVIVIVIXIVITIXIVIVIVIVIVIVGXITIXIVGNq@vBaAdD_AzCELeAjDq@tBq@|BGRkBdGmA|Dq@|BCHEJIXIVIVIVITIXGPIZKZGRIVIV?@ITIVIVGVIVIVIVGPK\IVIVIVGTIVABGRGRKZIVIVGVIVITIVIVIVGRELELIV[fAIVIVCJEJGRKZGTIVIVIVIVIVIVIVCJEJEPK\ITIVIVIVIVGVIVIVIVIVABGPIXIVIVGTIXITIXITIVIXITGVIR?BIVIVIVITIXCHELIVIVGTIVIVIVITIXIVIXABEPIVIVKZGRIVIVABEPKXGVIVIVITIXABGPGTKXGVIVIVIVIVA@GTIVGTIVIXIVITIVIXITCFENIVIVGVIVIVIVIVIVIVIVGTIVIVIXITIVIVGVIVIVIVCHEJIV]fAIVQn@IVIVIVIVIT?DIRGVIVIVITIVIVIVIVGVCFEJIZIVIVGRKZGRIXIVITIXIVIVCFCLKXGVITIXITIVIVIVGTIXIVIVIVIVITGVKXENADIVIVIVIVIVGTIXITIVIVIVIVIVIVGVIVIVIVITIXITIXIVGTEJCJIVIVIVIVIVGVIVIVIVADGNIVIVIVGVIVIVIVIVENCHITIVIVGVIVIVITIVIVIVIVGTIXIVIVIVIVIVIVGTKXGVIVITIXIVIT?@ITIVGVIVIVIVIVIVIVGVIVIVIVITGRABIVGTIXIVIVIVIVIVIVITGVIVIVIVIVIVIVIVITGTIZGREJELGRKZIVIVGTIXITK^ENKXITGVIVIVIVGRABIXITIVGVIVIVIVIVIVIVIVIVIZGRIVITIXITIVIVGVIVIVIVGPADIVITIXIVGVIVELCFIVIVIVGVKVGVITIVIVIVIXITADEPIVIVIVIVIVIVGVITIVIVIXIVITIVIVGVIVIVIVK\GPIVIXIVGTIVKXGRIVIVGVKVGVIVIVIVIVIVIVIVGVIVITIXITELCHIXITIXITIVIVITIVKVITITKVKVITKVKTKTKTKVKTKTKTKTKTMTKRMTIPABMTMRKTMRMTMRMRMRMTMRMRORGHEFMTOPMRORMPOROPORMPGFGHOROPOPOPEBILOPOPONQPMNQROPOPOPOPOPONQROPOPONORONOPOPONA@OPOPOPOPOPMLABQPMNQROPONORONQRONMPONA@ORONOPQPOPOPOPMNEDKLQPMPOPQPOPONORONOPOPOPOPOPMLSTOPOPOPQPMNOPOPQPA@MNOPMNQROPONQROPMNMNSTONORONOPOPOPA?MPQPOPOPOPQPMPQPONOPOPGHEDQROPOPQPOPOPOPOPOPOPOPQPCBKLONOPOPOPOPQPOPOPOPMLQTOPOPMNSTMN?@MLQTORKNQTORMRKL[d@]h@[d@QXGHS^KN[j@KPOXKRKPADYh@KTWh@Wf@MZKTKTUj@KVWn@Sl@Ul@KVIVIVKTSl@IVITKVITIRi@|AWr@Qf@M\Sl@KVIVKX[z@_@dAYt@Sl@ITKVIVITKVIVKVIVITKVIVITKVGTKVO`@Ob@IVKVITITKXQd@Up@GLCJa@hAMZCJQd@KZCFM\GNIVUn@ITKXEJADEJQd@GPGRM\IRKZUl@Un@Sl@IRKZQf@ITKXGPM\Sj@GLOf@MXy@~BGPM^KXITGNUr@]~@CD]`AUp@i@|AEHc@nAKVWt@GNITM`@Qd@ABQf@Wp@K\KTSl@IV[|@M\ABe@pAO`@Qd@Sl@]bAUr@Y|@ABQn@Qn@Qp@St@U`ACPK`@Mn@GXMr@Mp@Mt@EXEVMt@Kr@In@E\CTE^Gr@Ir@I~@G~@IdACt@GnACl@Ex@At@CnA?b@Av@?r@?r@?zB?b@?vC@vE?fA?j@?|B@dJ?zB?~A@|F?|@?pG?`A@tE?xB?nG@lF?pF@xH?`A?x@@dJ?h@?pH@nE?dB?T?v@?zD@lA?|C?rD?d@?zA?~@@jB?vA?rC?`A?`A@`E?xE?\?`B?`B?B?`@@N?|C?h@?vA?vA?x@?Z?@?jB@|@?pB?hF?F?rC@nAAF@pB?vF?|C@xB?V?B?xB?b@?|@?r@@rC?z@?B?tA?|B?dC?~@@zB?jA?n@?nD?pC?~B?rCA~B?z@?xAAjA?v@?|@Al@?FA~DAz@AfB?~@A~AAdACtD?z@AbCAnAEtFA~CCfC?pAAnAAnAAnAApA?hA?^AJ?l@Ar@?X?\?VAp@?v@?v@At@?t@?t@?p@?x@?D?j@?D?n@?nA?pA@pA?r@@pA?v@@r@?lA@v@@v@@lA@nA@rABlA@tAB~A@`ABlAF|CDlBBbBBn@?^Bv@DlBDfC@t@Br@@v@@r@DnB?HB`A@t@@J@h@?@?\Bl@?^@V@j@?N@TDvB@V?d@@NBhA@lADxABhABfBBnA@v@@N@d@@pABlA@zA@fA@p@?T@\@xCBhD?rA@v@?^?`B?v@?pA?fB?rA@jB?nA?pA?jA?tA@zC?xF@zC?zKBjR?T?lB?j@?nD@xA?zA?nG@~B?rC@xG?L?bD?F?vA?zA@pD?bC?bE@vB?pA?rG?vB?N@dA?lA?dD?`D@vC?R?bA?`B@`D?rD@|H?n@?x@?dA?V?vA?lA?fB?Z@X?Z?rB?v@?r@?h@?^?N?d@?Z?B?j@@lA?p@?X?v@?H?|@?nA?nA@R?v@?`F?bF@xE?nA?vA?|A@x@?X?t@?F?bB?hD?B?b@?B?B@^?J?f@?B?V?H?D?B?P?L?`@?V@xG?pH@l@?`B?`@?V?tD@fF?@?n@?p@?|B?nA?tA@V?xC?j@?xA?D?rA?lA@~C?xC?nB@`A?pC?fA?j@?j@?hA?L@zB?pD?|@?jA@jB?~A?xF?hA@dC?t@?rC?d@@lB?r@?dC?nA@jF?lB?lA@~D?P?bA?`B?hC@t@?jB?p@?bA?dB?j@@r@?dD?j@?l@?l@@lG?b@?T?bB?^@jA?l@?vA?l@?z@@lA?b@@nABdB@t@Br@@\@X@VDr@Bh@Dj@@PDl@Fx@B\LlAB\Hp@Hr@DXDVBZDXFZL|@Lr@Hb@Hh@DNBJJn@Lj@Nn@Nn@XhAV~@BJL`@Pn@Tn@HXJZRl@Xt@Rh@HRHTRf@DLNZTh@Rb@Xp@Vd@Rd@PZZh@Xh@dAhBVb@v@rAT`@PXT\DJj@~@PZf@z@x@rAR\?@V`@@@R^@@T^T`@dAdBJPDHHLr@lAFHZh@FL`A`BZf@\l@j@`AV`@@BR\DHd@~@DDZr@P\HNZr@Vh@FNb@hAVn@FPDHPd@t@rBPd@`@jA@@r@pBt@pBPd@L\h@xA`@hATl@JZFN^dAXv@JTJXJZTn@BDp@lBXr@HVPd@@DXv@Zx@p@lBn@dBf@tAL^JX\~@h@vAPf@Vt@@@f@tAJVJZ@B@DBDBJXv@Xv@L\n@bBp@jBnAjD\`AN`@Xv@@@?@FNFR@?FPXx@Zx@Tn@LZb@jAFPb@nAFNHR`@jATl@L\Zx@Xx@|AfEdAxCt@pB~@lCd@tAVx@\bAHVNd@T|@J`@FTDRLh@FVH\Hf@Lp@Jh@DRDXHd@DVDPHh@Fh@Hh@Ff@@JFd@BLBXBRD^D`@Dl@Df@Dh@BT@XBZ@VB^@VBX@X@Z@X@Z@X@X@r@@t@@P?j@?B@T?J?B?x@?Z?t@?b@?`@?J?r@?t@?l@Aj@?V?tDAhD?`@?fA?r@?h@An@?f@?pA?L?@?`@?j@?X?PAj@?j@?j@?H?`@?x@?N?fAA~D?R?bC?x@AX?nA?t@?t@?t@?t@AT?l@?`@?F?fBAjE?N?jA?V?D?VAvE?xAAvC?jA?V?l@?NAl@?J?r@?r@?X?~@ApA?j@?Z?X?X?r@?j@?j@?TA`D?nA?t@?t@AX?^?T?X?Z?n@?n@?J?X?f@At@?b@AxA?@AP?ZAN?J?NAH?ZCp@A\CZAX?BCj@ATCb@CXEf@ALAPARE^?DE`@AHEh@AH?DAJCNCRCTCZKr@ALCPGb@EVEZER?DGVEXEXGXEVGXGXEVIZMp@GXGVGXGVERI\AHMh@EVOl@GVEVGXEPI\K`@CPGVGXy@zDIXMn@I`@CH}@dEe@vBCJERWlAGVETKb@Mn@GVI\ERMn@Qt@On@Kh@Qx@CJENa@lBAFA@CLEPGXGZGTEVGVI\UfAEPADMp@GRADGZGXEPEXIZEVGZEVCNCPERCTEZCPAFAFAPCTAHAJAJAVCXCZAXC\AX?DATAT?LAN?VAP?F?Z?X?Z?^?V?H?H@D?N?J@^@V@X@X@P@J@T@L@L@P@RBPBXBVBT?@DT@NBTFZBRDXDTDVDT@DH\FXFV?B^tADNDNHTFRBFPj@Tn@JVBFFLHTb@dAJVJTVl@JT`@bAJTJVb@fAHPVn@Rd@HP\x@pA`D~@zBN^P`@\x@JV\v@N`@Vn@JTJTJVVl@JTHTHRn@|AJTJTVn@DLfAhCN^JTJVHRJVJVJVFTVp@Z|@d@xAV|@Tx@VbANn@FTFTNv@Nn@P|@@HJl@BHBNF\F`@BN@FDVBP@FDb@Hb@D^BZF`@Db@Db@D^?D@LH`AFr@Df@@NDt@@JBZF|@Bh@@@LpBBj@@@N`CBd@\nFDt@FbAF~@RrCBn@Dj@Df@TpDJ|ABb@NxB?FJvA\lFF|@Bj@@B?@Bb@b@fHLbB@PN~B@TDj@B`@B^Dp@J~A@DDh@Df@?BFl@BXBXBX@@Fp@Jv@L~@@FD\BNF^D\Ln@\xBTnAPfAZjBLp@VbBZfBHf@b@fCJj@z@fFRnAFVHl@ZfBLr@Jp@FXDXJp@FXBLBNDXP`AF^FZBNHf@Hb@Jp@Lr@RjARnAJh@DZTpAJl@TnABNRpAFZTtAPbABLNz@~@xFJj@F\RlAPhAFXJp@Lr@Lp@Jp@Lr@Hd@N|@Lp@Jr@DTDTLv@FXF\Hl@FXDVHf@BHFb@P`ADP`@dCBNDPDTDRDXFVDNBNDNNp@FVFV@HDLFXHVFVHVBJBJDLBHHX@D@BDJBHDLBLDHBJDLDJBHBJFLFT`@dAXt@Rh@Tf@Th@\t@Rd@Vh@N\nApC?@f@fAdA~BjAfCt@dBh@jA~@tBbBtDRb@nArChAbCXp@jB`En@vAn@xAhAdC\t@P`@Vh@Pb@j@lAl@tA|@nBlBdElApCLVXn@Rb@Rb@Rb@nArCRb@Rb@NZBHf@fAf@fARd@j@lAJPb@~@JVRd@Rb@^x@JRDJFNl@rAb@`A`@|@JTLV@@BHBFLTLZHPLXTf@@@JRJTLZHPJRJTBHDJLTJVLVFLBDJTHPNZJTJT@BFNLXZn@HRJRLVHRLVHPLZJTLVJR@BHRJRFLDJJTJRJVJRHRLXJTBFFLFLN\FLBFJTLXHNLXLZHPJTJTJTZn@HRHPRd@BDf@fALVHRLXHPn@vALVJV^v@Tf@Vj@`@z@JVJTJRJTJVBDVh@@DTd@`@~@JVHPDHTd@DLDHJVJTLVHPJVDJFJx@hBZp@HRBFJRHRBFFJHRNZRd@N\JRJTJRHRNZLVN\FLBHP^JTJTLVJTHTRb@BBLZJRRf@NZJVR`@DHLVHPJVJTJTJVHRLVHNJV@?BJLTHPP^FLLZRb@LXVn@DHL\BFL\FLFRHVJXHVHTFPBLBH@DBLDLFXT|@HZFZFZFVDVNr@DVDXJp@DXDXBXDXBX@BBVBX?@@H@NBX@L@J@XBXBX?N@J@T?H@R@X@Z@X@Z?@?@?V@P?H?X?X?X?Z?N?F?Z?F?RAV?B?XAL?JAX?DATAXAXAL?JCXAXATA??BCZAXCXCZCVCZAHANCXCZAVCZCXCV?@CVC\Gr@UvCq@vIc@`GGj@Q`CYlD]vE_@vE[zDo@vIQtBC^y@rKOhBAD?FCXCXCXAJC\Eh@SlCYtDEj@ADo@pISdCKnACZC`@CRAHw@bKEj@UxCAHARYrDCTCXCXCXCZCXCZCVCZCX[xDEj@Ed@AXCXCXCXCXCZAXE\IlAEp@CXGt@CXMhBGp@AXCZCXCXCXCZCXCVCXCZCXCXCXCXCZAVCXCZCXCZCXCXCZCXCXCXCZC\ATCZCVCZC\CTATE^M`BC`@CXGt@CVGt@CZEn@E^AZCVCXCZCVAZCPEn@OvBCVCZCXAJAJ?@CZCVGt@CXS`CCVC\?JCLAVADATCR?BC\CZCXAJAH?@CZCZCVCXCZCZAZCXCN?FCZCXARADCXAN?DE\CZAT?BEd@Eh@Gr@AFAPC\CTCZCZAXE\AP?DCXAJALCXCZCXARE^CZCXEt@Gr@CXCZGr@?HCPQbCCXGp@CZCXCXCZCXMhBALAJCZAHANCXCZCXCVCZCZEl@C\?BCXCXCXCZEl@E\AVE`@ATADAVCXCXCVC\?BGl@Gv@CXCXAXCXCXCZCXCZCXCZCXALEd@CXAZCXCXCXE`@ALC\CZCZCXGt@AVCZCVAH?BAJ?@CXCXCXCX?DCTAXCZCVCZCXI~@Er@E`@]tEo@dIItACREj@GbA?NA?Cn@GnAEv@Et@EnACz@ALA^Ar@ExAAdACr@?D?l@?FClBAzA?r@?f@?`@@v@?p@@lA@fABjBD~BFxBJnC@b@?@Dt@Bv@Dr@J~A?@BX@NFlANnBN~A@L?@Df@?@Ff@PjBNtANrAJv@D`@Jp@D`@Jr@?BRnA\`CHd@X|ALt@\jBTnA@BTlABLP|@Np@DRRbADNDNJ`@BL@FHZDVNn@DRBJDPHXDVFVFX@FBL@BDVDXFXDVBL@JDX@HBNf@vCF\DXJh@F\@FBL@FTtAJh@DXBNTnAVrABTFXDVBPNz@TjADT?D@DJh@@F?BBLDXFVDXFXDX@F@DBJDXDXLp@FX@LBJDVFZBJ@J@BDTDXDXFX@DBPFXDZDVJj@@FFVDXFXDXHb@BNDXFXDVLr@FXFd@BJBJBLDXFXDXFXDXDXFV?B@BBPP`ABHBP@FDXFXRjAPbA@FRjABJ`@~BHb@H^BRRjABNBP@B@Jn@pDLr@DVFXRhAF^BRFVF`@BPFVDZFVJp@FVDXDXDRBPBJDVFXDVDXFXLr@XbBDVBL@LBJBJDXDVDVH\RhADVDZFX@FBNDXJp@BL@JLn@DZFXDVDXFVDXFX@JBLFVDXFXDXN~@Jd@DVDXFVDVFVDXLp@DVPfAJf@BNDVFXBLFb@FXDVFZDVFXf@vCDVFVDXDXFZDVDVFXDVFXDXFXDXFVJr@Nx@DPDVDX`@zBDXLr@DVFXJn@RnAFVN|@Hd@DXDXFXDXLp@Jn@H`@Jj@DXFVDZFXDVDXFXDXBLBH@HBNFXDVFXDVFXDXFX@BBRDVLr@FVBP@DRhABNBHDXBL@JFVDXFXDVH`@BPDVDVFXDXDVFXDVFXBN@HDT@BDXDXFXDVFVDXFXHd@@LFVHb@@LFXDXFXDVDXFXDXFXDV\tBJd@BTFZFV?@DTDXFVDZLp@DVRjADXFVF\DTDXDVLr@DVDXFXXdBDXFVDXFVDXFZBJFb@FVDVFZDTFZDT@DJj@DVBJBLDVDZ@HBLRlADXDXDVLr@Jr@FXDZDTFVDZFXDXFVDXFXBPH`@FXNp@Lr@FVDVFXDVFXDVDTDXFVDXRjALn@DVFZDTDXDVDX@HBLDXDXFXDXDXPjAFXDZFZDTH`@BPFXDXDR@DDVDXHd@BLFVBN@HBNBHDVFXDZDTFVDXDVFVDVDVDVDXBP@FDVDXDXDVBL@JDXDZDVBNHd@DXDXFXDVDZFXBNBJDVFVFXDVFXDXFXFXDXFVFXDVFVFXDVFXDVFVFXDT?BFVPfA@BDTDXDXP|@Hd@DZDTFXZdB`@|B?D@BBNDVb@`C`@zBDZLr@@BHh@FXDXFXLr@DVbAzF@JNz@@BDXZdBt@jEDVFXDVDXLp@Lr@DX`@|BDVFXDVZdBFZDVBPF^DVDVJj@FZ@DDVDXLr@FVRjADVDXFXRjADXRhAFXF\BRDP@HFVDXFX`@~BDVFZDVFXDZFVDVDXFXDXF\DRFXDXDVDPF`@FVDV@BDVFZF\DPDVBL@B@FH\DPFZBHDLBJ?DBFJb@BJHV@FFP@FDNHVDLBHHVHXDLBFHVFTJXHVDJNb@JVDLn@bBHTJV`BnE^`A~@dCd@rAVl@BJN^JZTh@HVFL@F`@dAj@|AJTHVJT^dAJVHTJVHTb@jAFNBDv@tBHTFR^`ADJDLJTHVJVHTJVFR@BJVL^Nf@HZHTNl@FVFTFXFXFXFZDRFXDZ@DJl@BP@FDVDXDX@B?DBLDb@BNBZDX@TJhADp@Bd@@XBr@B|@Bz@LhEFnBD~AFbBBp@D~A@RBx@?FBn@B^Dx@@`@@NDj@BZBf@B\Dd@BTD`@BTD^BXBTHj@Jt@@BDZBTJp@Jr@Lv@Jr@DXRjA?@BN@HFZHf@Jn@BNDZ@FRtADPDX@FDXDXFXF^Lt@@NLt@DT?DDTDXDVFZDXDXDVDXFX@LBJDXDXDVFXDVDZDVDXBN@FFZDVBXFXBV@DDTDVDZDXDXDXFVDXDXDXFXDXDXFXDXDVDXDVFZJr@FXJp@DXDVDXDXFXJt@Lp@DXDVDZRhAHl@F\DVJt@Lr@DXDXLp@PlADXFXb@tCDT@FF\BRDZFVHh@DZF`@FXBTRlAFZDVh@lDF^PjAFXDX@JBLDXDVDVFZJr@DXFXDVBXFXDXFZBRF\DXDVDXFZDTDXDXDXDXDZPjADXFXDXDTFZDXFZDVDXFXzAvJV~ADZZjB?DLr@ZrBHd@Jp@Lr@VfBLp@VfBf@zCPhADZ^|BJr@XfBF\b@tCf@zCj@pDJr@Jp@l@rDPlALp@XdBx@hFj@rDXdBn@bEn@|D|A|JdBzKv@`FXjB^|BJt@~@|FHb@@JfA~GLx@dAxGz@pFJh@RtAhBdLbCrO@JTrAHh@hAfHHh@r@tEpAjIRjATzAh@fDJh@\|BF\BJ~@fG\xBf@`DJn@RlAfBhLDZ@HLt@PbAFf@VzARlAJr@PdAF\Jr@PjARhAJr@\zBF\Jr@RfAHn@FXDXDVJp@FZBVFXPhARlA@L\rBJp@PhAJn@FZJr@XbBJr@DVDZRhAJr@Jp@Lr@DXJn@TvATxA@BV`BJr@XbB?DJl@Jl@Lt@DXdA|GDVPfAXfBDZDTDVLr@Jn@Jr@PfAHh@Hd@Lr@BVRjADZPhARjAXdBPjAHd@TvAJl@NfANz@DZ?@@LF\r@lEPjAV~AF`@H`@Hf@Jr@DXDVFXJr@Lx@Jj@VdBDVHd@Hj@PjAFh@D\DXJr@NlAFr@Hj@Hz@Fp@LlALtAL~AJvAJfB?@Dj@Bh@?@Dh@D~@@^@JBj@Bj@@f@@Z@P@XB|@BhA@L?V?FDvB@j@?V@V?B?Z@r@?j@?B?Z?^?fA?@?d@?f@?v@At@?\AnAAp@ChBAXAj@A^AZCv@Cp@AZAVCt@EfAEz@Er@KhBEl@YrEG|@G`AIjAC`@[vE?@KtA?FInAGp@Cb@CXAPC`@AVCZEl@C^ANG|@CZIlAAXCZEr@CXCXEp@Ev@CVEt@CZAT?DEh@Ej@Cb@AFG~@AVEj@Eh@ANAPEt@?@Eh@G|@IzAEd@GjAGv@Cd@CZIlAEt@KrAC^KhBEj@OxBEj@Cj@Gt@Eh@GdAEr@CXEp@CTCj@Ej@El@Eh@G~@MpBCf@Ej@AJANANCb@QhCEl@Cj@ADInAAZO|BC\Ej@Ep@s@~KKfBCRGdAEt@AXEt@Ad@ALCt@Cr@AHAh@Cl@Ah@ATAr@ANA~@AVAZAz@?j@AnAAF?hA?hB?d@?N?t@?P@`@?t@@jA@v@@x@DrBB~@@V@\Bz@Bp@Bp@@V@ZF`ABr@B`@B\VdFFxADx@LzBH~AFpAHrAFlAHvA@RBp@@ZFfB@N@d@@R@DBt@@LF`A@HDt@?F@JF|@Bb@@J?NBXDt@?JB`@@ZH~ABf@BXFbABb@H|A@HDr@Dt@Dr@?D@TBXHhBDr@Bh@@J?@@\BXDj@@^Bb@Dn@Dp@B`@Bp@BX@P@VFlAB\@T@RDz@BXDt@?DL|B?DBl@BXDx@NxC@VJlBLfCHhBDx@Bn@RtDLfCPfDDz@HdBDv@JtBJ|AFjANdCHjAD~@F~@FzABd@FbA@b@Bl@F|@Br@BZ@X?PFvADt@@\BVFnADr@@XBZHfBBXH~AB`@JzBBZDp@Dt@FpABp@HnAJrB@NL~D@BBD@DF|@FxANtCBVVdFFhAF`A@VLbCFrAF|@RrDFtAHdCDr@@ZDp@hA~Q^xGH|ATpFFtAN`DBXFnAFnATrEP|CRvDN|CJxBHrAFrADr@JzBDp@B\?J@RFhAJhBBXBr@BX@X@XBV@\BX@XLbCHnA@Z@VDt@@XBX@XB\HfBBVBp@JlB@XBX@ZDr@@VHnABj@?DDx@@J?HHjADx@@Z@XBR@`@BT@ZDv@HrADfAB\@TBZ@\Dn@BX@XDr@BVBl@Db@Dt@BVBZBXFj@?BDj@@JBRJdAHv@BZHv@D\BN@HBTD\BTD\BN@HDXFf@Fb@BP@FDXDV@JBNBN@HBRLt@F\BRBPFZBNF^Hb@DVFXDTX|AHb@BT@@DXFXRhAH^BRRhAFXJj@@DDTLr@TlADXDTZdBTlAl@bD^vBJl@Jl@d@`CDXDTLr@FXDXFVLp@Jp@FXDVFVDXFXDVDP@FRlAFX@DBPRjAFZLn@DXTjADVDP@F?BDRDVFZ@FDNDXLp@DXFVDXFVF^RfAFVLr@FXJl@DP@JRhAFX@FBJDZFXDXDVLp@TjADZFVDTFZDXFVDXDVFXDVFZLn@Lx@V|AJn@?@Hf@Lz@DRDXLr@Hb@DTHh@Pz@r@lDNv@HZl@dDFZR~@Fb@Ln@F\Lp@Nx@P~@Lr@RbA@LLr@FXJj@Hf@xA`Ir@zDDXb@`Cf@lC?DFXDTLp@?@X`B@?Lr@DXFXDTF^Jn@BNFd@DZHj@DXBT@BD^Fh@@JFr@Fh@@PDb@?@B\@NDj@@NJ`BBZJvBDn@Dd@Dx@HrADz@B\HxAJfBDr@Fz@@RH|ABb@Fv@Bj@HzA\~FDr@BVDv@F|@?@HxADn@?BDr@JhBDj@HxAXhFDl@B^FhAB\Dr@?@LbCDp@LhBHzAJdBBh@BXDv@HxAJ~AHtAT`EZfFDr@Dv@PxCBZ@XDp@BZ@ZBX?BHjA@XBV@ZBX@X@FBj@Dt@BX@\HlA@L@\Dr@Bb@BX@VBZ@XBXJhBRbDH`BHnABZ?F@NB\@VBZ@VDr@BX@XBZ@XBV?@BZ@XBXDr@@ZBV@ZBV@ZDr@BX@XBT?B@ZDr@BX@XBX@XBX@XBXBZ@XBZ@XBX@XBX@XBX@ZBX@XBXB^H`BB\@XBXBZ@VDt@BVB\@VBXBXBZ@VBZDXBXBXDXDXBR@DDXFVDVDXFVFXFXHXDRHXHZFR@DDPHT@DFRHVHT@BHTBDFNJVJVHRVl@JTrA|Cb@`AP`@Zv@b@bALXFLZr@JVFLBFTh@Xl@Rf@|CdHHR|@pBl@tALXHRJVVl@n@vAJTLXLZnArC@@Rf@Xl@Vl@Xp@JTHPDJDHJVRd@LVDLDFDLJTRb@HTVj@Tf@HPd@fADJRb@JTJTTl@JTBDFNHN@DVj@BFNZJVBDrA~CVj@HTb@`ALVJTDJDJHP\v@Rb@N\DJJVLXHPb@bAJTp@|ApAxCVj@Vl@Xr@@BP`@LZd@lAXt@BJFPHPHTf@xAJXHT`@nArA`Ev@~BJXLb@\bABHFNDLHVJ\Nb@r@tBPh@n@pBVt@j@bBlAtDDPh@zAf@`B^fABHn@nB\bAf@zAFNVv@Rl@DNZ~@nAxDXz@FR@B`@lAVt@DNBFv@bCTp@@BVt@v@bCPh@p@nBRp@HTTn@\bAbAtCjBtFJXJZTt@^bA\~@JZVr@DNTp@Tn@HTDN@DVp@FPHVBDHTTp@Z~@JVJZHTDNL\JXPf@L`@Pd@Rl@L^HTRj@HTL`@DL^dAJXFTJVHTHV\`AJXJXPj@JVL`@N`@h@|AJZ`@hA`@lAPd@FR@DFN`@jANb@?@Pd@Vr@JZN`@Nd@@DVt@Xx@Rl@Nb@Xv@DN@?l@fBTp@DLL\Tr@r@rBf@xAJVXz@Nd@nApDL\HTPh@FP^fAHVJTVt@?@FPPf@Z|@Z~@Tn@Tp@Pf@BFRl@JVRl@Nb@Xz@Rl@FLVv@Tn@L^BFNd@N`@^hATn@HTHRTn@ZbAJX^dAJZFR@FPh@HTFTJXFVPj@Pn@BFDPFTn@~BBJJ`@Pr@Pt@Lh@HXDPJd@Jf@H\Np@Ln@Np@Hd@DRJj@RhALr@Ln@D\DVFVJp@DZBLF`@Jr@BTDXFb@Fh@DZJt@Hn@DZBXDXDXBXDVDZBXDXHr@DXDXBRD^Hp@BPJ|@BPF`@BVDXBTD\DZDV@PF^DZBXDXBXJr@BXTfBHr@DXR|AD`@DXHr@DXBXJr@BVDXBXDXJt@Hr@DXBVNlAFf@Fd@DXHp@NlADXHr@D^Hl@NlAD\Hn@DXRfB@HBNHr@DXNjAHp@D\DXX~BBVDZBXHp@DZFp@DVB^@NB`@BV@^B`@?B@^@X@`@?V?Z?B@T?Z?XAX?Z?X?X?ZAp@?\?Z?R?B?ZAX?t@?r@AZ?Z?X?Z?r@AZ?V?Z?X?ZAZ?X?X?X?TA^?X?Z?v@?T?X?JAL?Z?\AdB?t@?XAp@?B?V?Z?XAX?nA?XAZ?Z?X?X?XAt@?X?D?n@AV?\?X?F?P?X?ZAX?X?Z?X?XAZ?X?D?R?Z?Z?VAt@?V?Z?ZAX?t@?X?X?ZAX?\?V?r@AX?Z?Z?XAX?X?X?Z?Z?XAr@?X?X?Z?\AV?X?\?p@A\?V?X?Z?TA\?Z?X?X?ZAX?Z?V?t@?ZAT?D?X?X?t@AX?\?p@ApA?t@?r@Av@?pAAlA?lAAt@?t@?V?@?X?\At@?j@?^Ar@?F?l@?ZAr@?pA?r@AX?\?V?X?Z?XAZ?X?jB?f@?L@X?\@p@?ZBr@@t@?@Bl@@XBX@^BZBp@Bd@@NFr@Dr@Hv@Fr@?@BVBJJbABVDVDVDZDXBVJp@FZDXDVLr@Jp@@FBLDZHf@Hb@DZHb@BNDVDXLp@Jr@Lp@Jr@XdBDZFXJp@DXLp@DZDXRjARlAJr@Ln@Jr@DXLr@DXDXLp@Hf@@JFZJp@H`@BNDXRlAJr@F\BPFXRnAJp@RlADXXbBDZFVTtAPfA?DBNLt@Lv@BPFXRlADX@FBTRdADZLr@DVDXLr@Lp@Nv@DRFZFXNn@HZDTFVHXPp@FTPj@J\HVFVJVRn@Rn@Vn@Rl@JTFTVp@`@bA?@HRHVJVLXFRLXHTN^DLHRDHDLRj@r@tBRh@^hABHh@tA`@bATl@JTJVRj@JTHTHXJZRj@FLl@lB@F\`A^dAVn@Tl@LZtA~CVr@Pb@BDJVJTJXJVDJDHHTFPHVHPFTJT@DRd@?@HRVl@Rh@b@dAHRh@zAJZHRHVHXHTJXHVh@~AFN`@fAVr@Rd@DJHTj@|AHTJVTl@HTJVJXHTFP@BJTHXJVHTJTHVJTHVJVJVHTFP@BJVJXJVHTHT@?HTHTLXRj@Vl@Vp@HR^bAJVHVJVHTFNBDHVVr@HPHVN^FNHTHVJTHVJVHVJVHTTl@LZHRHTJVHVJVJVHRHVJVJVJTHTJV@BFPJZJVRh@Pd@N\HVHTJVJVHTHT?@LXTl@Xv@DHJXJVTn@Tj@Tl@JTJZHRDJDJ?@HRJVHVJXTl@JVh@xAJVVp@HRHTJXHRJVHTJVHTJVJVHTJVHTJTBJDJJVHVJTHVJTHVJVHTJVJVL\FNHVJTHTJVJXHRJVHTJXJTHTHVJVHTJVFNBDTl@@BHRHVJVHTJTJZHRHVJTJVDNBFJVHTLZFPJXRd@Vt@JTJZRh@JVHTJXJVHRJVHTJXHTJTHVJVJVJV^bATl@JV^bAJXTl@JTHVJVJXHRHTJVJVHTHVJVHTJTHTJXHTJVJVHTJT?@HTJVJVJVHRHVNb@FJJXFRJVJVHVHRJVJVJVJXRh@JXTj@HTJVHVHRLZHRHVJV@BHPJVRh@HTJTHVHTTl@HTDJDJRh@JVJXRh@Tn@Vp@Vp@Tn@HVJTVp@JVBHPb@Vp@Tj@Vn@Tj@Tl@JVTp@HTTn@Tn@Pj@^dAVp@Vn@?@z@nB`@dA^bAJV@DZ~@Rl@Lb@Pd@d@zAlAzDJ\\bARn@Tl@BDFRTl@HRHVHRJVJVHTJTJVHRHTLVHRJVHTJTTl@JTHT@BHPXn@JTJVJVJVLXTj@LX@DHRJVJTLXHRDJRf@BFXn@l@vAHT`@`ALXHRTl@HTFLBFTn@Tl@JV^dAHVJVJVHTJT@BHRHRJVHTJXHRJTHVHTJXJVHRJVHTJXHRJXHRJVJXHRJVHVFNBFHRJXJVHTJVHTJVJVHTJVHTJXBHFLTl@BHBHJXTj@@@Rj@JXBDDJ`@dAHTHTJTHVHRJZZ~@HTJVTl@HRJXPb@BFJVHVLVLZj@xAHTLXHTHTLZHRHTJVJXHTJTHTJVHVJTHVJT?@HTTn@JVHTJVHTLZHRHVJVHTJTHVJTHVHR@BJVHTJVHTJTJVHVJTHVJTHVJVJVHTHTJTHVJVHTTl@JVJXRh@Tl@Tl@JXHRJVHTJVJVRj@JXTj@HTLXBHDJFNBDHVLZLZZx@HVJVHVJVHTJVHVJVJVHVHRJVHVJTJVHTJTHVJTHVDHDJJVHTJVHTJVJXTj@HTJVHTJVHVJTHVLXFRJVDLBFLXHTHTHTJXJTHTBFDLLXHTHTLXHV\~@HRLZHT`@dADLDLTh@HTJVJVHTHTLZHTHRHTJV@@HTHTJXHTJTHVLXTl@HVJTHTHVXr@\~@DJPd@^~@~AfEZx@FRHT@BHTJTHTJTJXHTHTLXFRLXHRHVJVHTJT@DFPJVHTJVHR?@JVHTJVJTJXHTHR?BJTHTJVDJBHJVHVJTJVHVJXHRJTBHDJVp@HRJVHTJXHTVn@Pd@@DTl@JVJX@@\~@JVHTTl@Tl@Vn@BHDJJVHTJXHTJTHT?@JTJVHR?BVn@HRHVJTHTDJDJTl@Tl@HVJTBFDNJTJVHT@DRh@JTJX?@HRHTJVHTJVJVHRHVJV@Bh@vAFLBJJTJXFRJTHVJVJTJVDJBHHVJTHVJTHVJTHVJTJVHVDLDHHTTl@JTHVJVHTJVHTJXHRJV^dATj@JVN^Pd@v@rBRj@JV`@dALZHTp@hBN^@BPd@Rn@JTDNN`@JX@DDLHVJVHV@FDLJX@FDNHTHVHXHTHVDPBFHVFTV~@BHHVFXPn@FT@BPn@FVPp@FVFV@DDTPn@DVFVDN@HNp@FVFXDP@BFZFXLn@DVFXHb@BNDVFZBLBJHf@F`@DXLn@?BDVDXDXDVDXDZFZ?FHf@Fh@@HLdADTJ~@Hr@BZDV?DBRBXDXBXFr@Fd@@LBXPjBLjABX@BH~@Db@BNDh@Hr@BTFr@BVBZDXBZBRB\Hr@BZPhBDVBZFp@Hr@Fr@@FFj@Ft@LlAFf@@LFp@BXHt@BXBXBT?BDXBXBXBXDXBZPfBHt@BVBVBZHr@BX?BHp@Fr@BXDXB\Fn@DXBXBZBVDZBXBVBZDXB\@Bl@tGHr@Fp@LpAb@hEJnAD\BLThCNtA@RDXB^BTFt@Fl@Jz@Fp@Dl@Ft@BXBX@X@N?H@Z@Z@V@X?Z?X@Z?R?DAX?X?ZElAA\AVAXCXCXAZEXCXCXCXEXAJCLEZETCNGb@GXETABGXGTGXGVQp@Qn@ITSn@KVITKVITKTITITGPM\Ul@k@zAc@jAGNgAvCQb@_@bAq@`B_AdCe@lAy@|Bo@bB[z@Yx@KVKVIRKXUj@Sl@M^GTGREPADGVGXGVGVEXGVEXCVEXCZCZCP?HE^A\CX?NAf@A\?^?V?L?J?N?F?B@X?L@L@X@ZBV?@Dj@BRFl@R~AHl@@JLfAXzB\fCHv@Jv@VjBL~@?@Hp@Hj@Jv@Jx@LfAJr@BVPlARbBThBFb@R|AVpBJt@RbBR|A\jC?DRvAFj@PnADXNlAJz@@DFd@?BJ~@J~@Fn@Hz@@@Bf@D\Dp@B^Bh@@R@LBn@@^Bd@@f@Bn@?@@Z?X@~@@bA?p@?f@?R?V?Z?ZAV?XA^?TARCv@?TAVCp@Cp@Ej@C^AZCVA^Eh@E`@C`@KbACRCZKv@CXOfAE^G\EXCRA@EVE\GXEVGV?@EVGXGVGZAHENMj@I\GZOl@IXGTEPUt@GX[`AGTABIRGTOb@[x@Sh@?BMZKTUj@KVKTKTKRKVe@`AWh@]p@Q^_BbDoB~DIPgEvIw@|AcAtBWf@Q^MVYj@eEvIiCjF]p@q@tAq@tAOZm@lAq@vAWf@Q^Ub@e@~@o@rAa@z@i@fAaAlBUd@[p@Wh@q@rAo@nAi@hAMVWh@c@z@o@rAWf@MVg@`AUd@Yn@Yh@q@tAo@nAYn@Wf@Yl@MTIR[l@KTkA~BWj@e@bAIPc@bAWl@Q`@{@xBk@|A_@fASh@Un@g@zA[dA]fAGTUt@Oj@K^W|@I^WbAOp@YhAI^[vAc@|B]fBSjASjAKr@In@GZE`@O~@Ir@UhBEZMfAMnAQjBMtAEh@IlAEp@C\AVCZAZCXIjBCj@GpAEr@Ex@Cr@Cn@AFCj@Cv@Ex@AREv@?HCf@Et@Cn@GrAGfAM`D]hHCh@InBGrAOfDGzAGnAKbCGjA?DIbBGvA?DI~AIlBGnACt@Er@GnACr@KdCADCp@GjA?FCj@Ex@Ct@Er@Ct@Cj@Ej@Cz@C`@KzBG`B?BGxACb@?NCd@Cv@Af@?HCp@Ad@?BAv@Ar@Af@AT?J?j@Az@?fA?`@?p@AV?nA?lB?HAh@?t@?nA?`@?l@?D?n@A^?r@?bA?`@?vA?TAj@?j@ARAz@A`@A\?@GnAA^CXAZCXAXCZAXCXCVATIv@AVEXCXCXEXCXEXE\CTEZEXEVEVEXEV]bCQnAEZIj@Mx@Kp@Ip@k@xDIp@G\Ip@EXEXEXEXEVEXCVEZCTEXCXE\CZCTE^AVCVCVIdAOnCCt@AZAVA^AV?ZAn@A|@Ap@C|D?B?rA?JC|JAj@?L?\A~CAbHAhC?XA|@?j@C|HAjGA~DA^?bBAlCEpQAjGA|B?lAAZ?lDCxFAzGAlEAzCA~BAjFAlE?|AArE?PAXA~E?~BAhAA|F?lBAzAAzC?bAApDAhEAbB?zBApDAnDAvCArFAbFArD?fACtG?~CC`IAtB?rACdH?~CChF?|@AlCAhFAzDAtD?bCAtD?^AzA?~BAbEAvCAbB?tA?l@AvCAxD?fAAbD?h@?j@Ax@?tCAxB?xAA~@?bBAdC?nAAlA?pAAhAGrCC|AAXAx@GhCIvDEdCI|DC~@C|AElBElBCr@EjCCdAAf@CfAAl@A`@CtAC`BCx@C~@At@CvAC~@AZC`BAPCdAGvC?PAd@C|@A^Ah@Al@A\A^Ct@EjBCpA?XGhCCjAAXAXCnAItECx@ChACpBClAEzACv@?NCbACvAAr@CdAAZAx@ElBEbBAd@GpCCpAEjBCdBAZAx@Ab@Ct@Af@ClAEnBC|@CrAEfCEtACfBCr@ErBExBCbBCz@C|AAb@AXC`AGtCG|CG|CG~CGbCClBCp@EdCA`@AZAXErCEjBAd@GzBAbACfAGrCG|CG~CIzDGzCG`DGxCG|CEbCGdCEbCG~CG`CCdBEnBGbCG|CG|CKjFA^EfCG`CGnDI|DEbBEtBGjDIfDK~FG|CMnFIzEKvEIvDIzDG~CCdBI`DIzDAbACvAExAEvCAf@AFEbCIxDG|CKdFCbBATAv@CjAAPA\Al@Aj@ChAA\Ab@At@C|@CjAA`ACv@AfA?RGvCEpBE|BCfACfAAd@A~@GtBAhAClAAPAVG`DC~AGjDIpDK`GGvCE`BKpFEnBEnBCpBAZA\MdHIhDIjEInDEjBAj@KzF?HCj@WxMKtFAt@MrFAx@]nPCrAGjDE`CG`C_@bSUlLM`Ge@zUMlHAX?HEbBAf@E`CA|@E~ACZ?RA\?DAn@KhF?Z?PC`AAv@EtBA`@A^Al@Cr@?TCnAClAIhECz@?JEpA?VANClACn@Cz@A~@AZAd@CbAAr@?`@IdEExBCbAApAChA?BE`BAVQzI?\Ch@UtMMnFYbOGxC?DCfACr@Ax@AT_@rRGbDClAElBG~CCxAAdAClAEvAE|BQbJMvGA^GvC?VAZAXEjBCfBGdCAr@AXCv@?VAZAZAXCpCExBAXAZAr@I|DAT?TA^G|CAVAb@GxCC~AAf@CfBCpAAXA`@CjAAX?ZAXAX?XAZCr@?ZAXAZAX?XAZAX?XAZAXAZ?XAXAX?ZAXAX?ZAXAX?ZAN?HAX?XAZAX?XAZAX?XAXAZ?XAXAX?ZAXAZ?XAXAX?ZAXAX?ZAXAX?ZAXAX?XAZAX?XAZAX?XAZAX?XAXAZ?XAZAX?DAR?XAZAX?XAX?H?PAXAX?ZAVAX?ZAXAZ?XAXAX?XAXAZ?XAXAX?ZAXAX?ZAXAX?XAXAZ?B?TAXAZ?XAXAZ?XAX?JAL?ZAXAX?XAZCnAAX?XAXAZC`BEpB?XAZAX?F?PEhBAXAh@C~@?ZAXAr@AXCnA?ZANA^CrA?XG|B?F?XEbBCz@?ZAXAZAr@At@EhBAZKhGAZCnAEhBAX?XCt@ChBAZAr@Ct@At@Ar@Ct@KnF?XCt@Ar@AZ?XAXAN?H?ZCr@At@Al@GbC?ZGdCAz@ClACt@?XATAj@GrCCnACnAG~CChBAZA^ChAClAGlDCtAA`@CnA?DAR?ZAf@EtBCt@ErBCvAEjCA^An@Ct@?XCt@?XCt@?XAXEbCAZAXAr@C|@Aj@At@Cr@ChBAp@ElBAXAX?ZClACpACr@GxDAr@AZAXAZC~AOlH?REvBEzA?`@GbCAt@At@AXEhB?ZAXCt@?XCr@?ZCt@Ar@AX?ZEhB?XAXAt@AXAX?XAXAZ?TCx@ClACnACnA?XAt@Cr@?J?LAXAZAXAt@Ar@AXAZAr@AR?^AZAX?XAZAX?XAZAXCnA?VCv@?XCt@?XAXAZAr@At@AXAZ?XA^An@EhBAX?XCt@?XAX?ZAR?DAXCnA?XAZ?XAXAt@?BEdBCnAGbCAlACl@?`@CfAA`@AXCt@?XAZAXO~H?XAR?XAXA`@AX?ZAXCnAAt@CnAAX?XCnAAXAZAX?DAl@?ZE`BCrBCr@Ar@CnAAt@IxD?DARCjBCr@ChBCnAAZCr@?XAZAt@AXCnAAX?ZClAIxDAt@Ar@GdCAr@ClACpAAr@At@AXAX?ZAXAXAXChBAZAX?XAXAZAr@AX?ZAXEhBAt@Ar@AZAr@Ct@?XAXAZIdFAZ?FEhBAXGxD?@ClAAr@Ct@?XAZCnAAXEbC?FAl@CnAAX?ZAXAt@AXAt@AVAZ?XAZAX?XAXAZ?XARCtAAt@ANIlEAj@CnA?XCnAAXAt@AXCdA?HEdCAXCnAAt@AXAt@Cv@Ap@?XAXAZAr@Ab@APChBC~AEzAAr@AX?ZCr@?ZCr@At@At@AXAt@AXAXAZAt@?JAf@AXAZ?XAL?J?ZAXAX?XAZAr@At@AXAZ?XAX?XAZ?XAXAZ?XAX?ZAXAX?ZAX?TA^AX?ZAX?@AXAX?ZAVAZ?RA`@CnAAXAZ?XAXAZAX?XAZAX?XAT?DAX?XCt@?XAXAZ?P?FAXCt@?XCnAAVAZ?XAZAXAX?XCt@?XAt@EbBA`@Ar@At@AXAZ?XAX?PAF?ZCnAAX?XEhBAX?ZAXAX?ZCr@?XCt@ChBAZAXAr@E|BA`@At@CnAAXAX?ZAXAX?XAZAr@AZ?XC`A?LAXAZAr@Af@?LAXAZ?XCt@?XAXCnAAt@Cr@At@Ar@Ct@CnAAt@Ar@AZAr@AX?ZAXAXAt@?XCr@?ZAXAX?XAZ?XAXAX?RCr@AnAAXAXCnAAt@Ar@Ct@AX?F?RCnAAXAZ?XAXAt@Ct@?XAXAZ?XAP?HCnAClAAZ?XCnAAXAt@AX?XCn@?DAt@AX?XAXCnAEhBAt@AX?ZAr@EtA?@?XCt@?XEhB?XAZAt@AXAXAt@AXCnAAt@At@CnAAXCnAChBAX?DAn@AZ?XAXEjB?XAV?@AX?ZCr@CnAAZAr@AZAr@EjBAlACpACr@?XAZAX?ZAXAXEdCAX?XCnAAZAX?XCnAGbCCnA?X?@ClAAXAZ?XAXAZ?XCnACnAAZ?XAX?BAVAr@Ar@CpAAF?PAXApAE|A?JAX?ZEhBAl@?FCnAAXG`D?XADCbBCnAAt@CnAAXKhFAx@An@Cr@At@A`@?XAl@AZA^?NCx@CxA?NAXA^Av@At@AZAr@AZItDCrACjBCt@?XCfACjBCjAC|@?T?BAj@A`@AXAZ?N?HAZAX?XAX?@AX?ZAV?ZAXAX?ZAXAX?V?DATAZ?XA\AV?XAXA^?RAT?V?VAP?B?PAP?R?PAH?LA`@A\A`@A\?^A^A^A`@A\A^AZ?\AVAX?\AVAZ?XAV?@AX?XAZAZ?XAX?XAZAX?ZAXA^?RAZAX?ZAXAZA`@?RAX?ZAZAZ?XAT?DAX?XAZElBAr@AXAt@At@AZAZ?XAV?BAP?^AZC~AAJ?NAJAr@?LA\AX?XAXAZ?XAX?DAR?XAZAZ?VAZ?ZAXAX?XA^?XATAX?ZAXA\?B?TAXAZ?XAX?XAXAZ?VA\AV?X?BAVAZ?ZAX?VAVA\?ZAX?@AV?ZAXAX?P?HAXAZ?ZAVAX?ZAZAX?ZAZAXAhACvAChAGpCA|@EnBE`CAl@KtFAz@CvAEbCAj@APGhEG|CC~@Cr@Ab@CvACvAAj@C`ACjBAj@CbA?RI~DG~CCtAAn@G~BAj@GnD?@CrACvAEpB?PCvAGdCE~BA~@ItDA|@CfAGbDAXAj@GdDC`BAb@C|@?HAV?ZAV?ZAZA\?VA\?XAV?LAL?XAZCn@AZAb@?P?@AZAb@?h@AX?N?HAZA^AT?\AVAZ?XAXAX?XAZAZ?ZAV?XAZAZ?\AT?LAJ?XAZAX?ZAZ?VAXA^AX?VAZ?TAZAX?ZAZ?VAV?BAZ?XAXAZ?XAXAZ?VAL?NAZ?TA\AX?XAXAX?\AZAX?XAZClA?ZAZAX?XAZA\?ZAXAV?XAZAZ?XAZAZ?XATA\?\ATA\?XAX?T?DAZAV?XAXAZ?XAZAX?ZAL?J?ZAXAX?ZAXAX?XAXAZAZ?ZAX?XAXAX?ZAZAX?XAZAX?XAZ?XA@?VAV?\AXAX?ZAZ?XAXAV?\AT?ZAX?LAH?ZA\AZ?XAZ?TA\AZ?ZAX?FAP?XAX?VA^E`C?FCbBAb@E`BAt@CnAG|CCpBGjCGpDIbEA~@IvDC`A?TAZAp@AZAj@C`A?ZChAA\?LALIrEAX?JAh@AZAdAAb@ClAA\At@AV?\ANA~@ClAAZAj@Ab@?XCnACv@Ap@Av@AX?ZCnAAj@ExAE|CCv@?ZCjAAXCnA?ZAXAX?XAZAZ?ZAXAX?XCr@?XARGzEAr@EpAChBs@l`@G~CChBAXAt@AT?ZAXAx@AXAXChBAXAZ?VAZAt@Ar@AXAX?ZAXClBEhB?ZEfBAlAA\AX?XAZAV?^Cl@CdCCx@AZKrEAp@IjEGjDQnJAfAA`@Af@IlECt@IpEEhCEzBEbCWlNA^?RAX?JEzBGzDAXIrEChBAB?ZAn@AXCx@Aj@IxEK`HAVAv@AZIxDAt@AVGbDItEG|CClAChBAr@Cp@Ax@?ZCr@AlAAZAZClAAt@ChBCbAAj@[vPInEQfJMlHa@vTU`MGvDKvFAt@ATElBGhDS`MGvCKjFEjBCjBIvDAx@KnFCnAGpCGnDOnIARCtAExAElCC~ACz@Ar@ClACjAC|AClACvAAd@EdCKnFCrAAn@?XANAfAARKpFEbCAj@C|AMjHE~BKtEAl@EfCAv@ElBCfBCv@Ar@An@A^EhBAr@CpA?ZAVA\Ap@GbDC~AC|@CpAAr@CjAAz@A\?RAVI|DChACrAAv@ChBAZAVAr@AX?\AVAt@At@AXA\?TCf@Af@?ZAh@C`AClAC~@At@A\Ar@AZAV?\Ar@Cv@Ap@AX?XA\AX?VAX?^AV?JAL?XA\?XATA`@?TAZAV?ZA\AT?B?VAZAX?\Al@A`@AXAR?X?BAZAv@AZAT?ZAXAv@AV?XA\?VAZA\?VAZAZ?XAVAZ?\AX?VA\Ap@APAb@Ar@?ZCr@At@AX?\AVA\Ap@A^Ar@AZ?V?FAP?XA\AVChBA\AZ?VAXAX?ZA\?TAX?DAZ?VAVAZ?XAZ?BAn@AZAX?VA^AZ?XAVAX?J?VAb@AL?RAZ?XCv@AX?ZAf@C~@AX?ZAXA\?VA\Aj@Cz@CnAAt@A\Ap@A\An@A\?XAXAv@An@Av@CfAAd@?TA\Ar@A\AT?ZAV?ZAXA\?XAVAX?ZAX?XA\AZ?VAZAV?XA^AX?XAh@C`A?XAXAZ?RA^Ar@A\?VAV?N?LA\ChAA^?VAXA\?VAX?XA^AV?XAT?\AZA^?VAXAV?ZCx@An@ChBAXAZ?XAl@Af@Ct@CnA?NAz@AXA\?XAt@At@?Z?@ARAx@AXAV?VA\AX?H?LA\At@A\AN?ZAj@AN?ZAN?ZAJ?B?ZALAZAt@A\?B?TAV?XAN?JAXA\?R?BAZAX?XA\C|@?LA^?VAXA\?XAT?FAl@Ax@AV?XAL?NAn@Ab@AT?H?JA\?@AT?XAZAt@?j@AF?XAZAr@?PAh@Ap@Av@AZ?RAb@?l@A^Cr@Av@An@Cx@Cr@Cr@Cp@AZGrAIjAAXCd@Ej@Ep@CXCZAVCZGp@Gv@?@Gj@CZGv@CXGn@?DGr@Gr@It@C\CXCTKnAGp@Gv@Gt@Gp@CVABKjACXM`BANCTCXCXGp@CXKnAIt@APEj@CPGr@CTC\E`@IbACPMtA?HGn@CZCZKfAQlB?DIx@?H]zDOdBAHM|AMpAKjAGv@Gr@KlAMpACTCZSbCCZGp@OhBY|CGr@WzCCZ?BKhAYbDIbAQnBw@~Ii@tGWvCYbDY~CCVOlBCTGr@OhBCXGr@CZCXCZMjBCTCXGlACZAVEv@GpA?DEl@GfBEpAARA`@AZ?XAZCr@?REvAAr@Ct@?ZCt@Ar@CnAAZAt@CnA?ZAXAv@AVARAl@Ah@Ap@Ct@CtAAn@AX?@?XCr@GbDAf@?JA\Ar@AV?\AVCdACxAAt@AX?DAT?\AL?@CvACnAAZAt@AZAp@GfDAj@A^AZKdGAPAb@Av@Av@ClAG~CCr@?ZAXAXAr@A\Ar@At@AXAZAr@AZ?XAV?ZAXA\?XAVAVA~@Ap@ChAATAZ?^CnAAXAZAv@Ar@Ct@At@Al@C|@ChA?\Ad@AP?XAVAr@AXAZ?ZCr@?XAPAf@CnA?J?JA^AX?P?BAZ?JAd@Aj@AJAt@?TATA`@Ap@C|@?VAZ?JAL?VA\AR?D?ZAZAX?XAZAX?VAXAX?RAb@AVAx@CjA?ZAZAXA\Ar@A\?D?LAZ?XCt@?HAj@A^?HAh@?ZAt@?V?TAZ?`@?Z?P?z@?V?Z?X@X?V?^?V@V?@?V?R?F@Z?F?R@V?D?d@@d@@Z?@@T?\@V?J@N@V?B?V@Z@X?H@L?\@Z@X@X?D@R?X@X@N?D@^@p@?@@X?N@H@X@f@@d@@\?T@F@p@@Z@X?\@TBr@?J@P?X@V@\@X@r@?@@V@V@\?T@^@V@Z@X?D@T@Z@R@Z@Z@VBZ@L?JBZLjABZDXBVF\?@Jn@DVDVFXFXFVFXFVFXFTHXHVHVHTFTHVJVJTRj@LZJTJTHTJTJTLXJTJVHPLXHPJVLXHTHRHPDNFLHTHTJXHTNf@L\Nj@J^FTHZNl@DN@HFVNn@FXH\Ll@DZDVFXDXDXDXBH@NDXDXBVJt@BVFv@D`@BPBZB\@RBZ@XBZ@R@^@XBr@@Z@Z?X@Z@Z?V?X?^?h@?b@?XAX?ZAZ?XARA`@Ar@AXCr@AZ?\Cp@?RCf@An@AXAXAt@AXAXAZGfCIzDAXAVAp@?PAJAZ?XAXAZAZAZ?VAZAZ?VAXAV?BAZCr@Ar@AZAZ?VAZAZAXAZ?VAZAZAXAXAZ?XAXA\?TAZAZCr@?ZAZAXAVAZ?ZAXAZCnAAXAZAXAX?D?TAZAXAX?ZAP?FAXClAA\Cr@Ar@?FARCr@?XCr@AZAd@MhFAXIpDIdECj@CnAOlGMrFEjBA\?BAh@C|@KhEANGzB?BAb@GjC?BAp@ARIhDIrDAf@KxEKrEK|DCrAEhBGhCC~@CfAEjAAf@ChA?BCx@An@Cz@CfAAT?XEzACzAIjCG`DCx@SbICzAMnFMjFI|CG`DMfFI|CI|DKvDOhGClAEdBM~EMrFIdDIrDS`JYfMIpDAVKpDIjDCtA?PEfA?ZGbBAj@?XCh@At@GjCA`@GpBCbAEbCC`AAXCjAAXC|@ClAEfBATAZAx@Cr@CrACr@AZA`@?RCnAGjBA^An@APC`BAd@KhEIdDCj@Ah@?TALSpIAx@AXCr@MhGE|AYtLIdDi@fVMxEIdDAt@IlDIrCErBCdAOjGEbBErBk@lVCjAQ~G?NGlCEnAClAIbCC|A_@bOCpACbAE|AGpCCjAKrEInDMdFAd@CjAAj@GdBGjBMrFCfAIlEAt@AZCz@?RAZAVAZAr@Ct@IzDKzDAv@ClAClACr@At@EnACr@?HGtC?DG~BEjBYrLClAAX?TCp@A\AZ?XCr@AXA`@An@AXAXClAEhBAb@?FALCnAEjBAn@A\Ct@Ar@C`AAN?XA\AVAZAXA~@CfAAVCt@AZ?VAZAXAZ?XAZAXAXAh@?RCp@Av@EfBAPG~BC`ACrAClACz@At@GnB?JChAElBEtACpACjAGhBElBOhHI`DCbACvAEhBKfEAb@A\Ah@ExAMbGA`@ElAAp@EtA?XAVA`@Al@A\Ar@Ar@?D?^?r@?j@@R?b@@`@@V?Z@XBX@X@XBZBXDp@@PHz@BXBXD\Ff@?DF^BTLr@DXLn@FZLr@FVFTBLBJFTFZHVFXHTHZFP@BFR@DFRHXFPHVBBHVRn@Rl@^hAHRJXHTh@~ARl@HVHXJVHTHVHVHVJVHVHTRn@`@jAFRh@~AHTJVHTHXh@|AHTHVTp@\dAFPVr@HXJVDPBBHVFRJZFRLXFTJXHVHTHVRl@HVHTHVJVJXHVHVFVRn@HXFVPn@FVFVFXFVFVDZFVDVFZDXDXDRD\DXDXBXBVD\BRB`@?BBRBZBZ@ZBV@\Dv@?V@X@T@^?V@X?\?H?L?X?X?Z?t@?nA?VAjB?t@?r@?v@?X?X?ZAr@?X?Z?X?X?Z?r@?t@Av@?r@AhBAZ?X?X?Z?X?Z?X?v@ApA?fCAr@?Z?V?X?Z?h@Ad@?r@?v@?lACjG?t@?t@AdC?J?h@AxD?t@?t@Ax@?n@?t@?\AtDApA?X?P?pBAt@?r@?t@?t@AbA?J?t@?t@?t@AV?nA?hBAt@?Z?N?~@AdCAxD?jB?t@AjB?zA?L?\Ap@?pA?V?RA`@?r@?jB?t@AbC?t@AhB?bCAdC?nAAnA?t@?r@?X?j@Aj@?j@?h@?l@?XAvA?vA?d@A|A?vAAtA?j@AjC?Z?Z?rAA~CA`C?dC?v@AdC?nAAd@?h@?nAAjA?x@?r@?pAAjB?hAAlA?r@CbN?jBC`L?|@AbCApFAxDA|B?D?nAAnB?dC?j@?@ArAAfD?b@?j@?V?r@?^AX?Z?F?b@?t@?^?DAp@?r@?h@?d@?r@?d@Ar@?j@?r@?r@?FA\?p@?h@?\?\?T?VA^?X?\?X?D?R?\?X?X?VAZ?Z?\?T?\?V?\?X?F?@AZ?b@?^?Z?R?^?\A\?X?V?Z?X?H?@?H?^?T?X?p@?b@?NAzA?T?X@`C?jA?v@AP?x@A^AvA?JAhA?D?^?\AZ?Z?V?^?P?ZA\?Z?V?V?r@?pA?`@?RAlA?T?d@?V?X?X?XAb@?hB?j@AT?T?@?x@?^?`@?T?t@AX?Z?Z?X?\?T?Z?XAZ?V?F?P?\?Z?p@?XA\?V?Z?Z?X?Z?T?\?XAT?V?dE?`A?@?x@Ap@?nAAZAnBAfA?b@AP?Z?lA@r@?X?P?b@?XAr@?v@?D?T?T?^?r@?v@AX?V?Z?t@?l@?`@AT?^?Z?B?T?T?\?t@?ZApA?j@?H?r@?n@?X?`@Ar@?@?Z?n@?x@?l@ApB?T?^?X?X?VA^?Z?Z?~@?d@?x@Ap@?D?R?Z?\?V?\AnA?l@?z@?Z?Z?\?`@A`A?xA?p@A~B?h@?F?p@Ar@?dA?rBA|A?rAAnD?|B?HAb@?nA?hB?n@?d@A`@?X?ZAX?P?F?Z?Z?T?B?V?N?JAZ?B?T?X?rA?dA?^?L?R?T?P?XAn@?\?P?^?j@?Z?T?DAT?\?X?X?b@?j@A\?Z?\?X?V?b@?l@Ab@?\?l@?^?f@?j@Ad@?j@?Z?\?^?X?X?Z?ZA`@?Z?L?\?p@?H?T?T?n@?`@A\?@?X?N?F?^?X?P?B?b@?p@?Z?X?\?RAv@?p@?Z?B?V?Z?Z?Z?V?R?H?X?\?V?Z?V?h@?L?jB?J?\?h@?n@?`@?T?D?Z?X?V?Z?Z?X?V?Z?X?\?V?L?f@?V?\?T?N?v@?X?\?^@fE?`@A~@?h@?lA@l@?FAjE?X@R?\?Z?R?`@?X?L?R?dA?\?nA?t@?\?^?r@?bB?pA?n@?r@?|@?z@?p@?b@?P?p@?\?P?b@?~@?T?`@?v@?l@?zA?~A@lA?R?\?t@?t@?n@AnA?^?R?FA`A?bAAr@?x@Ar@AlAAx@?t@Al@?`@At@Ap@?\A|@Al@?ZAX?X?XAV?^?XAV?^?XAV?ZA^?h@?\Ax@Av@?f@Av@?XA`@?ZA\?X?XATA|@AnAAxA?l@AN?x@Av@Az@?VAXApA?Z?XAt@Ar@ApA?ZAX?t@AZ?X?ZAX?T?^AX?X?ZAT?D?NAf@?Z?PA^?X?`@AR?XAZ?Z?XAZ?Z?XA^?\Ah@?h@A^?\Af@?L?\AXAv@?x@Al@A|@Ap@?X?ZAj@?d@AX?X?ZAl@AvAAZ?LApAAx@?`@Av@AnA?t@Ap@Ar@?\AlAAr@?b@AN?^A\?t@AX?\An@?NA`A?\?ZAZ?V?ZAX?ZAZ?X?ZAXA`B?d@An@Ax@?j@Az@A^?V?^At@?TAb@?l@AZ?t@An@AZ?^?NAj@AhAAx@?`@?^At@ArAA`@?XAt@Ap@?V?^AZ?b@?PCfBArA?t@ApAAt@Ap@ApA?b@Aj@A^?\A`@CnCAtACzC?J?d@A`@?j@Al@?d@An@?f@At@?\Af@A|@Av@?f@Af@Ar@?t@Av@Ar@?v@AB?p@Al@?\A^?f@?b@Av@Ar@?X?^AX?f@AT?TAn@AfA?z@AT?|@AhAA^Ap@?^At@Aj@?V?f@An@Ab@?PAn@?d@At@?b@Al@A|@?|@?BAt@?^CjA?z@Ax@AjAAt@?XAr@Ar@?ZA`@?Z?ZARApA?R?VAd@?T?L?^Ad@Ap@?D?Z?XAn@?T?FAZ?p@A`@?R?VA\?XAX?X?@?X?x@Ar@?F?L?\?Z@Z?x@?F?|@?^@h@?n@@h@@t@@Z?Z@f@@d@Bv@Bz@@f@Bt@Bf@Bd@@b@Dr@Dv@Bj@Dv@@TDd@Dn@B\@XBXBX@XD\Dp@BVBPDf@@PD`@Fn@B\DXD`@Ff@BXD^D\Hr@BVBTDZBZBL@JBXDZBXDXBVDZBZDVBZDXH~@Db@Db@Db@BTBZDZBZ@RBXD\@VBXB\BVBZ@XBX@VBZ@ZDr@?BBV@X@\@VBZBr@@X@X@\@V@\?V@XBv@@p@@b@@p@Bz@?j@B|@@r@B|@@b@?h@?H@X?X?Z?n@?v@AfB?rA?v@?rA?v@?lA@bA?xA?lB?`A?n@?V?`@?f@?d@?j@@P?j@?r@?~@?p@?p@?v@?v@?^?n@?r@?Z?^?l@?`E?lA?v@?hA?x@?n@?t@?t@?t@?t@?t@?n@@t@?^?X?t@?X?ZAZ?X?Z@lB?z@?n@?pA?nA?`C@rA?v@?R?x@?`A?r@?n@?v@?fA?t@@rA?bB?jC?lB?~A?rA?^@r@?jB?jB@rA?r@?tA?pA?n@?fC?tA?nB?`@?^?zB?x@?bD?vA?vB?nC?j@?r@?rE?lB?lB?j@?dD?v@?vA?vA?jC?j@?`B?tA?nD?V?R?j@@zE?fG?lD?dC?lE?x@?j@?rB@nF?vE?jA?tE?pF?f@@~C?t@?Z?b@?h@?`C?rD?~B@zC?X?X?Z?fA?fC?|@?jA?l@?J?lA?j@?J?fC?lA?Z?pA?X?v@@X?V?`A?lB?X?P?d@?^?dB?`@?l@?t@?pA?X?|@?l@?X@t@?t@?X?~@?j@?Z?X?X?X?pA?pA?r@?t@?pA?X?jB?Z?X?Z?nA?r@?pAAt@?ZAX?XCt@?LAPEhAAXAZCn@Er@Gv@IpAGt@It@Ir@Gl@OjAMz@Ir@ET?BKj@Gf@UvAW`B[tBMt@Kp@Kt@Kn@EZGXEVQlAWdBSlAKz@Ij@Mr@Kr@Ir@EVEZM`AEd@O~AI|@?HEh@G|@CZA^Cf@Cr@Cb@EbBCt@Ax@Cn@AXAt@Cz@ChAE~BEtAE`CEtA?XE~AC`ACnAAb@ARAXAv@Cp@Ax@EbBCz@An@ClAEnAAr@EhBObHElAEpBAp@AVAXAXClAEbBCbB?BE|AGpCCzACn@?ZAZAVAX?ZAXAX?XAVCv@?XAd@C~@Cx@?LCbAA^Al@AXAZAX?XCp@ChA?HAX?XA`@Ap@Cp@Aj@Ez@Cd@EbAAVIbBOfCKbBEn@Gx@S`CMnAK`AE^In@Iv@M`AEf@G^MbAGd@CTKj@G`@UzAWdBShAMp@EZGZKj@Kd@Kf@Id@GVUhAS`ASx@GVGXQp@On@GVIXGVGVIXGTGVGVIXGVGZGTCJELGTGXGTIVGZGTGVIXGVIVIZGVGVQr@GTGVIXETGVIXGTGVIZGXkAzEOn@Uz@a@`BCJIXEPQn@Ol@I\IVq@rCIVMj@ADOh@Op@s@rCKd@Mb@IZi@vBQt@Oh@GV[nAGVQn@Mj@c@fBK^Sz@[pAOj@{@fD[pACLGTAFERQp@AFMf@CFOp@Mh@K\[nA[pAELEPQn@Op@WdAa@`BU`AGV]rA}@jDm@dCYfASx@CHOn@GRa@bBOl@GR[hAOl@e@~AADYdAGT]jA]hAEPABCDCJABMb@K^ABOf@IVEJu@bC}@rCA@GRITIVGRKVKVITIXIRKXGRKVIVSn@ITITUp@Sj@KVIVIVKXIRIXIRKZITITKXSl@Sj@IVKVGTKTIXKVIVGRKVKXITIVKVIXSj@KZITKXIRO`@M`@KVQh@KVQj@Sh@Sl@Un@CHELITa@hAIXSj@Up@IVKXIRIXITKXEJCFIXITITKXITKZIRKXGRKVITITKXITITIVKXIRIVKVGTKTIVIVIVITKVSl@IVITKV?@ITIXITITKVIVKXIVITIRABGRKVGPIXKXIRITIVIVKVIVITKVIVIVKXSl@ITKVITIXKVGRIVKVGRKXITIVKTIXITKVIVIVIRKXGRKXGRA@GRKXKVIVITKXIRIVITKZIPIVIVA@ITITIXM^O`@IVKXIRIXIPKZGRUp@KVELAFKVITIXITKXITITIVKVITIVITIVKVQh@KZIRITKXITELCHUn@IVKVi@~AITUn@GTKV_@bAKZKTGRUn@ITITIVIRKXGTITKVITIVUn@[bASl@IVITWp@IRIVKZITITKVIVITITKZGPKXSn@ITIVADGNIXIRKXGRKVGTKXIRIVIXITITIVITSl@Wp@ITITKXITIVIRKXIXITKVITIVIRKZITITITKVIXITKVITITKXIVITGRKZSl@IRKVGTKXIRIXIVITKXIVGTKXKVGTIVKVGTITIXITITGVITIXIVIXITGVKXGRIXIVIVIXITIZIVIVGTIVITIVIXITAHELSn@IXIVQj@IVGTSn@Qj@KZIXQl@IVITIVIXIRIXIXKZGVIVGTSp@ITK^K\EJSr@Ut@_@jAg@`B]fAGTQn@IXIVSn@IXIRIXGTKZITIXMb@CJGTUp@Qn@KVGTCJELITIVIXGTKXGVOd@CHGVIT[dAQl@IVQl@IXIVGTIVIVIVSn@ITEPCDGVITQl@[fASp@Ql@IVIV?@ITIXGTIXIVITQl@IVIXITENCHIVGRSn@IXITIVSn@Qn@ADGNGT?BITIVIXITENCFGTKZQn@[dAIVQn@IXSj@IVGVABGRIVIVIVIVQn@g@`BYbAGVITIVIVGTKXGTIVITKZGVA?Qn@IXIVIVIVGTGTIZITIV?@GRITITIZGRKXGVIVITIXGPCFGRIVIXSp@ITAFGPIVIVIVITm@xBKZ?@[bAQj@EPM\Mb@a@tAa@pAOh@a@tA[`AOd@Of@GVITIXIT?@IXIVQh@Ql@IVKZGTQj@Sn@IVIXQn@ITK\Oh@KZIVIVIVIVIVIXGTITIXIVGTIVENCFIVIVIXGVITIXIVSl@K\Oh@GTGRIXIVIVITGTIXENCDIVGVIVIVGVQf@K\IXGVITIVIVIVGVIVKVGTKZGTIVIXGRKZGTIXELCHIXGTIVGTIXIVGVCHELGTIXQl@I\GPIZIXCJCLQj@Kb@Mb@IXGTIVQp@GTGVMb@?@Of@EPGVIXIVQn@Md@[nAc@|AI\CJMd@Kb@Sr@Mb@Mf@ELIVGTGVIZ]rAMj@ADGXKh@Mr@I\GVGVIXGTMd@EPGRI\GTCNKd@YpA[pAWjA_@bBo@pC?@a@~AQp@Qn@YfAQp@Qn@cAvDUx@Ql@YjAQn@YdA]rASt@Sp@YhAIXENMb@WbAYdAQr@Sv@]lAIZQl@U|@[jA]nAa@~AGRWbASt@Sv@Qj@Sx@cAtD[nAm@vB[dA]fAADY`Ag@|A]jAGP]fAo@tB]dAo@vBSp@GRSn@Ql@]hAQn@ABQj@YhAK`@Md@[hAU~@Ux@YbAIXKd@CJm@|BYhAUx@c@bBYfA]lAOh@CLWz@Qr@]pAUz@a@zAABm@|BSt@]pASv@Sr@On@a@vAa@zACJa@zAEN_@xAYfAABMh@Qn@Ol@]lA[fAI\IVUx@c@xA[dAY~@Sp@EPY`AY~@a@vAOf@Uv@]fAEPKZuAjEmBnGk@jB_@nAM^oAbE_BpF{@nCo@tBAFIVCFENIXK\Ql@Qh@K\CHQj@K^ABUv@CD]jA]fAIVYbAa@vAQj@IVQj@IVQj@Sn@IVABc@tAo@xBg@bBMb@IVGVA@GRIVIVGTITIXKXQl@IVIXUv@GN[dAELiBnGCJ_@nA[`AK\Sl@A@Qn@Sh@IZQj@IXSp@g@~ASp@wAvEw@lCIVIVQn@]fAQj@IXITGTGTGTABOf@?@Sn@Of@Of@CJKXOf@Of@IVELADKXEPIVABGPIVGTGN?@M^Oj@CDIVGVIXIXe@zA?@Ut@Qj@GPK\IVITIXIVIVIXIV]jAIVENCHIXIVIVIVIVIVGVw@jCM`@aA~CENc@xAc@tASn@CFK^Qj@CFOd@GRGREPGPEPGNMb@Md@CHIVSr@GPM`@K\IXELCFSn@[dAIXIXGPADIZw@fCM`@Qn@ITK\EJUt@GVg@`BWx@GTM`@ABOf@ENIVIXELM`@ABK\CHGPK\CJKZCJKZGTGNGPK\K^M^Od@IXELMf@A@Md@ADK`@EPITGVQf@?BOb@Qh@Od@Oj@Od@Mf@K\AFOf@Mf@ABOl@IVQl@IVGVMb@Yz@Md@Of@GPSl@ELY|@ENWx@Uz@GRGVK\Ql@ADWx@Wt@IVk@jBAFOf@Ut@Sl@EP_@nA]hAOf@ITGTIXSt@Up@Up@?BWv@M`@Oh@KZM`@Of@MZABYz@]dAUl@Wr@Sh@Sh@_@~@sBlFWr@O^CBa@hAOZO^GNO^]~@Wj@Ob@Sd@MX?@Wn@MZSb@c@dASf@A@]`AIRMXa@jAWl@O`@Wx@Qf@K^Mb@K^CFIXMf@K`@Qt@Kd@Mf@Ib@Q|@AFI`@EXETGd@GZANGb@G`@SfBCXGp@Gz@G~@IzAAPAXCj@AXCb@AZC^Ej@G|@AVI~AATATEt@Gl@?FGj@?@Gh@Gh@WbBOtAETETQdAKn@AFG^CTOt@Kn@UtACTEPEVIf@Ij@G^GZIb@G^Ih@ABId@AHG^CNMp@CPCJGb@Ib@I^Kn@A@If@Mh@EPGTOh@IZMZGPITQj@Wp@KZUh@OZUd@S^W`@]n@KNOVKNYb@OREDEDWX[^SVUXk@p@c@j@KLABYZ]b@qA~Ag@n@A@q@v@QT[`@]b@]b@ILEFQVINMTOTKROT[n@CFKNOZQ\Qf@Wn@Ul@?@Sl@Oh@K\Sn@Qr@S~@]bBOp@Mp@YjAOp@On@Mh@Oj@Op@ERGTK`@Ml@CHMj@GVYhA?@Qr@Qr@CNCFOp@I`@I\ENWfAGTEPOr@GVAFQh@IZITIVADMb@GLITWj@CFO\ABQ^MVMVMTGJOXYf@CBOXWd@CDCFU`@GJO\KTGJMZKVO^M^GVCFU|@AFI^CJAHEREXGZGh@CPGf@ANAJATATC\AXARElA?DAd@Cj@Cj@Al@Al@Ch@Ab@Ch@EvAElAAFEvA?REbAAPCx@A\?X?DAV?h@?n@?J?P@b@@Z@b@B^B\BZ@HBRBTBRDTBRHd@FZ?@DTBNJ`@Nl@J^L`@N^JVDLDJP`@NZJRFLDHR\Tb@JNNXb@t@^p@T^T`@PZNTR`@b@t@T^NXRZb@t@PXNVR^PXJRLRVb@JRLTRXT`@JNJPRZNRNVJNLPHNTZRZTZX`@RXX^HNLNFJfChDfAxALNnAdBZd@d@r@|@vAv@nAV`@^l@b@t@T`@v@vAJPh@`AT`@NXTb@P\R`@`@|@`@x@@DXl@j@nArA`D\x@P^Xt@Zx@Tn@Tl@LXL\\`ATj@HVTj@JXTl@JT?@^dA@?Ph@Rf@N`@HTRl@BDPh@Tt@@BLb@XdAPp@J`@ZrA@H@@F\Jh@Jf@f@hDH`@?FHh@@FFh@Dd@@LFr@@RFp@@B?DJlAJpAD\Fx@BZBRBZDXFr@@P@FFp@B^Fh@Fz@DXBZFn@Ft@BXFt@B\?@Hn@B\@PNvANbBRtCb@rE\zDDb@LdAJbADh@D`@LzAFn@Fn@ZrDRtB@JFh@Fj@Hl@DXFXLl@FXHZBLBFFVHVHTL^FPJTJXJTLZd@z@Xb@LRHJDDFHh@l@^^PPFHFDPNNNHFHF^XBBfAp@LFJDRJNFPHTJXJTHf@PXHPFJDVHVHh@Pd@Nh@PRFRHRFd@NB@RHLDVJLFJDRJLFLFTJTLHFFBTNHFHFRLHFHFDDLJPLNPHHRPPPLPNNLPNTNRLRFJPXJPLVJRLXHPJR@@LVVh@LXHPLTJRLTHNNVR\V\FJTXX\VX@@JLRPHJVRNLNLDDHFNJZTJHVP@@PLRLPLDBJHPNRLFFVRb@\B@f@f@B@BDNLDFJJNRLPJN?@RTFJDFLRLPHLFHLRHLBF@@JNFJBDPVXb@FFDHPVLPLTn@bAPVLRl@~@NTXb@\h@j@z@\h@RZFHNVHLJPLRd@r@T\R`@DHJLj@~@JPLPDFj@|@LRX`@LRNT?@@@T\Vb@FJLRJPJP?@JPLTP\JTDJDHLXPb@NZJXRj@JXJZPn@Pl@FVH^DPTz@FXLl@BFBPF\Hd@@FFZJz@Hr@D`@BL?@Bb@B^B|@Dz@FpC@nC?\?dB?j@?pB@nB?~@?V@jB?hA@j@?b@?N?j@?h@@j@?N@x@@b@?V@b@@fA?h@@J?v@?Z@n@Ap@?B?JA~@AZAd@AN?H?PCf@Ad@AJANATARA`@CVAZCRAZCXARADC^En@ANI~@C`@ATCl@A^AZ?VAL?P?X?V?\@Z@d@BZ@\B\?@Dh@@H?DFb@BXBTDVHl@Hd@Lf@Hb@Ld@HZFNFTDJDLBHDH?@Tj@BFDJLXDJLXXh@PXR\LTLNd@n@VZJLFHt@bAh@p@p@x@`@d@VXTXRTPTHFFHLNJLBD@?BDRVr@z@RT^d@\`@p@z@VZFJZ\bAnAj@p@rA~ABBp@x@t@|@|@fA~@jAx@`Al@t@n@v@`@f@b@h@pAzAfB|Bt@|@VXVZRTZ`@VZ\`@bBtBjAvA@?`@f@j@r@t@|@JLb@h@RTX\PT@@x@bAh@n@PTX\t@|@t@|@h@p@FH^d@LLLRPTLPT`@DDXd@Td@PZP^FL`@bAN\Nb@JXBHJ\@FNf@Jb@Nj@RbAFZBPLx@Hj@Ht@Dj@Df@FdAFhABv@@b@FpBB`ABn@@V@XD~@Bt@FzABl@?L@JHfBBp@DdABn@H|AHtA@NHfAFv@Dh@Ft@LrAHbAHl@B\Fh@BVFj@DZJdAJx@Jv@NdA?DHd@Hh@Lz@PdARlAHb@Lp@Lr@F^Hd@RdAFXF\H\Nr@P~@FXFVH`@DNLj@Rt@@HRv@Nr@FXLj@Jh@F`@F\BR@HN~@@LDXBPLfAFr@@JDn@BX@R@b@Bb@?NB\?V@\BhA?DDbB@`@?RBt@?V@^@f@@d@DjBH~D@h@Bx@BrA@^?ZBbBBvABnA@V?@BjABv@@RBt@@n@Bt@DnABxABbA@n@BfA@|@@j@BlA?`@@F@`A@f@?H@XBl@?R@T?VBt@?L@r@?j@Ax@?TAXAf@Cv@C\Ej@?BARCRCTAPMfACNGf@EZAFCNCNCJETABGZCJCPGTIb@K^CRQr@GVGRCLa@|AU~@Mj@Ql@WhA[vAI\GZEVI`@ETIh@YzBABAHK`AOfBGbAC^AJEbAAj@Aj@?^AVAvA?`A@vA?j@@lABZPpFDvA@d@FzA@XDv@D`ABx@FvADrA@XD~@@\Bt@B~@@X?P@\?V@P?L?bA?^A\A^Ad@ADAb@Cp@CVEj@CRC^Gd@It@EXGf@EVIb@Ml@Kh@Md@ERGTOh@Mb@ITENOd@KTELADCDKXKTUd@O\a@z@q@xAIRsAzCw@nBABcAtCs@zBK^Sn@IZOf@Qn@IRERELq@~BMf@_@pACHK`@[dAw@lCIXK^Mf@Of@CH[hAAD_@lA[fAK`@W|@Of@K\CHOd@Wz@Uz@EROf@K`@IXER[hAM`@CJK^ENI\Of@Sr@CJGRK\Of@ADWbA]hAUv@IVMb@CLg@fBq@~BOf@Mf@GPGTq@~B_@rAa@|AA@Md@?@Od@?@Od@[dAW`AWx@y@nCM`@IXUx@YbA[fA]fASr@g@|AKZSt@KZCJGR?BENIV?@IVELU|@Qn@Oj@EPGR?@Qh@Mh@m@vBK\?@Sn@Mf@Of@Mf@WbAe@xAAHOd@GPIZIXm@tBOh@Qn@e@bBKZW`Am@xBCDENQj@y@xCABOj@a@xA_@nAAFK^CDCN[fAYbAMd@Of@AD]fAg@dBGVK\Y|@e@bBK`@Oh@i@jBITGVIVIXQn@yAnFKZCJ]hAMb@IVERCFOd@K`@ABIVSp@Sn@GVGPADSn@IVGVITIVQn@?@Ql@Sn@GVSr@Y`AADSp@]jAOj@Ql@Mj@Mh@c@zAY`AMf@YfAM`@[fASr@CJK^Qj@IZIVMd@Mb@GVEJMb@Qn@IVEPMb@Ux@Ux@Wz@c@|ACHIV[hAiA~DaAnDa@vA_AhD}@zCERGPk@tBw@lCwClKCJMb@K^Of@Od@q@bCoArEs@dCi@jBGVc@xAK`@g@hBw@nCe@`BENUx@Of@a@rAM`@]nAOf@A?ELIVSr@_@nACF[dA{@pCSr@y@nCc@zAkAvDe@~AUt@g@`Bg@~Am@tBQj@Ul@g@~A[dA[fAM\Mb@Oj@Ur@ENK\[dAGPUr@Y`ACH[bA[fACFW|@c@xAGPWx@Ql@O`@G\Ql@a@rAIXUv@_@nAs@|BW~@GRKZ_AxCCL_@jA]hAMd@GTUp@q@xBY|@Sl@e@|A[fAGVIVOf@]nAe@vAIXQp@g@~Ae@|A[fAy@jCITQh@i@dBSn@Mb@Ut@IXu@bCy@nC_@lA]jA[bA]fAe@`BK\Sp@Of@Ob@k@jBg@bBq@|Bg@`BKZUv@W`AMh@Mf@GVKn@GVCNAFEXEZEVEZEXC^CRE^CVAXCXC\AXCZAXAZ?TA\A\?Z?ZAZ?J?H?^AXAnA?ZA\?XAt@Ap@?v@AnAAv@Ar@?^A\?RA\?t@At@Ar@?v@Av@At@?r@?v@?p@?^AT?Z?t@?v@?t@?t@?t@Ar@?v@At@Az@?p@At@?t@?t@Ax@?t@At@At@Ar@?x@Cp@Av@Ct@Cr@Ct@E\ATGr@G~@En@KlAMjAK`AK`AG\U`BOfAO`AKt@[tBIj@SrAIh@SzAIh@Kr@CJQrAUzAIp@Ij@Iz@Q`By@zFe@fDYjBWlBKp@Kr@Kr@QjAKp@E\EVMbAM`AGj@E^CTCXCTEt@C\En@Ep@CnAAv@At@?r@AX?L@j@?\@r@@r@@N?F@V@X@R?HBp@Dt@@J@LB^BRBXBXBVFf@Fd@Hf@Hn@Hh@Jv@Hn@Lv@?@DVLdAF^DXBVDXF\BRJt@BXDVHj@Hv@DZHp@J~@`@jDP`BFn@H|@LnALbBJfA?B?BFx@@D@L?FLhBB^Db@Dx@JfBDt@BX@VFnA@XBt@@XBr@Dt@DnA@XBlA@X@Z@X?X@Z@X@X?X@X?Z@X?X@Z?X@V?@@dC?lA?t@At@?p@ApAAl@AX?V?TA\Ar@AZ?XAXAv@Cr@AZ?XQhGCx@Ap@A\CXAZEnAEr@GnAEt@AXCXAXABAVInAAVCZCXEt@CXAZCXAZCXATADAXCXAXCXCZAXCZCXCXCXCZCVEZCXCXEVIt@Kr@Ir@EXEXOjAEZAFCPOnA[|BEZIr@ABCRIr@Kt@EXCXEZAHANCX?@CVCXAZEr@?\?ZAX?F@PBfAFjA@HDn@LpA?FRxBX~CTdCZ`D@TPbC@f@@T@R?BBb@BxA@vAAzCGxB?JEdBGbCAx@AdA?|B@N?d@@h@L`DDr@N`BNzA`@xDTnBV|B`@xD^bDPdBDXJfABVBRLrANpBH|BDpB?r@@vACtBUrG_Bbc@_@hKG|AIxBM`DOxDEjAInCCh@MnDQnEGtAAZ?HANEjAAXCh@?NM`DE|@Ad@A`@Ev@ATG~AIzBEdAIvBSdGg@pMI`CIrE?hA?t@?N@l@?R@TBrABp@FfAHpAB\@D@LJhAFb@BN@LF`@Fd@RrA\~Ab@rBNt@FR\nAXfADLp@vB|@hCjBtEjCtG`@bAXr@z@vBd@hAl@~Af@lAXp@^`AtAjDN^Xp@j@tAlA|CdAfCl@|Av@lBf@pAv@lBzCtHhAtC~@zBfAlCb@hAL\L^</points>
    </polyline>
    <duration>
     <value>27157</value>
     <text>7 hours 33 mins</text>
    </duration>
    <html_instructions>Keep &lt;b&gt;left&lt;/b&gt; to stay on &lt;b&gt;I-40 W&lt;/b&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Passing through Texas&lt;/div&gt;&lt;div style=&quot;font-size:0.9em&quot;&gt;Entering New Mexico&lt;/div&gt;</html_instructions>
    <distance>
     <value>842691</value>
     <text>524 mi</text>
    </distance>
    <maneuver>keep-left</maneuver>
   </step>
   <step>
    <travel_mode>DRIVING</travel_mode>
    <start_location>
     <lat>35.0978089</lat>
     <lng>-106.7231231</lng>
    </start_location>
    <end_location>
     <lat>35.1719923</lat>
     <lng>-111.6528567</lng>
    </end_location>
    <polyline>
     <points>i`fuEnjkjSVh@T`@FRLXTj@JVJTj@xAPb@Rd@Pd@JTXr@d@hA@BHR`@bAx@pBZv@Pb@Tj@JV`@bAXt@Rd@l@xAn@~ARh@HP?@DHDJFLDJ@FHPHPHRJXl@xATl@Vj@l@zA`@bATl@JT`@bAJTPb@N`@JVHRJVHTXn@HTJTJVJVPb@Xr@JVv@pBRd@DPDLtAhD|@|BVn@Rb@z@xB@?JXlAzCzAtDx@rBr@dBzAtDVp@LPFPLZLVTl@LXL^h@pAJVHRTj@Th@Vl@Tj@JTXn@Tl@FLBHb@bAJVJXTh@L\Rf@Pb@N\Vl@Vj@JVJTVj@n@xATj@JRJVHNLZTj@JTTl@JTVn@Tj@JVTh@Vp@Tj@b@dATl@`@bAHVTj@Tj@Vn@`@bAN^Pd@Vn@l@xAJVTj@x@pBFNL\JVTj@Vl@@DHRZv@DHJV@@Rj@Rf@Xp@@B`@bATj@HPZx@BFHPLZHRJVJT^bALXDHBFFRDHP`@LZTl@@B`@~@Rh@LZ`@`AJV^`AVl@Tl@JTBFHPHTb@bAHTHRLXHVJTJVFNL\BDN\FRLXJXLXLXHTb@dAHRXr@L\N\JXj@tAVn@Xn@Rh@b@dATj@`@bAb@hAb@dATj@Tf@JXJVPb@N^Rd@LZPb@N^JTTj@DLDHJZHRTj@Rb@N^Tj@?@Xp@HTTj@JRBJFN\x@BFJVTj@Pd@Rb@FN^`Af@nARf@JVBBFPJVXr@lCxGp@dBFJfBlERh@b@dAjAtCbEdKBH@BZt@n@~AJXJTVl@DLDJLXx@rBlAzC`@dAPb@DJJXLVL^@Bd@hAl@~A^|@HRJV`@~@FNPb@Pf@N\Vl@DNd@fABFXr@FPb@dADHd@lAXr@f@lAhArCn@`Bb@bADJHRTj@JXTh@Zz@HRTr@d@xAf@|AJ\d@dBFXR|@Rz@?@Lf@?@RfA@FPbAX|ALx@F`@@HNpAJdANzADr@@B@NJnAL|ALvALtARbCJrAH~@t@vI`@vELdBPjBThC~@jL`@xE^vEd@tFFt@Ft@Fn@t@~JZrD|@vK@LHv@Fr@LdBPnB@PFr@NdBBXFt@JlAFp@BZBZJjAFt@R`CBT?BBXDX@VDZDr@LnADp@N`B?DFt@NfBBZBXBXDZ@VBZFp@@BDp@Fr@BXFt@Fr@Fr@\vDJlAFr@BZFn@Dd@Dj@JjAFv@Fr@LxA@LJnAFr@JnAFp@Fr@Fr@Fr@BXV|CBXJlABZBV@D@TBVBZJlABVBZBXBVFt@BXFr@Fr@Ft@Fr@BXBXBXBZBXBXDX@XBZDX@VDZBXBXBXBXFr@BZBXFt@HjAJlAHt@JlANfBRbCFr@JlAJnAJlAR`CJlAFr@RbCFv@JhAJlAFt@Fr@Fp@Fv@Ft@JjAFr@H|@H~@B\Ft@JnALhBZ~CHr@Fr@TzC^nEFr@BZJjAFr@JlAFr@Hz@@RFr@JnABXFr@BXBXBXDZRhCb@bFDb@LzAFt@PhBFr@Jr@Hr@DV?DHj@Jt@DXDXDVJr@NjADVJr@Jr@Jt@PjAPpABTPhAJt@Hp@Jp@PnAPjAJp@Jr@BXDXFZHp@PjAJr@Jr@Jr@Jt@NjAJp@PnAJp@NjAPlAJr@Jr@Jr@Z~BJt@Jp@Hp@PlAJt@DVTdBPlAPjAPnAJp@Hr@Jp@R`BF^Hp@DXDZDVJr@Lr@Hp@^`CPjANlAPlAJr@NjAJr@PlAJp@Hr@VfBPlAJp@Jr@Hp@PjApAjJJr@VdBJr@Fh@@HPlAPlAPlANjADRJx@Jp@PlATfBJr@VdB`@xCPjAJr@Hh@Fb@Jp@NlAz@`GTdBPnAPhA?@VhBTdBVdBVfBl@jENjAPjATbBVdBNjAPjAPjABPJx@PjATdBPjA`@vCJr@Jp@BPLx@Z~BNjAFZBTJr@Jp@TdB@BNfAVdB\|Bd@pDl@jEVfBNhAJn@PlAJt@Z|BVdBj@fE\~B\`CBXVdBp@vEh@zDZ~B?@Jn@f@tDZvB`@hC@NZzBZ|BF^h@|DL~@ZvBJr@DZJt@NfAf@nDHd@Ff@RtAJp@BND^VfBd@hDLv@Z~Bp@zEZ|Bf@hDPrAF`@N`AJz@BNDXDXVdBFh@BHHp@DVPlAHn@?@Hh@Fb@Jn@BVJr@Jr@DVNdA?BLt@Hn@BRJv@Jp@Jp@DX@HHj@Jr@Jr@@LF`@Jp@Jz@BPJn@PnADVHn@PnAFZBRJp@Jv@PnA@DFh@Hj@F^DTHp@Hj@@DJt@Jn@BR@FJr@Fd@BLJr@Jv@Hn@@@Jt@BTDXRpAHn@Jv@F`@Hj@Jp@DXBP?BDXFZDX?@D^BN@BHr@DVDXDXDXDVDZDXDXJr@DXJr@Jp@LbAL|@Jr@DXDXDXJr@Jr@Hj@@FJp@DZBVJt@DXJp@Jt@Jr@Jp@DXDXTfBJp@D\DTDZJr@Jr@Hn@FZDXBVF\Hn@Jt@DXJn@Jt@DZDTDXDZDXJr@Hp@Jt@DTBXDXJt@PjADXDXDXDXDXJr@DXDXJr@Jr@Hr@Lr@DX?BJn@BXFXDXBVJr@Jp@Jr@BXDVPjAJp@DXBXDVJr@DXDVBVJr@Hd@@JJr@Hn@Jr@Jp@Jp@Hp@FZBVBL@JJr@Jp@Hp@PjAJp@Hj@@DHp@DZDVDVPjAHr@Jp@Jr@Jp@@HRzAZvB@DJr@Hn@Jr@Lx@hBrMNhAVbBPnAJx@t@dFv@zFt@hFn@rEHh@Hh@Fh@Jr@Hj@Hh@RrAFh@@@PrARrARrAFh@RvAVbB`@tCPrANdAVdBDXL`ALz@T`BF\Jp@D\Jl@Jn@TlAVjALl@Nv@Rx@R`Ax@rDp@|Cd@zBt@fD^dBx@pDR|@P|@ZvA`@dB\`B`AlEZtADVNp@Nn@Np@Nn@FXDVNn@Np@FVFXFVFTFXLp@FVFVNn@FVLn@HXLp@Nl@FX?BLf@?BFVH\DRNp@FTNp@DVJ^Jf@Np@Np@Ln@Np@FVNn@Nr@HZDRFVNp@DVFVFXNn@FZFTFVFXJb@BLLl@FVFXFVNn@FXFXDTNp@FVFXNn@Nn@Jf@H^FZNl@FXFVDTHZDTNp@Np@Ll@FXFVNp@Jb@Jb@FZNl@Ln@H\FTLp@Nl@Ln@Pp@Nr@Ln@Np@Nl@ThANn@Np@Np@Jf@J`@Np@DRFZBJBJFV@DDPDTHZDVHX@HBJHZ?@DTFTFZBHJd@FXFTFX@HBLFVNp@FVNr@FRFXLn@Nn@?@Np@Pt@DPFVFVLp@FVH^DPFVNp@Nn@Np@BNBHDVFVFVFVFXFXFVFTFXNp@FVDVHXDVNp@FVJd@J`@Np@Np@DVJ^BPNn@FXFVLn@HXFVDVVhANn@FXFVDVHXDVFVNp@FVNp@FVFVLn@Pr@DTFVFXFVFXNn@FXDTPr@H`@R|@Np@Nn@Nr@FVDVFTFXFVNp@FVFZLj@^bBNn@Ln@Nr@FTFV?@FVFVNn@Nr@Ll@FXNp@VhAR~@BHH^BNNn@FXFT?@FXFTLn@Np@FVFXNl@FX?@FTNp@DTNp@Np@Nn@?@FVLl@J`@R`AFTNp@Lp@Nn@Np@Ll@@@VhATfANr@FXVfA\~ANp@FVNp@Nr@Nn@FVNp@Lj@FZFTFZFVNn@DV@@Ln@FVNn@Nn@FXLn@FVNn@FZFTNp@DTNp@FTFXJf@Px@FTFZFVFVFXFVLn@HX@FBPFTFXf@zBNn@FXFVFZBHBJDVNn@FVFZNp@FTNp@FV@BLl@FTLp@FVNp@Np@FVNp@DTFVH`@DLFZFVNn@FVFXLn@FXFTNp@VhAFZLj@Np@FVFZDLH`@FVFVFXBN@DHXFZDTHXDTBLBHFXFTDV@@Np@DV@DDNNr@BJBJFVFVDTHXFXDTFXFVFXFTNp@DTNr@HXDVFTFXFXNn@FVFXNn@Lp@Np@FVFXNn@FVFXFT?@FVFVFXFVDVHXDTFXFVDP@FFVFVFVFV@DDPLp@DN@FNp@FVBHBLFXLn@HXLn@FXFVFVNn@?BFTFVLn@FXFVFXNn@FV?@FVFVBL@FHZDVFVFT?BFVFVNp@FVFV?@FTFXH^BJTfANp@^`BBJh@dCNr@Nn@VhAFX@BLl@FVFVNp@Nr@TfANp@Np@Np@Ln@Pp@Lp@J^R`ANp@@BLh@?BFR?BH^Lf@Np@Np@FZJb@XrAFXNp@Rx@Pt@P|@FXFTLp@BHR~@Np@Np@Nl@Nr@FV?@Nl@Nr@VhAThAVfA@FT`ANp@VjANn@Np@?@FXNn@Ll@VjAXnAFZNl@Jh@H^DLJf@Ll@XlAR~@Hb@Pt@d@rBf@zBXnAJh@Rz@p@`DLj@Lf@VlALh@`AjEXpANr@|@bEJd@DNFX?@Nl@VlAJf@BDFXNp@Jd@Jf@@BJf@XpALh@XrAJb@Lj@dAxE|@`EH`@FZRx@R`AFXNp@Rx@?BJb@VhANp@f@|BFVFXFXFVNp@VlAFTFXFVNp@Nr@FXNn@Pv@DRNp@FVFV@FH`@@B@DFVVjANp@FXVhAVjAPv@TdAv@lDTfA`AlEp@vCLn@Nr@XjANp@Nr@Lp@Lp@Lr@Lp@Jr@Jt@Jn@Hr@D^BRD^Fr@Hp@Fx@Fr@Dn@@XDt@Dr@Bt@Bz@Bn@@X?X@t@@v@?v@@p@AX?t@Av@Ax@Ap@Aj@ALChAEt@IbBC\Et@CTC\Gz@KhAGn@C\MnAOhBKjAEn@Iz@Gr@SdCGr@Gr@Gt@OfBGr@E\CZKnAKjAAJEh@Gr@Gt@Gr@Gr@KnAGt@CXCPGz@Gt@Gr@Gr@MpAGt@SbCCXC\CVCXE\CXGr@AVKlAMnAKlAKpAKlAKpAGp@CZCPG|@Iv@Gr@En@KnAMnACVCZOjBGr@CZGr@KlAKnAKlAOjBGt@MlAGz@CRGr@KpAOfBOfBKpAKlAKrAKhAKnAKnACXCXCXGf@M~AcA|LQlBC^k@xGs@vIIp@k@hHEf@eA~LOjBAPI~@C`@UjCALE^CVALMxAKtAIz@CVQtBMtAKtAS`CGl@KpAGp@KnAS`Cg@jGE`@E^e@|FObBEl@QnBGn@UtCKlAM`Bk@pGGz@a@tEEj@a@vE_@vEYfDSdCGj@KtAAJGp@S~BGp@UtCm@fHM~AOhBi@pGO`B[rDKtAAH_@bFYlDy@lJIx@W|COfB]dEs@pI}@rKy@xJm@pHi@jGUpCObBEh@mFno@SdC}@nKKjAMdBM`BKlAIfAInAGdAEv@EjAGdAElACr@ElAAf@A^Cr@Av@Al@Ap@CnAAbB?nAAhA?d@AjA?pAAdCAvCAbB?r@?lAAp@A~B?vB?DAdBAhB?dBA`B?jAAjAErOAV?d@?^?d@A`@?`@?b@AxA?d@?f@?^?JAb@?Z?X?Z?d@Ad@?f@?\?\?XAX?b@?B?r@?t@Ax@?x@Av@?nAA`A?`AA`A?n@?bAAx@?|@?f@AbDAbDAvBA~A?@?lA?`DAfA?fAChBCxC?xCAjFAzCAnFIzVCxEAtDAjA?hCEdLChECbIArEAvEEpIAhCEbOAnEEvKCvJ?@?^?ZAX?V?^?V?X?XAX?Z?X?X?Z?XAX?Z?XAX?XAZ?XAVAZAZAVAZAXAXAVAZCXEr@AZCXCXCXCXAVEZCXCVCZEXCVEZCVEXEXEXCVEVYfBGVEZGVEXGTGXGXGXGVEVGVGXGVGVGTELCLGTIXIVGTIVIVIVWv@Od@Ul@GPM\ITIRKVIRKVKTKVKTKTKRKVKTKRKTOVCDGLKRMVMRKRMRMTKRMROTMRMRKRIJEFMRORMPMPOTORMPMNQVMNORMPOPOROPMPOPMRQRMPORMNQRMROPOPMROPMPQRORMPOPMPORMNQTMPOPORMNOROROPMPORORMNOREDILMNOROPOROPMPOROPORMPOROPORMPOPMROPOPMRORONMPORMPOROPMPMPQTMNKLCDMNORMNOROPQTKNOPORORONOPMROPMPGDKNMNOROPCDMVMLk@t@QT[`@SVk@t@{BrCgDjEAByAjBg@p@}@hAe@n@_CxCq@|@aAnA{@hAuAfBeArA_C|CeC`DeBxB{@hA{@fAIFgB~BcAnAWXmAzAi@l@eAlAUZ_@Z_@d@UVsCrCw@v@q@l@CB]^}@t@oAdAYVo@j@u@l@QLYTyBfBGDGDSLc@VyExCSLu@d@sAx@[Rs@b@_@TUNq@`@IFoAt@QL_Aj@MHe@Zg@XUNOJQLiAp@[Rg@\}@h@_Al@{A~@SLQJUNGDo@`@WNMHWNQJ_@V[RQJMF]TMHQJ]Tq@b@WLSLe@ZMHWPQJSLg@ZkAr@g@Za@VUNk@\a@VSLQJ_@To@`@SLo@`@IDQLC@c@XIDUPWPEBIFYTMJQLKJEBOLURKHONQPCBKLABQPORQTOPMPMPQVMTa@p@_@p@Uf@O\O^M\K\O^Oh@IZGVGTIXETGXETGZE\ETGZAHCPEZANCLE^G`@E\CXETE\OlAIn@OnACNCRE^Kt@Gf@EVCZETE\CVEXIn@CRQvAEXEXCVQzAWrBIn@EVCXE\WnBGj@ETE\E\CVEVEXCTE^AHE^Gd@CRE\CNGd@E`@CNEXCPCRGj@Ij@EZE\CXKx@a@bDGb@CVE\Kx@CNEZE\Gh@Ip@Kp@It@Gb@ALE\E\Ij@In@Gf@E`@Kr@?@Gh@AJOdAIv@SzAANIh@AL?FCPAHCRC\CXEd@Ch@APAVE`AAh@AT?p@?`@AX@X@v@?\@\@X@\@R@D@XBX@ZBZDZBVD^BRD`@DZDTF\BTH\DVFZHZJd@Lh@Pp@Rl@JZHVJTFRd@lARf@r@hBb@jARd@@DRf@N\FR`@`Ab@jAf@pAv@pBdAlC^`AN`@pBdF`AbCVn@Xv@|@~BDFJZJTHTLZ@BDLFNJXn@~AJXJXLVHTJVFNFRFLf@rAJVJTJXVn@j@vANb@Rf@HRJVb@hAHR`@dADJ`@dAN`@d@jAd@lAHRJXHRVn@Tl@Tl@Pd@rAjDJVHTVn@HR@@HTDHN`@HTJVJTHVJVVn@HPVp@HTJVLZJZFLVr@Xt@Vr@j@bBVx@ZfADNRr@DPPp@H^Lf@VjALp@Np@DVF`@Lp@Hh@Fd@Hf@D`@BNBXDZBRDVB\Fl@@D@RBPDh@BVHfADz@Dl@?F@H@N?FBp@Bb@?H@L@b@@P@b@?R@Z?L?N@V?\?b@?N?X@ZAX?P?N?P?X?r@A~@Ah@?v@AdBA^?TAr@?t@A^AhCAh@?h@AxAAvAAzBCdCAzA?d@?XAZ?V?\?XAX?X?XAt@?V?B?NA|@?XAV?X?^?LAd@?ZAfBAX?X?T?DAX?V?V?B?ZAX?T?`@?VAVAhB?ZAr@AnA?r@?XA\?X?R?V?FAN?F?R?`@Ap@?F?RAX?v@AV?Z?X?RA^?X?ZAX?X?XAX?Z?X?XAZ?X?X?XAZChEA|CCjC?nAErF?RCfCEfGCtECtFEzEAlA?TArBAh@?~@AdA?d@Ap@?\Al@A`@?V?XAhBAZ?T?t@At@?t@CtDAnA?XChBKxPC`DCpGElFEbH?j@EfGCbBCzFCjEAdBAj@AfAAnBChCIxBAt@GnAAb@Cj@ATQ~DMhBIrAIhAEf@Gr@C\CXCVALE\Eh@U~BGj@Il@E\CTE^CTABEXE^M`AKp@EXE\EVEVGZEXKp@GXCTGXEXGXMn@G^w@jEo@lDg@fCETQ|@ADI`@o@lDUjAUlA[bBi@vCUfAALKf@[bBk@xC[~AOv@gArFcAjFi@`Cu@fE]pBu@vDGXg@jCy@lEg@pCKf@w@fEMp@a@xBA@a@xBMr@Mj@{BtLe@bCCNEXYrAOv@SjAMn@WrA[~AUlASjAMp@GZEPMt@Mp@WpA[dBGZKh@Kf@Kh@Kh@WrAMn@Kn@Kd@SfAKh@Mt@UhAOr@Mn@Qz@I\Or@Ml@Kf@Mh@Sx@Qt@ADQn@GRGXIXGPSx@Qn@Sr@Qj@CH[bAQh@KZIXQf@M`@GPKZQf@Wp@GNENSh@[|@Wn@MZYp@_@~@?@Uf@MZWl@c@`AABSb@Yn@q@~AABm@rAQ^_@z@Wl@]v@Sb@INIRQ`@Sb@g@hAIRINYn@MZYl@Q`@Sf@a@z@ELMV[r@Sf@OZ{@lBe@fAq@xA[r@w@hBe@bAWl@ABWh@Sd@o@xA[p@Wj@a@~@g@hASd@_@z@GLc@bAm@tA_@z@k@nAc@bAWj@e@fAQ^i@lAQd@_@v@_AvBk@lAaBtDk@pAs@|Ao@vAc@bA{@pBIPm@tAa@|@m@rAQb@e@dAO^m@rAADe@bAIRe@bAe@fAKPKTMTKTMTYh@[j@CBU`@A@S^W^S\U\MRA@KNY`@W\Y^]d@g@n@_@`@A@MNOPOPa@b@]\a@`@?@a@^i@f@]XONc@^MJ[TQNIFYTMHEBQNMHm@b@g@Z[RUNUNOHQJSJMF]ROHMF]P]NULE@SJSHSHSHSJ_A\SFSHUHSFSFUHSHSFUHSF}@ZUFUHUFSHSFQFWHSHUFQFC@SFSFUHSFUHSFUHSFSHSFSFA@SFUHQFA?UHSFQFWJUFSFOFYHSHUFSHUFSHSFSHUHSHUFSHSHSJC@OFUHg@TSJSHSLSJSJQJSLe@XGBKFSLQLSLQLSNQLQNQLMJCBQLSPWTOLQPQNQPq@p@QRONOPQRONQROPMROPA@MPORMROPOTMR]f@MRMTMRKPABMTMRMTYj@KTMTKR?@KTKTMVKTKVGLAFKVKTIVKVIVIVIVKVIVIXIVGVIXGVIXGVGVGXGXCJCJGXOr@Mp@EXEXGX?FEPEZEXEXCXEXCXCXEVCXCXCXCZCXAXCXAZCXAZAXAXAL?LAZAV?ZAXAX?\AX?X?ZAX?X?@?XAX?XAZ?Z?XAX?Z?XAX?X?ZAZ?X?VAZ?Z?XAZ?X?XAZ?L?JAZ?X?XAZ?X?ZAX?Z?VAZ?Z?XAZ?X?XAZ?T?D?XAZ?Z?XAX?Z?XAX?ZAX?Z?XAZ?X?\AX?X?XAZ?Z?XAX?ZAZ?VAt@?X?Z?VAD?j@AT?`@Av@?`AClB?NAtAAp@?l@A\Ar@?B?v@Av@At@?r@Ar@?ZAv@AjA?F?T?NAx@?VA`AAT?t@AV?\An@EzE?ZCrCEjFAjBALA`CAlAAt@AjA?NCbB?r@AZ?X?VAb@?RAlAAjBAlAAt@?Z?\Ar@At@?p@C`B?TAr@ApAAFA|@?N?h@AfA?j@AP?d@Ar@?HAt@?l@AJ?R?~@?n@A|AAdA?BCpA?PAjA?TAr@ArBApACnB?r@AnAApACbBApBAt@AvA?XAp@AfA?h@Ah@?FAtA?`@CnB?HCnDA|ACvCAdBCnBAt@?t@A|@A`BCdBAnAApBAnAC|BAbA?h@AlAAz@ApAAtAAnAAlA?^?j@?F?b@Ah@Av@CbBAdA?FArAAt@AjBAhA?\Av@Al@?f@?DC~A?j@CnBArA?v@AhAAx@?NAl@?h@At@At@?t@AV?\Ar@?n@AD?t@Ap@?@?t@Ar@?@At@At@AnA?r@At@ApAAt@Ar@?t@Ar@?ZAf@?f@At@?t@At@Ar@Ar@?\?r@At@At@At@?t@Ar@At@?t@At@?r@At@At@At@?t@At@Ar@?t@At@At@?t@At@Ar@?t@At@At@?t@Ar@At@?t@At@At@?t@At@At@Ar@?t@At@?t@Ar@At@?t@At@Ar@At@?t@Ar@?t@At@At@At@?t@Ar@?X?\AZ?XAr@Ap@?BAnA?t@Ar@CfDCpDE`FAbAC~DCfBAvBAbAAp@?ZA~AAfBClBAnAAdBEvFCzCCnCAvBChBAfCEvD?l@CzAAdCAjAAnAApAC~CApBCdB?~@?JAb@AlAAt@?p@?\Av@?n@?d@Aj@?P?F?Z@\?^?j@@f@?b@?V@`@?\@T?P@b@@X?V@X@^?X@d@@d@Bt@@Z@\@TFnAFnAFtA@TDr@Dt@Dj@@LDn@B\BZ@RD`@?@@VBZDX@PBR@N@L@J@N@HBXDX@PBVJ~@Fj@Fd@BNBX?@Hp@Hr@Jv@NpAVzBHj@NtANrABRPzAD\LbARfBTfBTpBLdANnAV~BF^Fh@Hv@NnAJv@?@BTDb@LbAHp@Fh@R~A\zCJt@BVHt@Hl@Hp@D^BRFj@Jr@BZHp@Hr@Hp@@DHn@LlANnAFh@@HDXDVBXD^Fb@Fb@D`@LfAHr@Hr@Fd@Ff@Hp@@DBZDXBVDVD\BVBXD\DVBVDZBVDZBTD^DVDZBXBTDXDZDXBXBVDZDZDXBVBXDVDZBZDTD\BVBVD\DVBXDZBXDVBVD^DVDZBXBTDXD\BVDVD\BVBXDZDXBVDXDXBXDXDZDXDZDVDVFVD\FVDVFXDXFVFZFVDTFXHZFXFTFXHXPn@FVHTFVJZFRHVHZHTHTJXHVHRJZHTHRHTLZ`@`A?@JTJTHRNXHRXl@JTJRXn@JRJRLXJRJRP`@FLJRJRLVJRJTJVLTJRJVLVJRTf@BFJPJVJRLVJTLVHPLTJTXn@HNLVJTLVJRBFFLJTLTJVJTLTJTLVJTJRJTJTLTJVJRLTJTJTJRJTBDHPJTJT@DJPHTJTJVJTHRJZJTHTHVJVHVHTHTHXHXHTFVHVHXFTFVHZFTFVHZDVFT@D@HBHFXDXFXDVBN@HDXDXFZBVBL@HDXDZBVBVD^BVBVDXBZ?H@NBXBXBZ@X@XBZ@X@X@Z?D@R@X?X@Z?X@Z?V?Z?Z?X?Z?VAX?^AX?TAT?DAZAXAXA\CVAZAVC\CVAXEZAXCVEZAJALCXEVCZEXEXCVEZEXEXEXEVEXEZEXCVEVEZEXEVEZEVEZEXEXCTG\EVCXGZCVEXEVEZEXEVEZEV?DCREVABEVCXAHEPCVEXCNAJEVEZETEVE\AHCREVEXEVAJCNCVEXCPCHCVEXEVEXEZEXEXEXCXCJALGXCXEZEVEXEVE\EVEXCTABEVCVG\CVEVE\EVEV?BERCXG\CRG`@CTEXEXEXEV?BEXCTGZGb@CNCVEZEXKp@Gb@CNEXCVGZCXEZETAFCPEZCVEZEVEZCXEVEZCVE\CVEXCXC\EVCZCVAJALCXCXEXCZCXGp@Gt@Gr@EZAJAJAXCXCXC\CTAZCZAXCV?@AVAZA\AZAVAVA^AVAZAXAXA\AV?BAXAVC\AVAZAZAXAXAVAZAZAXAZAZAZAVAZAZAXAXAVAXC\AXAXAZAXAXAZAZAVAXAZCZAVAZAZAXAXAZAXAXAXAZAXAXAZAXAZAXAXAXAXC\AVA\AXAZAVCZAXAZATCZC\ATC\CVGn@C^EZAVEZEZCVCVEZKr@CTG\CVGZEVKr@GVGZETEVGXG\GTGVGZETIZETGZGVGXGVGVGZGXETI\ETGXGXETIZMn@GZGTGZETGVG\GVGXGTGXGXEVGVGZGVGXADEPGZMp@WjAGVGXEVGXGXOp@GXMn@WlAOp@I^Mj@EVGVGZGXOn@GXERG\WhAGXEVGXGVGXGZGVGXGXEVGXGTAFCNGXGXIZEVGTG\GTGZGVEVIZEVIXEXGTOr@GVEXGVGVWlAETWjAG\ELWpA_@fB]bBGXOn@]bBiAnFe@rBg@tB_@nAMf@ABGTe@tAm@hBCHk@xAMXw@jBq@tAGPw@vA{@vAmB|CMPOROTORKPOPORCDILOPOTMNOROTkA~AmBfCMPORMNGJGHMPQTILQVORMNOROTOPMPA@MRMN{BtCOR}AxBMPgBbCCDMNOTMPOPOROTORMNQVMPORMNORMRORMPMPQTMNQTMRA@KLKNEDMPEFGHQTMPOTMPMPQTMPKNA?QVMPORORMNMRORABKNOPOTMNQVMNMPQTCDILMPORMPQTORKPORMRMPCBKPOTMRKPQTKREFIJKROTMRKPOVMROTKTKPGHGLMRMTGJEFKPOVKRMROVU\eElHu@rAMTMRMT[f@MVKRQVKRKPOVKPOXKPMRMTKROTMTKPA@MTKROVMPKROVKPMTMTMPMTMTKPOXKPOVMRKPOVKRKPOVKROVKPMRMTMTMTMRMRMTA@KPMTMTMRKROTKRMRMTMTMRMTMTMTMRA@KPMTKRMRMRMVMRMTMRKRMRMTMTOTKROTKRMRMTMTA@INOVKPMTOTKRMRMVMRMTMRMTMRKRMTOTKPMTMTKROVMPKRMTMTOTKPMTMRMVMRMTMRKROTKRMTMTMRMRMTMRKROTKROVKPMTMRMTMRKTOTKPMTOVKPOVKRKPOXMRMROTKRMTMTKPMRMTOVKPMVMRMRMRMVKPOTKROVMTMRMTKPMTMTMRMRKTMRMTMRMRMTMTMRMTKROTKRMTMRMRMTMTMTMPKROXMPKROVKROTKRMRMTMRMVMRQXe@x@GJm@dA_@n@EHYf@]j@OXe@x@OV]j@MTYd@w@tA[j@g@z@c@t@S^]j@Wd@SZ]n@CBMT[j@]l@[h@Yd@_@p@CB_@n@i@bA]j@q@lAU^A@a@t@MRMRWd@_@n@OXGHGJGJQZEF]n@Wb@ININCBU`@INYd@INCBCFGJWb@]n@_@n@S\MROVEJOVg@z@a@r@U`@Yd@U`@S\QXS^Wd@QX}AnCaA`BGJEFIPU^GLKNa@t@u@pAMRw@rA?@c@t@c@r@[j@q@jAINo@fAaAbBWb@OXgAhB_@p@INe@x@MRg@z@INS\_@p@g@x@m@fAaBrCe@x@a@r@a@t@{@vA[l@CBy@vAs@lAMTOXU^_@p@Yd@]n@aA`B{@zAc@r@O\OXcCfEW`@U`@U`@wDvGEFUb@U^i@~@MTILA@s@nAi@`Aq@hAOXGHkAtB}B|DwBvDa@r@OVKRe@v@OXMPm@fAKNQZGLMRGJOVQXkCtEeAjBqAzBq@hAU^SZy@lAo@|@EHGHIHGHMPQTKLOP]`@y@`Ay@z@a@b@e@b@ONs@p@wAlAiA|@_CfBeAx@oCrBWRMJqCvBc@ZcBnAo@f@}AlAw@j@]V]Vc@\{@p@yAhAYTMHOL]VC@e@^m@d@GDOLQNQNOJQPCBKJSPQNOLQPONMLCBOPONONONQPMPQPOPMNQROPMPMPQRMPORMPMPORORKPOTMRMPMRMRMRMRKRKPILILKRKRMTMTA@GPMTMTMVIRCDINIRKVKTKRKVEJEHITKVKTITM\GNKVITKVITIRKXITIVKVIRITKTITKZKVO`@O`@KZKTIRGPKVKXQh@Sh@Qd@Yt@Qd@Wp@Qd@Yx@[v@_@fA_@`AGPEJCFUn@Wn@Sh@KZ_@`A_@bAKVKXGRUj@Sj@Wp@e@pAg@pA{@`CUl@_AfCuAtDQd@Qd@cHhRQd@KTIVITKVKTSj@{BfGeAnCa@fAg@tAqAbDiDpIa@bAa@bAKTUj@Wn@ITUj@MXUj@aAdCa@`Aa@dAIPADO`@Yt@kAtC}AxDw@pBo@|AGPeChGGJGLITKTKVITKTKVIRKVITKVIRKVKTIVWl@IRKTKVUj@KVITO\GNITKTKTITKVITWl@Ul@KTITm@vAKVKXmAxCUl@ITKRKVKVKVIRITKVKTUh@Qd@O^KTKXIRa@bAWl@IVKRKVITKVIRKVKTUj@KVIRKVKTIVIRKTKXKTO^EHIRMZMZGLGLQb@MVKVINEJMVCBQ\INKR_@p@e@v@g@r@MRMR_@d@ORMPOPMPQRMNORMLa@b@OP]\A@WTMLONOLMJc@^URMJSNOJSNQLQLSLQLQLQJSLOHIFUL[PQHQJGB_@PUJSJOHUHID]NUHMDa@NKDYHKDe@Ns@RqAZu@NA?UDe@JWBKBI@SBSBSDU@UBSBWBU@UBK?G@U@UBU@S@U@SBW@U@W@G@_@BW@Q@S@WBU@]Ba@@UBU@S@U@UB_@@_@Bk@DU@i@BaAF_AFU@i@Di@BQ@Y@WBg@BS@W@UBC?Q@U@K@O@]BC?U@U@S@WBW@M@u@DQ@S@S@S@WBU@Q@WBS@Y@S@U@C@O@U@W@e@D_@@c@DU@YBY@WBsAPWD_@Di@JG@SDUFk@Li@N]Jc@NSFQF[LQHIB[NSHWLQHQJWNMDYROJSLSLQLSLQNIFGDQLQPQLQNQNSPa@^a@`@c@^OPQNQNQNa@`@QPQNmDdDyArAuBpBeFzEsAnAsAnAcFvE[Z]X{@v@[Zc@^SRQNMJUV_@ZQPQNOPQNONSPc@`@YVYVONQPQNQPONSPMJQRQNOLQPONWT[Z[XWVQNSPWTYXc@`@WTm@j@QNs@p@ONQPSP[XGFSPKJc@`@ONSPONQNa@`@SPMLQPQNONQPQPOLONQPQNQNONa@^c@b@OLSRONOLc@`@QPa@`@c@^c@b@QNQNQPONQPQNOLQPc@`@QNONYTIHyBtBONUP_@^SNONQNQNQPQNOLQPQNQNSRONONWTKJa@^g@b@KLk@f@k@h@ONQNa@^QPg@d@YXSPQNONONQN[Xg@f@OLQPa@\QRQNURUTUTOLQPQNUT[Xc@`@ONQPONQNMJc@b@QNONQNQNMNSRQNWT{@v@ONa@^QPQNGHi@d@ONyGlG]XmCdCWVa@^QNGHGDQNcA~@sApAUR[ZKJWTuAnAs@p@q@n@_@\u@p@cB~ASRqAjAgD~CoDfDc@`@A@c@^cB~AA@kAhAEBABUPGFgAbAWV{@x@QNa@^e@d@KJONQPONA@OLWVSP{@v@q@n@URi@d@k@h@YVWVML]XUTYVUTc@`@w@t@[X[Zk@h@_@^WTONWT_@\c@^k@h@aCzBy@t@WVy@t@c@`@]Ze@b@GFc@b@i@d@a@`@QNWTYXQNONKJIFSPA@IHOLQPQPOLA@a@^QPA@QNg@d@GFo@l@C@u@t@A?[ZqBjBg@d@s@p@c@`@a@^a@^ONa@^c@`@a@`@a@^QNa@^QPq@n@SP_@^c@^gBbBmCdCABYTa@`@eA`Aa@^s@n@q@n@QPc@`@kAfAIHONQNED]ZGFi@f@QNQPOLQPONQNQPQNONQPMJUR_@`@QNQNQPA@OLONURk@h@QNQPONQPOLQPUR]ZQPONQNQNONONQNOPQNONSPc@`@ONWTQNIHGF_@\ONMJQPQNMLONQPQL?@OLQPQNQPQNSRm@j@SP_@^QNQNONQPa@^GFIFONQNQPQNOPOLQPQNQPSPa@`@}A~Ac@d@a@`@MJUT_@\_@^URMLWV[\ONIJA@QRGFiAjAOPOPUTA@[\OPc@f@GHSRa@b@OPON_@b@_@b@QPONUXWXSROPOPONm@p@s@v@q@t@OPOPe@f@{@~@aBhBm@p@iDtDo@r@aCjCMNaBhBs@v@aDlDIJON_@`@aBhBQTKJQRQP_@`@q@p@_@`@s@p@o@n@SPQPOLKJ]ZIHSPc@^EDYVUPIHC@ONQNQLQNMJEBOL_@ZUPiAx@IFKHMJe@ZSN[R{@l@mAx@A?MH[RMHg@ZsBlAMFWPULQJSJWNc@R]PKD]PWLYNWL]N[Ng@TYLID_@Nc@POHWJQH{@^YLSHSJ]NWJC@sB|@IDwCnA}BbAcAb@cA`@e@Ts@ZsB|@w@\q@Vu@\o@Vu@Z_@Pq@X_@Pc@Pc@R_@NEBi@T_@Nc@Rg@Tu@ZYJ[Lo@Tw@V]JIBIBi@Pg@Lk@Ni@Lg@Ji@Li@JI@_@Fg@H{@Lq@J_ALk@H[DQBg@Fa@Fo@Ho@Hi@Ho@Hc@Fi@He@F]DK@u@Ja@Fq@Ha@Fq@Ho@Jg@Fq@Ji@FK@m@Hm@Hg@He@Fa@Fe@Fa@Do@Jk@Fg@Hc@Fq@Ha@Fg@Fc@Fa@Fa@FUBOBk@F[FI@w@JaALu@Jq@Jg@Fm@HWBi@Hg@Fe@Ha@F_@D}@JA@aALm@HyARe@FSBMB]D_@F_@FWDSBi@F[F_@Du@Hy@JoAPwAPUD[D{@JoAPeANmBVE?kAPo@HuAP_ALk@Hs@JiANwAPeANc@FSBk@H[D_@Do@HUBe@Fm@FE?c@Fi@D_AJaAJ_AHK@u@Fk@Fi@Dk@Fi@DsALcAJaAHi@Fi@Dk@Fk@Di@FS@k@F{@Hc@D{BRiBNm@Fk@FWBk@De@Dg@Fi@DeE^w@HU@QBm@FQ@oAL{BRO@wANWBU@i@FYBOBm@Fc@D_@FM@w@L[Fq@Le@HYHi@JYHq@P{@Xi@P]LaA^gAd@eF`CeF~Bu@^kClAMFkBz@sCrAWLUJaAd@w@^OFsDdBmLpFoB~@sDbB{@`@_Ab@OHi@TQHULg@Te@TUJ}@b@a@ReAf@u@^e@RSJ_@PGBkAh@aAd@wB`AcBv@kD`B_EjB{E|B_DvAgErBkClAaBt@gD~AgCjAaBv@iAh@o@Xe@TWJy@`@u@\aAd@e@T_@P[Pi@Xs@`@k@\c@X]T[Te@Za@Zc@\g@^QNQNQNONQNQPQLQPONQNQPONOPOPQNORQPOPONOROPQRMPOPKLORQVMPORY^_@j@[d@]h@Yf@]h@QXKRYh@Yh@Q\MVYl@Sb@KTWh@Wn@KXQ`@M^KTKVGTKXUn@Wv@ENSp@g@~Ac@zAk@hBSr@_A|CIXELUv@[fAUr@Y`A[dAIV_@nAw@jCKX[dAQl@Ut@[bAY|@Of@GVSj@Sp@Sp@Uv@K\Ur@m@nBc@xAg@~AGR[dAi@hBq@vB_EtMaDpKOh@q@xB[fASn@]dAGTq@zBg@`BSn@]hAQn@Sl@Sp@Sn@GVKZwAvEQn@IVIRaBrFIXIVIVIVIV[fAITIXg@`BIVGVIRcEdNGTKZQl@q@zBmA|D]hAIXcAfD[dAQh@GTQj@ADCFIXa@tA_@lAKXUv@o@tBs@~B_A|C]jAUv@a@pAeAlDc@vAOd@Of@IXyA|E[bAIXGPADM`@?@Ob@Qn@KZWx@]lA_@nACHOb@IXITGVA@[dA[dAWv@Md@M`@oBpGIVELAFIVGRIXIVKZK^Ob@?@Qh@[dAIVIVIVSr@GPW|@Wx@IVAFWz@GRI\Qp@GVGVK`@Mf@GVETGX?@GTERG\CNI`@EZCNCHCTMp@E\ETCXEXEXOjACXGd@OvAIr@MjAShBIn@CVCXQ~AKz@a@rDE`@AN_@~CCRCVIt@It@Ix@Gh@Ir@W~BKx@_@lDCXIr@MhAEXGp@c@vDUxBADGj@MfAW`CW~BQ~As@nGQ`BIn@q@dGGh@SrBCLGl@WvBGn@gAxJW~BGj@W~BGj@Q`BOnAMlAIp@CTE\MjAk@lFKx@K`A[rCGj@qBxQgBlPOnAo@`GADOtAOtAIv@}@nIq@dGUvBGj@_@bDYjC_@vCOlAKt@]|BKr@WbBMt@c@`CUhAMp@]~A_@dBS|@u@~Cw@dDmB~HSx@?@Uz@gBpHS|@e@nBm@bCMd@?@y@lDeBfH}@tDCJIZg@vBMj@Uz@e@xBUhAUlAYdBKp@YvBE`@Ir@Gp@MnAi@vGc@vFEj@Eh@Eh@M`BKvAS`CQ`CMdB]hE{BdZk@nH_@`FIbACVEj@OhBUxCe@bG]xEC\ALQvBEh@Gt@Ej@IjA_@xEAHGv@C^KtAw@bK_@zESpCIz@SlCKvAGt@E^C^Ej@YtDi@fH?D?@CRANIpAQzDE`AAXAd@Ch@?DA`@CvAEbBElDAJ?L?RAN?PA^Af@?ZCfA?@AjACxAE`CCpBAT?ZAb@Af@?ZAZ?b@AX?XAR?V?JALAv@?^APAl@?H?L?NAXAt@AX?ZAX?ZAV?XAZ?ZAb@?NAZ?VAZAV?ZAX?ZAXAx@A^An@?VA^Al@?ZAXAX?\AX?XA\A`@?^EbCCdAAv@C~AAx@?b@AZ?NAXAt@?PCfAAbA?HAN?l@AVAV?\?RCjAAt@AX?D?F?J?B?D?FAH?TAZ?XAZ?ZAREpCAbAAx@Ax@AT?\Ad@C|@?R?RAj@AZAZ?Z?HAN?VAZAdAGzBAr@APAd@EbAEv@G|@AL?LALALAJANAHAJAL?HAHAFAH?FAFAJ?FADAPIn@?BCNGh@SbBMbAK|@UhBKt@In@Ix@CLALETMjA]pCA@k@tECVo@fFCPCTIl@Gh@OjA_ArHQvACZEXEZEXCVEZEVCZET?@EZCXEVCXEXEXEXCXEVEZCXEXCNAHCVE\CTEXEXOpAEXEXCVGf@Gd@EXEXCXIl@EXCXOjAa@hDStACZUdBAFCVEZQ|AWlBAD?DAD?FA@?DADAHADAJAHADAJAF?DAFAJADAHAF?FAFABALAFAHAFAJAJCJAJCNMjAAF?@ABALAHAD?DAFADAHANCNCLCTEXCT?BAJCH?DAFAHAD?DAD?BAD?BADAD?DAHAHCNALCJAJCNk@vE{@jHYzBSfBWnBGj@CPm@zEE^UfBQtAAHAHANOnAQnAYdCQnA?DGd@AHM|@Y~BAJKz@K|@CLQxAIr@a@zC?DQrAi@nECLUhBK|@Ih@?FQlAc@rDi@pE[bCe@tDY~BALiDxXOlAIr@QnASdBEVIt@OnAUfBOjA_@|COlAOnAUdBY`C[bCOlAOlAOnAY~BOlAIr@Kr@Ir@Ir@OnAKr@OlAUfBOlAShBUdB_@|COlAk@nEc@tDOlAQnASfBOnAaBtMSdBUfBOlAc@tDe@vDOjAIr@Kt@Ir@Kr@Ir@Ir@Kr@It@Ir@Kr@Ir@Ir@Kr@Ir@Ir@Kr@It@Ip@CNGb@It@Kr@Gh@AHIr@Kr@Ir@UfBIr@Kr@Ir@Kr@Kr@Kr@Kr@Mr@Kr@Mp@Mr@Mp@Mr@Mp@Mr@Op@Mp@Or@Op@Op@Qp@On@Op@Qp@Qn@Qp@Qn@K\ERQn@IX]dAg@`BSn@Sl@Up@Sl@]dA]dAUn@Sn@Un@]dAUn@Sn@Sn@Ul@Sn@Un@Sn@Un@Sl@Sn@Ul@Sn@Up@Sl@Sl@Un@Sn@Sn@Ul@Sn@Sn@Un@Qh@KXIVIVITKXIVITUp@IRKZIVGRIVKVIVIXKTGTIVKVIVIVIVKZIRIVITIVKXITITIVIVKXIVITIVIVITKXIVIVKVGTKXIVITIVITIVKVIVIVKXITITIVIVKXGTKVKXGRIVKZIRIVITKXIVITSl@KZGRIVKVIVITIVIVKXITIVIVITIVKVIXITIVIVKVIXITITITIVKXITIXITKZIRITIXITIVKVIVIVKVIVITSn@IVKXIVITIVKVIVIVIVKXITSn@ITKXITIVIVKXKXQj@KXIVITKZITIVUn@_@jAKXIVKZITIVKXKXIVIVKVIVIVKXGTIVITKXITIVIVIVKVIVSl@IVKVIVIVIVKVITIXIVIVKVOd@M^KXIXITKXIVKVIXKXKZSl@K\c@nAYx@Qj@EJCH_@hAcAzCUn@}@lCUn@Sn@e@vAkBtFa@lAQf@Od@Wr@k@dBGNUp@]dAEJc@pAOd@O`@IVIV}@lC}@lCs@vBUn@Qh@Un@IVIT?@e@tAM^IVIVKXITIVIVIVITKXITKXENCFITKVITITUl@KVKTKTKVITWj@MVITKTYn@c@~@IVKTKTMXITKTIVKTKZGRCBQh@IVIVKVITIXITIVKVIVADGRITIVKVITIVSn@IVKTIVM\EPKXSl@ITIVIVKVIVKXGRIVKVIXUp@ITITIXKVITIVGTKVITIXITGNSp@CFITIVIVITKXIVSl@GPCDg@|AIVKVIVIVIVUl@Sn@Sl@KXIVITSl@Up@Sn@Sl@KXGPKXSn@Un@Sn@ITSn@Un@Sl@CHELKVIVIVIVITKXSl@IVIVITKXIVITIVIVUn@IVIVITIVKVIVSl@GTCBSl@Sn@IVKVSl@Sn@Un@Sn@Ob@CHUn@Sl@c@tAKVCHQj@Un@Qh@KXK\ITKVIVIVIVIVIVKTIXITIVIVKVSl@IVIVUn@Sn@IVSl@Un@Sl@IVIVUn@Sn@Sl@Un@IVIVIVIVUl@IVSn@_@dAIVSl@IXUl@q@tBKVIXIT_@fAGTKVSn@IVUn@Sl@IVUn@Sl@Sn@KVGTk@bBIRIVIVIVKTIVEPCDCHELIVIVKVIVITIVIVKVITIVIVIXKTIVIVIVIVKVIVIVIVIVIVKVIVITIVIVKVIVIVIVIVABIRIVIVIVQh@CDIVIVIVKVIVIVIVEHCLITIXITIXITIXIVIVIVIVGVK\GPIXA?GVIVGPELENIV[fAo@vBc@xAKZCDGVIXIVIVIVIVIVIVIXGTIXIVIVIVIVGVIVIVIXIVIVIVGVIVIVIVIXITIXIVIVIX[fAITELCJIVIVGVIXELCHIVIVIVIVGTABGTIXIVIVIVIVIVIXIVIVGVIVIVIVIXITIXIVGVIV?@IVIVIVGVIVIVIVIVIXIVGTIXIVIVELCHIVIXGTIXIVIVIVIVIVIXGTIXELCHELCHIVIVGVIXIVIVIVGTABGTITIVIXGRIZIVITIXIX]fAI\CHWz@_@nA_@lA?@_@lASn@K^]hAa@rASn@yAbFQf@aAfDK\Ut@m@pBCHGReAdDK^GPg@zAK\Wt@CFK\a@fAIV[z@Sl@kAbDIRUl@Sj@{AdEIRIVIVKTIVITKTKXITIVKVITITKVIVKVIVKVITITKVIVKVITIVKTIVKVITIVKTIVITKVIVKVITKVIVITKVKV?@KXITITKVIVITA?IVKVITIVKVITKVIVKTIVIVKTIVITKVKXIRIVIVKVITKTKXITITKVIVITELEHIVKTIVITUn@ITKVITKVKVIVITITKVIVKVITEJEJOd@Yv@KVUl@i@|Au@rBk@zA_@dA_@dAUl@ITA@ITKVUl@KTWj@Wl@Wj@S^Q`@INCDKRYf@MVMTMRMTMRMRMT[f@MR]f@{@lA]h@k@v@{@nA{@jAa@l@w@hAkA`BOTILm@z@]d@KNQVEFW\MR]f@]f@UZU\m@x@_@j@Y`@]d@]f@iA~A[d@EFq@`Aa@j@k@z@a@j@g@r@m@z@a@l@uAlBaE~FYb@e@n@y@nAsAvB[j@U`@S^MV]p@Ud@[p@e@dA[v@_@~@Qd@Yv@Ob@M`@IR]fAUx@M^IZQp@Ol@K`@Kf@GRCPK`@Kh@?BMl@Kn@Mt@QhAMt@MbAKt@m@hEObAQnAOdAU`BM~@a@tCETKv@QjAU|AQnAWhB]bCWjBYtBWhBYlBYtBKl@Ir@YnBStAm@lEQlAALg@jD[zBYvBQnASpAU~A_AxGwAfKc@xCIn@c@~CUbBSpAObAu@lFg@tDQlA_@nCuAtJKv@WnBi@tD]`C{@jGWbBYtBq@`Fm@dEUfBEX[xBm@hEYpBa@pCKr@M~@a@xCa@pCg@rDq@xE?@YrBIh@Gb@ADIh@e@hDAJEVAFk@dECLGb@ADIh@Gb@In@QnAIl@SvAIj@EXIj@EVCVSvAKn@CVABCNObAKx@WfBKr@Ih@EXc@`DSxAUzACVa@nC_@lCGb@G`@CXIj@Kv@M|@AJG^EX_@jCO`AGh@CRKn@G`@?@Ij@OdAAFQrAEZIf@E\Il@CJCVKn@_@lCE\AJIj@O`ACPObAIh@EXETCNCNAHCJG^Mp@?@EVERKf@WtACHSbAETI^I\Sx@S|@Sz@YhAERMd@Qp@GROl@Sr@GPe@bBs@jCw@nCu@nCAFmAlEs@dCe@bBuAbFg@jBADk@nBqAxEy@tCk@tBaAjDa@zA[bASt@k@tBe@bBW|@e@dBi@lBkDfMwBvHaBdG_@rAs@hCQn@U|@Ql@GPCJYdAUt@WbA]jASp@YdASp@Md@W|@Qn@c@`BK^IZW|@[fASt@CLABA@K`@AB?@[hAa@tAOl@Sr@GROl@YbAUz@Kb@Qr@K`@IVIVIV?@M`@M`@ABMb@Ql@M`@K^St@Mb@ABMf@c@|AYbAMd@GPGTGTSt@Mb@Qn@Sr@IVOj@IZQn@IVSr@Oj@Ql@K^GVIVOf@Ux@CLOd@Qn@Qn@YbASv@Ql@Qp@[fAGVIXSr@g@lB_AfDWz@Qp@IVGVIXK^Qn@Qj@i@pBe@`Bm@vBU|@[fA_@vAOf@Qp@Of@IZg@dBOj@m@xBi@jB_AjD_@tAk@vBc@~AQx@Qn@GVKf@CLOl@Op@Op@UhAI\I`@I`@[zAI`@Mj@Mj@UhAI`@Kf@Q|@Kf@Kd@I^WpAENId@Kb@Kh@IZm@zCe@zBk@rC_@fBKb@]fBi@hCCLOp@UhAQx@Qx@o@~CCNGV?@k@nC]fBiApFMn@YrA]`BWlAWpAUdAq@dD[zAI`@WpAMh@UfAUjAgAhFG^UdASbAWlA[zAQ|@g@bCa@pBWlAGVGXOv@c@xBo@vCUjAm@xCS~@e@~B]~A[zAMl@UjAo@zCSbAq@`D_@lB[|A]~AOr@S`Am@zCWnAWlA]bBeAfF[zAKb@ETI^c@vBUhAg@~BWlAG^UbAMn@UfAWpAYrAKj@Mh@Ov@WhAUjAI^[zA]dBWnAQv@Mr@Mf@Q`AI^Ib@UfAWlAUjAIZCJG\IZQ|@Q|@a@lBQx@GXOt@I\G\GVOt@Ml@G^Or@Ot@CNWrAId@Id@Kn@EZERG`@Gf@Gb@CVEb@Il@Gr@It@Gt@Gv@ATCZEl@A`@CZCr@Cn@Cz@Cr@C`ACf@An@Af@Cp@GhCC|@A`@Cz@E|BCdAEnAE~BEjA?RCr@Aj@Cr@GzBAj@Aj@AH?`@Cj@G`CI|CA~@A^K~DEtAAj@EpACpAEfBAf@Cl@CjAGnCGbCAL?FC`AAj@EvAKhEAZAXAr@A\AXAVAZ?XA^ATAZAX?XAXAZAX?JCj@ClAGdCARIzDGdBAd@EfBAb@Al@AZAXAZAX?VA^AXAZAR?VCh@?PAZA\AVAb@Ad@Ax@Cv@Cr@?FGzB?LA\ANCtAAf@Cj@Aj@C~@A^A\?D?VATCt@?XCp@?JA^Cd@EnBCt@?HCn@An@Aj@A^?@A\A\Al@AVA`@AL?JCpAIhDErAM`FAj@C~@Cr@G`DKdEAXCn@G`DAVAXCr@?LAf@AXAZAX?XCr@A\AX?ZAVAZCp@?\AZATC`ACx@C~@Ar@Cx@CdAAb@E~AAf@An@ADAv@ApAA^?T?p@?lA@j@?b@@Z@r@@n@Bt@Bn@Bj@Bj@B^@VHlADp@BZB\JfAHz@@FBZF`@Jx@Hp@DXJt@H`@BPDXHd@H`@Lr@Hd@@@Hd@Lr@Hb@Hd@@@Jn@Nr@DXRfANv@Jh@Hb@Ll@Lv@TfADT?BFZFVDXHd@Jf@b@|BJn@TnAVpAVvA`@tBXzALp@Lp@Jl@DXLv@Jt@D^BRB\BZ@VB^@T@V?F?R@T?`@?RAV?T?JANAb@AZARC^CZC\CTEZGd@I`@GZETK`@GXGTGTKZELELENKTIVKTUf@Sd@mAvBWd@iAtBkArBS^Q\e@|@MTMVEFU`@KPUd@S\KPMVKPMTMVOVIPEFU`@KROZILOXKRMVQ^ABKVKRO^KVM\KZ]bAENGROh@CLIZGTEVKb@ERETCNGZCNGb@EZAHCTCPEZC\CVCZCTC`@AXCj@Cd@Ad@Ah@?R?J?X?lA@n@@\BlADv@?LF|AJ`DB`@DjAF~ADnAJjC@b@Bp@@R@\@Z@XBZ?F@L@X@V@X@b@?@@Z@T@X@Z@L?HBZ@`@?F@V@N@V?N@D@d@Bl@Bt@HbCB\Bl@@^Bv@@^Dv@?FBd@Bt@@^Bj@@^FbBDz@Bl@?J@LBh@Bn@Bt@@^Bj@@`@Bp@Dt@DjA?TDbADx@@ZBl@?TFhA@b@@\D~@DjA@d@Dz@@^HlB@\Bx@?@B`@B~@HfBBt@Bp@@XBj@?JDz@HvB@f@@^HdB@b@Bt@Dz@BbA@VHbBDtADpAD~@HxBHbCHhB?HDbBBz@@h@@t@?H?jA?~@AjA?r@AT?F?VAJ?VCbAC\Ct@I~AEv@CXM|AGr@[dEKfAIjAGp@OnBEd@]hEEv@Eb@E|@Ex@GxBAL?ZEfB?lBA\?X@lA?fA?dA?\?vB?zB?lB?j@?f@?d@?bB?hC?fF?|@?nB?zB?nA?pB?`E@h@?d@@z@@j@B~@FnADx@J~AT|BHr@NdAF^PdARbAFVDXXnAXhAPv@BHJf@FVFVFXFVFXNp@Pr@Jh@DLLn@Np@DTJh@DRF`@DZFb@Fb@LpAFr@Dj@@N?DD|@H|BBj@Bf@D|@Fx@H`ADb@Fn@Jx@Jn@Jp@Jn@P~@XrALr@J`@ThATdAJd@DRBLFZDPFXNv@FV?BH\Jf@@BLp@Jd@FVVrAThAFXNt@H^Hd@@FF\Fl@Hj@D`@Ft@@JJ`BFrBB`A@x@?f@@n@Ah@?l@?L?j@?jA?pC?zE?`B@vB@~@@x@?H@R?XBj@@l@Bf@FnADz@F|@H`A@R?BFr@H|@F`@NvANnANdAZnBRdA\fBH`@VpAXtAP|@P|@H\Hb@FVF\VlAXxAHb@Pz@R`ABLLj@^jBVrAXtAHb@F^XrAXtAXvAVtADPHb@Np@Nt@b@zBJf@VrA@DDPVrAFT?@BPFT?DH\FXDVDPFVFZDVFXFXDRDVH^DPFXFZDTDRNt@Jf@P~@@DTfAFXNt@Jf@Nt@BJJl@Lh@Jf@Lr@TfALl@?@Jh@Lj@FZDVDTFTHb@BJFVBNDTFXFZFZH`@BHH`@Jh@Np@@DJj@FZLn@Pv@Jj@Pz@BLFVF\Pv@RbALt@Np@RdANp@?BTjA@@Lr@Nn@Lt@TjAVhAZ~AF\FTJh@Jf@Jh@FX?@Jf@H`@TjAH`@Lh@Nv@Ln@Pz@Hb@FZFZJf@Jd@Hb@Nt@Lp@FVFV@HJf@H`@Jf@ThAP|@DLFZDRDR@HH^DNFXPv@Lj@Nn@J^Tx@Tv@Rl@@DPh@N`@Pd@Tl@L\Pd@Xp@?@Rj@Tj@Xr@Rf@DNN^JXZx@@BVl@Tl@^bALV^bAVn@Tl@JTHVTj@Rl@Rn@Tl@Pn@Rn@HVNl@Pp@Pp@BJJd@Np@ZtAJh@Lp@Lt@Hh@Lx@Jr@Hr@Hn@BXFp@DZ?@Fn@Db@D\@PFl@Dt@?@J`BFxABt@BxA@N@t@@r@DjC@pA@l@@p@@b@BvBDhCFhEBvB@X?Z@h@?@B|ABhABbC@J@|@@vABp@@z@@n@?b@@P@t@@h@@n@Bt@?NBZ?B@LBd@D`@Fn@Fj@BRFd@DVD\BJFZH`@Ln@Ln@Pt@Jb@Nd@FRDLBJNb@FJHTJZJRJZJVRd@NZHRJRLTJPBDJP\h@HL^j@NR\b@^b@?@NNNPZ\NPDD^\b@b@PNPNLJRR`@^HHVTRNPNNNVTzCnCx@t@NLtBlBHHFDNNPNRRJHfAbAl@h@j@h@B@r@n@tDfD^\RPNNNNr@n@XTnBhBPNPPPNNNNP\^d@h@PRLPNRLRNPLR\h@JPLTLRLTLTBDFLJTJRLVJTJTJVHTJVHVHTHVJVHVFVFTHXHVFVFXFVFXFVDXFVDXDZDTDZDXDXBXBVDXBZBXDZB\t@pHDZBXBZDXBXBXBXDXBXB\BTDXBZ@H@LHr@BTD^PfBBZDXBVBXBXDZBXFj@Hz@D\BXBTDZ?DBRBXBVBN@LDh@Fh@?@Fj@Fh@Fj@JbAD`@BVBX?@BVDXBX@H@NBZDV@P@FBZBXBVBX@X@@@XBXBXBZBZ@XBX@VBVB^@XBX@X@XBZ@Z@XBX@X@Z@X@X@Z@X@X@D?TFhBDfBBz@@HBpADpAH~C@b@@ZHxBDnB@\DfAJvBDj@@XJ`BLzAH`AFf@Fp@@JJ~@Fh@Hj@BR@LBNHn@D\XfBXfBx@hF`@lCNx@DXDVRnAXdBXhBJr@n@xDTvAPjAt@rEPbABTb@fCXhBDZF\n@~DBNNfAHf@F^PbAHl@H`@Hl@b@hCJn@?Bt@pERrADVHb@DXHf@Hf@XfBRjATzATtAVdBLp@Hh@RrAX`BTvA^~B^~BjBpLDTF^FZn@`EJl@TvAL|@Hf@Jp@@DBHL|@F^Jl@BPRjALx@XjBJl@F\L|@Jj@Hh@Lr@Fd@H`@F^BRFZBTLt@Hf@@LJj@N|@Jn@j@nDHd@b@rCXbBHf@Hd@Hh@H^DZFXDVLl@Jj@ThAZvAThAVjAXhAFRDRFTH^HZFTRr@Pr@^tATz@^nAFPRn@Pj@@DHV^hARl@JV?@Tl@HVJVHTJXPb@f@lATj@Tj@DLBBFNHT^x@?@Rb@Rd@Vj@R`@d@bAJRN\LVd@bAj@lAHNJRJTVh@JRJTR`@N^JRLTHRLTJRHTb@z@Xn@Vh@Rb@DHb@|@@BLXFJJTt@|AjB|DHRVh@LVJR|@lBdFtKVf@p@xAbAvBDFXl@x@fBR`@P\d@`A@DDFN\`@x@LX`@z@dExI?@JRLXb@z@Xn@n@tAXj@JR~@nBFN`BhDJTv@bB\r@FLRb@Xl@^v@JRj@jA`AtBZl@Zp@jCtFb@~@Td@hA`CvAzCb@z@LZd@~@FJP\T`@Xh@FLNVR\JRXf@Vd@PZJNLTf@x@LRHL\j@PXXb@\h@f@r@RXFJt@bAf@r@l@z@HHNRZb@b@f@JNLPlAvANRPPJLTVX\Z\TVNPPPPPRT\\nArAl@n@HHd@h@PPXXh@j@^`@|@`AbA`ANNNPNPNNNNPR^^RRbAdA`AdALLz@~@FFFF`@`@XZLNf@f@PR`@`@VVvAzAp@r@@BXXdAfAn@r@|B`C^^t@v@\\hAfAFFHHZXt@p@NN^\PNb@^p@h@d@`@FFHF`@\b@\PLNL^Vz@n@FFj@^TPNJZTXRt@j@RLPLPLPLPLPLPLHFVPRNFDn@b@^X\VHDf@`@LFRNFDXRRNNJ`@ZTNPLNJFF\TxAdApA|@r@h@JHPLPJRNPLRNPLRLPNPLPJHFZTNLRLt@h@RNhAx@\VXPPNRLPNPLd@\RLTPp@d@HFHFTNLJPLPLDB^VTPLHPLn@f@HDDDHFPLTNLJ@?NLPLRNHFFDRLPLPL?@PJPNPLPNPLPNTPLJNLFH@?HFNNBBJHFHHFHHDFFFHFPPNNFFFFHHDFHHVV@@HJNPLNNPPRLPPRLPBBJLNPNTLPNRLPPTJP?@NRNTJNLT@@JPLRNVLPJRLRLT@@LRLRLTJPLTLRNTLTLRHNBD@@LRJPHNLRNTJTNRNVLTLRLR@B@BFHBDLRLTLRT^LTLRJPLRJPNXLPNVFLNTNVLRHL@DHL^l@Vd@NVNRLTPXBFNTLRLTLRJRLRNVLP?@JRNRLTJPLTLRLRNVJPLRLTLPJRNTDFFLJPFHLT@Bd@v@Zh@NTDHNTJPZh@LRXd@JPPXDJ@@DFJPJPJPLRPZLPDHFLZf@JNJRRZHNLRJRNRLT@@JPJRNTJRLRJNrBjDx@rAjCnEbCbEV`@T`@@BT\FLLRLRr@lA^l@x@tAJRJPLPXf@R\^n@DFPXXd@Zh@h@|@j@`ALPLVLRZf@LTHLBDLTLPh@~@h@|@NTJPNXJNLTLRLRNVLRJPLTLRLT@?LRJRLTh@z@NTJRLTNTHNLRNVNTLTJPNVLPLTLRNXVb@NRLTLRLTj@z@LRNR\d@NRLRNRNPNRr@x@JLNPPRNPNPb@d@LLPPNNPPPPPNRRLJNLPPRNPNPNPNPNPNPLPPRNNLPLd@`@xAlAb@\b@^b@^b@\b@^b@\NLPNfA|@PNPNPLPNb@^RNb@^xAlAt@l@`@\t@l@d@^PNhA|@b@\t@n@RNbAz@t@n@xAlAz@t@ZXxAjAb@\v@l@RNPLRLd@\RNPJ~AfAJFv@f@JF`Aj@PJRLRJPLRJf@Vd@X|@d@x@`@z@b@RJRJPHRJf@Vf@VRHRLRHRJ^Rl@Xf@VpDfBRJf@Vx@`@@@d@Tz@`@RJPJf@VXLt@^VLVLRJPHRLRHNHRJTJPJRJTJNFVLPHRJTLNHRJHDJDRJNHRJRJTJPH@@PHRJPJRHh@Xt@^^PLFNH@@PHNFFD^PTJRJTLPHRJRJRJd@TJDFDRJRJd@TRJRJRJRHPJRJd@Td@TTJPHTLRJRHRLPHRJPHPHh@XTJPJRHNHVLPHRJRJHDJDHDXNRJRJTJNHTLRHRJPJRJPHPHVLPJPHTJRJPJPHTJTJPJPHNHTJLHRHHDPJ\NZPRHLF~@d@RJRJRJNFTJRJRJPJRJVLPH`Af@\NRJPHTLPHTJPJRJPHXLPJNHTJRJPJRJTLNHVNLHTJPLPJPLTLPJNLRLTNNJPNRNNLPLBBNJNLPLPPPLPNPPLJNNTRNLJJTVNLNNLNRRNPNNNRPPNRLNPPNP\d@NRLPNPNRLRLPNRLRNTLRNRLRLRLTLRLRJTLRLTLTJRb@z@NXJTJTJTJTJTJVJTJTHRJVJVHTJTJVHVJTHTHTJVHVJVHRJVHTHTJVJVHTJVHTJVJTHTLZRh@lDpJXt@Xp@x@xBL\N\h@xA\z@`@hAJVFPJTHVJTJVRl@JTJVHVJVHTJVHTJVJT^dAJVHTJVJVJXHRJVHTJVHTJXHRJVFRLXJVHVJTHVJVLZFPJTHVJTv@vBRf@JXHRBFFPJV`@hAHP^dAJVHVj@zAJXt@pBt@nBd@nAJZJVHVJTHVJTHVJVHTJVJTHXHRJVJVHTJVJZHPRh@HXJRHVJV`@jARf@`@dAb@lATh@Rj@JTLZ@BFPLTJTJRNZFLLRNXHNNRPXLRJNPVNPFJPTLNPRNPPRPPLLb@b@HFLJTRRPLJ\VPLRLBBLHd@XRLTLRJ\PXNTJTHPHh@PRHVHPFPFVHRFVHnA`@RF~@XVJTFRFRHTHRFRHRHTHRHRJRHRJRHRJRJPJD@FDDBB@DBHDRLDBDBDB@@HDFDPLRJPLPL`@XTPRLNLRLRLPLPNPLRLPLPLPLRLPLPNRLPLLJHFHFFFDBBBPNRNNNLJBBPNNNRPNNPNNNHHDFPPPNHJ@@NRLNPPRTLNPRNPLP^d@BBJLLRNPLPNRNRLRNTLRXb@NTLRFHFLZd@NTLRNTLPLRLRLRLPJNPVNRj@r@Zb@DBdApAHH^b@PP^b@PPNLNPLLTRJJPNPNNNRPNLNLNLLJ@@TNRPRNPLRNLJRLPLRLPLPLRLPJRLRLPJRJRLPJRLPJRLRJPLd@Vb@VVNPJPJVPNHRLRJPLRJPJPLTJPLPJTLNJRJRLPJRLLHD@PLRJRLPJRJRLPJRLHD`CvAzA|@PJPJRLPJRJRLPLRJPJf@XTNVLJFPLRJPLRJRLPJRLPLRLPJPJRLRLt@f@RLPLXP^VNLRLPLPLRLPNPLPLRLPLPNPLPLRNPLPLPNPLPNPLPNPLPNPNJHDBPNPNPLPNPNPNPNPLPNNNPNPNPNNNPNPNPPxBpBb@`@LLPPRPp@p@^`@NNPPNPPPNLNPPPLNPPNNPPNPNPPPBBHJb@b@RR\^NPPPn@r@hBlBBBpBxBHFTVVXbAdA`@b@^`@`@`@hAlAr@v@VXfDnDhDrDnArAn@p@LL`@b@b@d@VXVXpBvB^`@PNNPNPPPLLb@d@^b@`AbAPPNPPP?@ZZRT^`@^b@PPNNNPNRZZPRPTn@t@p@t@lAxAb@h@PRNRNPNPNP^d@\b@NPNRNPNPLRNPNPNRNPLRNPNR\d@\d@B@V^PTFHj@t@b@l@hA|ADHX^f@r@@@|@pANRRZFHPTZd@NRZd@\h@PVJNLRLR\f@\f@LRLRLRNRLRNTJNNVLRLRLRLRLRLTNRf@x@@BJNNVLRLRLVLPLTLRJRLTLRDFFLJLNXLTLRLRLTJTLRLRLTLTLTDHDHLRLTLTJRLTJRLTLTJRLTLTJRLTJTLRJTTb@`@v@HNLTJTLTJTJRLTJTLTJTLTVh@JTLTJTJTLVLVXl@JTXj@JTJTJTLTJTJTJTJVJTJTJTJTJTLTJTJVJTJTTl@BDRd@JVJTVj@JVJVHRJTJVJTVl@HVJTTl@JTJVHVJTJTHVJTFRVp@JVJTFRLXHVj@zAHTJVHVJT^fAHTJVJXHTTn@Nd@HVJVJZHVHTHVf@|A`AvC`AxCf@xAHVTt@HVJVRl@FVJVZ~@J\HVHTHXJTHVFPJZXz@v@`Ct@zB`AxCXx@DNHTRl@Rn@^fA`@jA\dA\dARn@^fAHT^fAHTt@zBn@jB`AvCx@dCRl@hAhDFNjAlDpA`ETn@\bAHVFR^hATn@f@zAFPbA|CPd@h@~AfAdDFR|@nCTn@tAdEt@|Bh@|AHVHVHVNb@lApD\dA\fAHVJV\dAr@tBHVHVf@|ATn@|@rCJVDNHVXz@N`@HTHVf@zAr@xBJXHTHXHTh@|Ar@vBJXv@dCN^HVHVJZFRHVJVRl@Rp@JTHVRn@HVJVHVHVRn@FLBJTr@Rl@h@`BRh@\dAHV|AtEHVDLBJJT\fAHVRl@HVTn@Rl@HVPf@L^HVHTHVHVHVJVJ\HTTn@HVDLBHHT@DFPHVHVr@tBRn@HV^jAFL@DTr@z@lCbA~CPj@j@dBHVJZPj@L`@t@|BJ\FP\dAHXHVHVHTTx@j@bBFNDNRl@Lb@Nd@pA|DL`@DJHXHTZdAJXNf@L^HVHTHVHXHTJZ?BPd@Nf@t@~B@DL\ZbADLHVRn@FTFNj@hBHV\fARn@f@zAnA|DBH\bAPj@\dARn@FRBFHX\fAHVRl@DLDJFVHVHTFPxB`HJZHTZbAPj@L`@FNHV\dA\fALd@DHHZFRFRDHX`Af@~A\bAr@~BX|@Nd@Nf@@@ZbARn@HTFP@FJXFRFT@BBDDNDNL^Nf@Nd@JVFVFP@DHVHVHVHVHVRl@FXX`APp@BJ?BJb@FVFVFZ?BJb@Hd@DTJn@DZDX@HFh@DXBVFf@@LBXBZBVBZ?J@PB`@B\?JBX?RBh@@j@?Z@t@@h@?f@A~@?f@?@AZAr@Ct@CXCr@GnAEx@Cp@ATCb@AVEt@SlEEv@Ct@Er@GfAMjCAZAXEr@AXCZ?LEr@Ex@GfAEt@Ct@Et@Ev@Cp@Et@Et@AJCf@Ev@Cr@En@Ev@K`CEv@Ex@GfAGpAGpAAJE~@EbAEbAIrAGhAGnAGnAGpAEv@Ev@Ez@Ex@A\G~@EfAGlAARAPG`AEz@Ev@E|@AREr@Cl@IjBG|@E|@?JGjAGpACv@GnACv@EjA?@Ch@Ad@ElAGdBCx@CnAElA?R?FAVCx@C|@ChAAv@?L?@C~@At@AfAE~BAlAAv@Ab@EvHClD@xCAZ?dK?V?b@?v@?X?X?Z?X?X?\?p@?x@?r@?X?Z?X?Z?\Ar@?nA?jB?p@?T?bA?~@?|A?t@?rA?fB?pA?vA?f@?~@?x@?jA?lA?rA?h@?rA?D?pAAhB?nA?`@?fA?hB?nB?bB?vA?dB?l@?t@?V?zA?vD?pA?fA@|@BvABr@@V?D?H@ZFzADrALrBFbABb@BTFx@JnAJ`AJ`AJdAJ|@PlANbA@FJr@RjAHd@BLLr@Lp@ThAFXH`@d@vBXpANl@b@pBDh@l@fCLd@d@lB^fBBHH^l@jCTdAFXJd@Pr@b@pBXrAFZVfAJh@@F\xAFVTbANr@Jd@h@dCVhAf@~BLh@H\ZvAR~@f@xBBNXnAZrAVjA|AfHHZH\\|ADRFVPz@DTHXFVTfA@BNn@HXFVJ^JZBJ\fAFRTr@^dA`@bAN\Rd@^v@BHHNZp@LTf@~@LRh@|@d@t@BD\f@l@z@l@v@FHVZn@t@p@p@r@r@NPb@`@b@b@^\bAbAXVXXNNr@p@ZXVVr@p@JJTTr@p@b@`@`@`@RP^^`@^JHVT`@`@b@\r@p@f@`@p@j@RNp@l@b@\PLRPj@f@j@f@PPFDv@t@FDb@b@ZZPR^\r@x@b@d@\^p@r@`@d@t@z@Z\r@t@~@`A`@`@`@^j@h@lAjAx@x@nDhD\\d@b@b@b@x@v@TTNNJHRRFFPNd@d@r@p@RRb@`@FFFHp@l@RP`@b@ZXHJPLJJb@b@~@|@BBd@b@LL`@`@PNHHRTFDZZdB`B\\l@j@z@x@XXdAbAb@`@JJDDNNPPb@`@^\TT`@`@XXd@b@^\\\d@d@^\@@VV^^h@h@\ZTTNPLLXVHJr@t@b@b@Z\TT`@b@`@b@RT`@b@p@v@PPHJ\^l@p@j@p@VZ^`@NR`@f@X\bAlAd@j@p@z@f@p@f@n@dAtAr@~@|@lA^h@z@jAHLNR|@lAj@x@Z`@`@j@x@hAr@`Af@r@DFJLTZX^t@dAp@~@p@|@p@~@lA`Br@`An@|@|@nAn@z@r@`ARXV\n@|@t@`AX`@h@t@d@n@PVRXl@v@JNRXTZTZTZJNZb@p@|@V^x@hAj@v@TXLR^d@hA~AbAvAjA|AhA~A^f@b@n@`@h@PTNRnAfBv@bA^h@X`@p@~@v@dAZ`@JPPTj@v@l@x@NRZb@@BHJ`@h@JLLRBBJPTX^f@NTLNT\JNX\@@BDX`@PVLNLPTZV^PTBDLPPTJLBDDFFHRVNTLNFHHLLPBBV\@@JNPVPTNRRXPTRXV`@`@h@NTV\PVLNJNLNNTX^RXRVLPTZHLRVLRTXTZRVNVJLJLNTPTHLFFNTNRPVPTPTTZFJDDRZDBHLPTV^LN@BRVPVNRBDRVFJPTV^BBLNFJJLFHRXJNLPX^NRPTPVXb@RVRV@@DFFJFHLNNTJLFHLRDD@@FHLRNPNTLNLPJPRVRV@BLPPTZ`@l@z@x@fAJNp@~@RXRZt@dAj@z@`@l@HL\h@X`@@BjBtCxA~BXd@v@nAR^^l@\j@`@r@`@r@Xf@h@`AXd@DHZj@Xf@h@bAVd@JPNXf@`Af@`Ah@bALXFJZl@l@nAR`@DJNXXl@Xl@Vh@LVNZFLXp@Vh@j@nAVj@rA|CnAxCx@nBJVvBtFf@rAj@vAHTHVJZJVh@xAt@vB^dAh@~Ad@vAVx@f@|ARl@Tx@n@pBPl@XdAJ\X`ALb@XbAV~@Vz@ZjA?BFN|@nDVdAb@`B?BXlANj@Pv@Np@J^BNHX^hBTdAVjA^dBNr@P~@BLf@hCP~@TjATnALr@RlA`@~BDTZjBHh@j@tDn@jEr@hFd@rD`@dDtAzKXzBr@rFzAzL^vC`@~Cf@~Dr@pFR`BJx@Lz@fBrN|@fHt@bGl@zET~ATjBRxANjA@LHn@NdA@NPtAX|BF^ZjCZ~Bj@lEb@pDT`Bp@pFDVBP^xCj@rEBPR|ANlAHn@n@`FTlB\fC^zChBvNf@`EVlB\rCl@xEbAbItAvK`@~CBVRxANjAHr@PtAVrBx@nGL`ATbB?Bp@jFFh@lBbOhA~IFh@NdA@NDXHj@Jx@BXVfBHt@Jr@Ht@TdBJt@Fb@BR^|CVhBXzBTlBTbBHp@D\ThBTdBb@lDF`@DXD^b@hDBXPpAL`A\lC|@`H@LHp@BR?B@BFd@~AdMNnAPnAHt@PlANlADXl@rEHd@NtALt@f@fDBLhAtHZnBLx@RhAN|@XdBl@rDJl@\jB`@bCVrAJh@TjAhAbGBNNn@f@fCR~@b@xB`@nBLf@P|@Nn@b@jBNp@DXNl@Lf@`@`Bf@rBf@nBRx@v@rCBJ\lAb@~ADLl@tBj@jBNd@r@zBJZ?BBFJZPf@Pl@~@rC@BPd@~ApEJXh@xAfAvCt@pBbAdCRh@pA~CdB`EbClF`AvB|A`DdAtBfBhDHPjAxBLRf@|@h@`ALTLRHPT`@T^Zj@Xh@\h@LTLTXh@Zh@Zh@Zh@Zj@Zj@PXTd@Zh@Zj@Zf@f@~@j@`A`@r@`@r@Zj@h@~@f@|@v@vAd@v@^n@j@bAb@x@bAfB\n@Xd@h@`Al@dAHN|B~DpA|B~ArCdAlBhAnBfCnEnC|EbF`JlEzH|@~AZf@rBrDnAzB^p@x@tArFzJrA~Bj@bAVb@`@t@r@lAlAtB~@`Bv@vALRLTd@x@BFLRXf@Vd@JRp@hAp@lA@@`AdBJP^p@f@z@bAhBZh@h@`AHNv@tAXd@r@pApA|Br@lAt@rA`@t@b@t@PZh@~@v@rAbD|FbAfBh@`At@pAt@tAf@z@\n@d@t@\n@bAhBl@dA^n@b@v@j@`AZh@^r@\l@Xf@\j@Xh@T`@\l@^n@R^R\b@t@lAvBd@x@n@jA|B~DjBdDdAjBl@fAr@pAh@~@Zh@v@vALTJRNTJRZh@\j@d@x@\j@`@t@lCzEXf@DHR^x@zAb@x@d@x@NVJRT`@PZLTLRLTJPNVLTLRLTLRLTLTLRLTLRLTLTLRHNR\JNLTXh@h@|@LTLRZj@Xh@LRLTZh@Zh@FLp@hAjAvBn@fAd@z@t@pAj@`Af@|@h@`ArA`CnAxBj@bAv@rAb@x@h@|@d@z@^n@r@pAr@nA`@p@d@x@b@v@n@jAf@z@\l@Xh@Xf@j@~@f@~@`AdBf@z@Zh@f@|@Zh@Xh@Zh@LTJRLTPXLVJRLTLRTd@LTLTJRLTLTJRNZLTLTJRLTJTLTJTLTJRJTLVJRLTLVR`@Xl@Vj@Zn@`@z@\v@z@jBXn@Vd@lAhCd@bAn@vAb@dATj@^~@JXJXj@tAf@rAZv@Pd@Zv@`@bAZ|@`@dAXv@^dA^bAt@tBz@bCZ|@^lAfBjFr@~BJ\bAbDd@`BVz@BJ\hAZhAPn@ZfAt@rCNh@Rt@Lf@J`@HVDRHXFXHZFTRr@Lj@H\J^Lh@HZFTFTFZHVFXFVFXHVPp@Np@Nn@Pp@Np@HVFXFVFXPn@FXHXFTFXFVHZNj@Jd@Lb@H^Lf@H\Nn@J^Lf@Rv@Nn@Np@Pn@FXZnALj@Lf@VbANn@f@rBj@xBh@zBv@~CT`AXhAJb@Pv@J^@Bd@pBXhAH^Nl@Ld@@HnB`IzC`M~ClMjCxKpExQ`A`EbCtJxAnGvA|FtArFjCxKL`@Lf@@FLf@FTJ^^zAf@rB`@`BtA`GJ^^zAv@`Df@tBd@hBl@fCnAdFFTd@jB`@`Br@tC~@|Dn@fC`@fBTx@`A~DZnAzD~On@lC^`B`@fBPx@l@vCr@pDh@lCP~@PdAZ`Bp@|DXfBj@nDXpBf@pD\bCLbAPzADX@PFZf@jEZvCPhBBVLvAVpCPpBH`Al@zHj@rHHz@HdApAtPJpAd@dGP~BJtALvAP`CTtCl@zH^bFBX^vELbB`@pFHbAJpAH~@Fp@?FJfAPxBL|AP`CDj@@D?J@Dl@zH?@LfBJ~AZfEh@lGLzAHdAH~@JlA^zEv@jKDd@^vE`@nFZ~D|@dLnA`PXrDHjAPvBd@dGXvDPtBPxBLdBH~@R|BJtAPfBLvATvBXrC^dDHn@b@pDFb@Ht@VhBHn@p@vEHh@\~BF^Jl@P`AXhBNv@\nBTrAVpAJh@XvAX|AZzANx@^fBt@vDThA^pBXtAVlAXvANv@Jh@VrAp@bDP|@v@xDJj@Jd@Jh@VpALp@`@rBd@zBJh@Jf@TnAThAt@pDJh@Jf@Jh@Ln@TlAd@|BtAbHn@~Cn@bD`@pBLr@XrAb@zBJf@TjAXrAVpAb@zBd@zBJj@Jd@?BJh@tA|G?@xBxK|@pEzAvHDT@FBF\hBdBvILj@ZzAJj@Ll@Nv@lAfGJh@b@xBXrAdAnFtCxNtA~Gz@lEx@dEjCxMf@fCvAdHzAtH`BjIb@xBn@dDh@jCh@jCf@dCTlANp@Hd@v@zDhAvFVtAv@vDXvAnDpQl@|Cr@jDP`AbA~EVnAb@|B`CrLrEnU\bBv@|DbBlITlANr@TjAdC`MpBfK^hBVlAThAn@dD@FFVNt@FVDZFXFVFXFXDVFVDTFZFVFXDTFZLp@FXb@xBFVDVNr@FVDXFVFXFZDTFXFXDTNp@FZFVFX@HLh@FVFVFXFVDVHZFVFXFXFTFXDTHZFXFVFVFVFVHXFVFXFTHZFVFVHVFVFXFTHXFVHXFTHXDRJ\XhAHVHVFVHXHT\fAHXHTHVHVFVHV`@zAHXHTHVHZHVFR@@FTJXHTHVHVHVHVHVHTJVHVHVHTHTHVJVHVHTJXHTJX@FN`@LXFTJVFP~@dCj@zAZx@FLN^FPTl@JTJVHRLXVl@FPNZHRLXHRFNBD\x@L\JRVn@LVHRLTJTJVXj@Vl@LRJVJTJRJTLTFP@@LXJRJTJPDJFLJTP\NZNXLXHRP\Tf@vAvCr@xAbBlDv@bBb@|@`@z@^x@R`@LT\v@p@tAZl@p@rAnAhCjDfHP^Rb@HR?@HNRb@Rb@Rb@JXv@`BjAdCjCpFjAdCzA~CzCnGzBzEf@dAdD`HbCbF?@bBlDR`@nBbEf@dAzA~C|CpGxCnGDHRb@Zn@Xl@Vh@Xl@dAtBt@~Ap@vAHR@@p@vA~@jBvAxCZr@lB~DbAtBNXf@fAt@|AVh@Xj@d@`Ab@~@xA|C|@lBjA`C^v@P^LVn@tAjA`CRd@`@v@Xn@|@jBLXv@`Bf@dAhClFvAzCf@bAl@pALVRb@bArBt@|An@rAn@rALVVh@\t@vBnEhAbCd@~@\t@DJpAlC|@jBr@zAFJVh@|@hBXl@d@bAv@`BDHP\l@nAJTXl@JRd@~@Xn@BF^t@Zn@Vj@JTVf@Zn@HPXl@NZJTR`@LVp@tAn@tAh@fATf@Td@P\HPZn@N\^v@HNNZJTR`@h@fAJTLXjAbCRb@pBbE\t@Tb@FNRb@JRHPhA|BRb@|@jBf@fAj@lAP\Zl@`@z@Zn@b@~@l@nAVh@~@nBb@|@Rb@Rb@j@hAf@dARb@Tb@d@`Ap@vAd@~@Vh@Zl@JRR^Rb@T`@NZJPP^Tb@b@x@h@dAVf@Tb@h@dATb@Tb@vAnCXl@Vd@DHjA|Bt@vAVf@zAvCLVVd@R`@v@xAt@zAJPZl@|@dB~@hBTb@BDd@~@|AvCv@~AJPHPTd@R`@f@bALVTd@DJFJZn@@DVh@\v@LTb@~@Xn@\t@FLP`@Rb@^x@FNbA|BBHj@rAPd@DHN\JTb@fA|@zBr@fB`@dAf@nAL^b@fAHVTl@JXRf@HXJTRn@\~@Vt@Rh@JXJX\bARn@`@hAZbARl@Rn@HVRl@JZDNNd@Pf@ZdAZdAHVJ\HVNh@JZPl@^pALd@Rp@Nh@Rt@ZhALf@Rv@HVHZFVHZFPFVJ`@DRHVFXHVFTFVPr@Nl@Np@HZBHBLHZFTVhAPp@Ln@HXDVHXFVDT@DDTFTFXFXFVFVFXDVBF@FJf@DPFXFVDXFVLn@FXFXF\FTDVFZFVLr@FVJp@FZLn@F\DRDTLp@F^FXFZJl@DZFVLr@Hh@`@bCF\XhBJl@VfBVfB@DNbAJt@Jv@@HFd@BJ^rCPxABNHj@BV@H@D@JXzBD^Hp@LlAFh@@JBP@JF^BZFb@Fl@D^Fn@Fn@DZ@PBZF^BXBXHn@B\DZFp@DXB^DVFr@BVD^BVJ`A@JHx@BPD\BV?HBLHt@Fn@@JFh@BZBTBT@HJ|@Dd@D`@BNDb@Db@NrAVjCDXHv@PfBD\Fp@Fj@Ht@Fr@LjAFr@LjA@@Fp@d@vEJ|@Fn@BV^rDFj@Hr@NpADf@XhCPdB@H?@@HDd@J`AJ|@b@hETzBXrC`@vDNzAj@rF@LBRFj@T~BDX@N\jDVdCLjA^nDFj@N|Af@`FDTFp@Db@Fj@`@zD?@BRHn@B^DXPbBFr@DZHr@Fr@LlALlAV`CHv@Fn@Ff@\hDRhBBVHr@D`@T`CP~AHt@PlBFj@NpAH~@NzAHv@Hz@JbA?@JnAR`CBRB\BZFr@LzALxAT`DHhAHlAB\@XHjAJzADj@JdBJfBDv@Dv@Bd@@JBj@Bj@JdBJ`CJtBBf@HdBFdBFjAB^Dz@DjA@P@N@ZDr@?B?FB\@\HbBFtADn@@ZDp@@`@@V@TB^@XBT@Z@XB\Bn@B^@RDpAB\@V@V@ZB^Br@LbC@TDx@N~CTfFDv@@XDr@Bt@FlA?DFhA@XBZ@\@V@VBZ@V@ZBX@\@VB\@T@\@VBX@X@X@D@T@X@^@VBV@^@T@XB^@V@TB^@T@\@@@TDv@@VDz@@RBv@Dt@FhBHfBDnA@XDjABt@Dt@@\@V@r@Bn@?^BlA@p@@X@z@?B@X?N@L@p@@r@?p@@B@~A@hB?X@X?Z?D?l@@V?b@?Z?r@?Z@lA?T?\?X?@?V?ZAZ?X?X?X?X?Z?XAZ?V?Z?XAZ?X?XAX?Z?XAV?\AZ?XAX?XAZ?ZAN?F?XAZAZ?VAZAZ?XAZAX?ZAVAZ?XAX?XA\AX?VAZAX?ZAXAZ?VAZAZ?VAZAX?ZAXAX?ZAXAZ?XAXAX?XAZAZ?VAZ?VA\AZ?XAXAZ?VAZAX?ZAXAX?ZAXA\?TA^?P?DAXAZ?XAZAZ?XAV?T?F?RA\?X?@AX?V?Z?XAZ?T?B?X?@?V?X?R?F?XAZ?X?V?\?X?X?X?Z?X?X?Z?V@Z?Z?X@X@r@?Z?V@Z?X@Z?X@X?Z@X@X?X@X@Z?X@X@Z@X?X@X@X@Z@X@X@X@Z@X@V@Z@V@Z@X@X@XBZ@X@X@X?BBV@V@X?@BXBr@@F@P@XBX?B@TBZ@XBX@V@BFdAJrAL|ABZLdBHt@VxCTxBBTDh@Db@j@nFB`@\`DFn@Db@NtANtAb@tEPzAJlANnAJlABVJz@JbAD^Fl@ZbD^nDDh@^pDHt@Hz@Hx@LjAHr@JlABLHv@JdAHt@H|@@NRfBDf@Ht@D\T`CNzAVdCT~Bl@xFBVXxCRjBFn@DZBXBVDZBZBTDZBXDZBVBZBTBRD^BXD\BTB\BTDZBXBVBZDXBXBXDZBVBXDXBZBTBZDXBZBVDXBXBXDXBZBXDXBVBZBXDXBVBXDZBVBZBVDZBVDZBXBXBVDZBXBXDXBXBXDXBZBVBV@JBPBZBTDZBXBXDVBZBVBZDVBXBXDZBVBXBXDXBXBZDXBVBZBVDXBXBZDXBVBXD\BVBVBXDXBZBVDXBZBXDXBVBZDXBXBXBXDXBXBXBXDXBZBVDXBXDXBXBXBXDXBXDZBVBZBVDZBXBVDZBVBZBVDXBZBXDVBZBVDXBVBZBXDXBXBXBXDXBVBZDVBZBXDXBZBVDZBVBXDZBZD\B\D\BVDZBVBXDXBXBXBXFh@Fh@BTBZDZBVBZDXBVBZBXDXBXBVBVD\Fh@@L@LDZB\BRD^BZDVBZBXDXBXBXDXBXBVBXBVDZBZBVDXBXBXDXBZBVDXBZBXDXBXBXDZBZBVDXBXBXBXDVFr@BXDZBVBXDXBZBXDXBXBT?BBT@H@LDZBZDZBXDZBVBVD\BXBTBZDZBVBXDZBVBZDVBXBVDZBXBXBXDXBXBXDXBXBXDXBVBZBXDXBVBZDXBXBZDVBZBXBVDZBVBXDVBZBZDVBXBZDXBXBXBVDZBVBXDXBXBXDXBZBXBP@DBZBVBZDVBXBX@DBRBZBXBVDX?FBNB\DVBXBXD\BVBVBV@BBVBZBXDVBXBVBXD\BT?BBTDX@N@JBXDXBVBZBXDXBZBVDZBXBT@BFt@DVBZFp@DXB\BTDZBVPhBHn@BXD\BXFn@LlAD\BXBXLlABTBXDXBXBXDZBVBXDXBVDZBXDXBXDXBVDZBXDVD\DVBTD\DVDVBXDZDXDTDZDVDZDVDXDXDXDVDXDVFXDVDZDXFVDZDTFXLr@DVDVFXDVFXDVFZFVFVDXLn@FZLn@FVHZDVHZ@FBLFTFVFXFZFVFVHZFVFTH\Lh@FVFVHXFVNn@DNHVFVFVHVJ`@HVFVL`@FVNd@HXFVHTHXJZFVHVHTFVRj@FVBDHXHXTn@HTFTJXHTRn@HTLZFPHVHTJVHTHVJTHVHTJVHVLXJVPf@BDDNJTJVJVHTJVJVJRHTLZHPJVJRJXJRJTJVJTJTJTHRLVJTJTJTJTLTHRLTJTJRLVJTJRLTJTJTFJBFLTLTJT@@JPJTLTJRLTLRJTLRLTLTJRLRLTJRLTLTLRLRLRLTLRLRLTJRNRLRLTLRLRLRLRLR\h@LPLRLRNRLRLPNTLRNPLRNRLRNRLRNPLRNPLRJLBDLPNRLPNRNPLRNPNRNPLPNRNPNPLPNPNRNPNRNNNRNPLNNRNPNPNPNRNPNPNPLPPRNPNPNPLNNRNPNPNPNRNPNPNPNPNPNRNPNPNRNPNPNPLPPPLPPRNPLPPPLPNRNPNPNPNPNPNRNPLNPRNPNPLPNPNRNNNRNPNNNRNPNRNPNPNPNPLPPRLNPRNPLPNPNRNPNRNPNPNPNRNPNPNPNPNRNPNPNNNRLNPRLNNRNPNPNRLNNRNNNPNRNPNPLPNPNPNPNRNPNPNPLPPPLRNNNRNPNPNPNPNPNRNPLPPPNPLPNPNPNRNPNPNPNPNPLPNPNRPPLPNPNPNPNPNPNRNPNPLPPRNPNPNPLPNPNPNPNRNPNPLPHHLNNRNPNPLPp@v@NPLPNPNPNPNRNPNPPRLNNRNPNPNPNRNPNPNPPRLPNPNPNPNPNPNRNPNPNPNPNRZ`@PRNPNPNPNPNRNPNRNNNRNPNRNPNPNRNPNPNPNRNNNRNRNPNPPRNPNRNPNRNPPPLPPRNPNRNPNPNRPPNRLNNRNNNRPPNPNRPRLPNPPRPRLLNRLLDDLLNPNPPPNNNN@BNNPNNPPNPPPPNLPPPNPNHHFFPLPPNJPPRLPNPNPNRNRLPNNJ@@PLRNRLPLPLRLPLRLPJRLRLPLTLPJ@?NJlAp@d@V^RZNPHRJRJRJTHRJPHTHTJRHRHRHTJPFTHTHRHTHRFRF~@ZVHNDVHRFTFRFTFRFTDTFRFTFTDTFTFRDTFTFTDRFTDTFRFTDTFTFTFTFRD?@TDRFXH^Jn@RTFTFVHPFTHRHTFRHTHRFTHRHPFB@RHRHTHRHRHRHRHTJRHTHRJRHRHRJTJRHRHRJRJRHRJRJRJRHRJRJRJRJRJRLRJRJPJRJJFFDRJPJRLRLRJPLTJPLPJRLTNPLPJTNPLPJPLRLPLPLRLRNPLPLRNPNPLPLRNPLPNPLPNPLPNPNPNPNNLPNPNPNRPPPRNNNPPPNNNPNRPNNPPNNPPNNPPNNPRNNRRNNNPPPNPNPPPLNPRPRLNPPNPLPFHn@v@\b@RVDD~@lANR|AtBhAbB|@rAZd@\h@LT\h@h@|@t@pAZj@v@vA~@fBh@dAd@~@rAxCBBv@hBVj@N^P`@Pb@p@bB@BN`@Pf@Rd@FTPd@Pf@d@rAJ\b@tAL\Pj@HXHT^pARr@Rv@BJHV@DLf@BJVbALf@Lb@f@|Bj@jCNt@DNTnAb@fCF^Lx@Lr@@H\zBHf@XpBNjAb@bEN~AFh@N`B?@LbBBZBVHhAFz@@TB^?BDp@HxAJzB?D?JBj@Dj@?H@TBn@D`A@RB^Bj@@L@VBj@@Z@VBX@^Dt@@Z@V@ZBZ@X?DFjA@V?BDp@@X@JBj@Bf@?N@T@D@V@XBn@@V@H@R@^HnABf@@H@ZDr@B\@VBXB\B\@RBR@LBXBZBTBT?FHn@B\D\DXDZD^Ht@BJ@LF`@D\Hh@F^Nx@?DVtADVNv@H`@DTH^FVDVBJBJHZFZH\XjAHZDNLb@HZ`@xAJXFVL`@Nh@HTHVV|@DNRn@Pl@BHNd@Rp@HVRr@Pl@\hANd@J^`@tAPf@FVHXHVHVHVPj@?@HTLb@Nf@Pl@JZFTRn@Rp@FTFVHZNf@Px@Rx@?@DRDTH`@FXDTFZBN@LDTF\@NBJBVDXD\BL@LBXD\D\BZBZBZB\BXB\@\B\@XB\@\@ZBx@@Z?Z@\?\?X?\?x@?\?N?LA\Av@AZ?\AZA\CXAZALCh@AXCXCXAZCXAZCX?FAPGv@AZCZC\AZCXCXAXCZAZCXCXAZCZAXCXAXCXCXAZCZC\AVEt@CZAVCXA\CPC`@AVIrAATCXGnAC\ATGr@AXG~@KdBAR?BCZEt@APCX?HCZEr@IrAAVIpACZCf@APCVC\A\Gr@A\MjBATAFAZC^O|BAXEp@C\ARI~AEbAEr@AXEh@ANCZCZA\CXCZCZAZADARCVAXCVATAVCV?HCXEr@Et@CZC^C\Er@C\A^Gt@C`@GjAKhBc@fHAZqAlTG~@Q`DO`CIpAGhAKdBInAOpCc@~GUzD_@lGY`FShDShDCh@AHWfEMzBGdAKfBC^AH?HKrACZCZCZCZCZAJCNCZCZCTCXCZEZCTCZEXCXCXEXCTEX?@CRGd@It@EVEXCRGh@Ih@GXEZEVEXEVEVEXG\Kn@GXKp@Mr@Or@Mp@Mn@Op@Or@Mn@GXIZGVGVOp@GXQn@GVQp@Qp@IVOl@IXGTIXIXITIXIVGTSp@IVIVITIVSn@IVKTIXITKVIVKXITIRKVIVKVITKVIRMZIRKXUh@KXIRWj@KZWj@Wl@KTKVWj@KTITMVIROZCFOZABKVKTKRMXIPMVCFILWj@Yj@e@`AYj@Yj@KT[l@Q\GLYh@Yh@MTg@|@MVYh@w@tA[f@e@x@MT]j@Yd@CDKPS\e@t@EFYd@S\SXYf@[f@]h@KP]j@SZW^i@|@W`@S\i@z@a@n@GLy@nAWb@QX_@l@eAbBs@hAQXeBpCg@x@[f@wA~BqArBg@x@wBlDOTg@z@]f@w@nAgAhBo@`A[h@[d@i@|@g@v@]j@OVGHcAbBCBS\yA~BCBU`@{A~BmAnBwA~BaA~A_@j@i@|@EHkAjB]h@s@jAaAtAoAzAaAdA_@^SRg@d@}@r@i@b@_BhASLYPUNkBjAkBnA}@p@o@f@UROJUPOLQNQNSPONOLURONa@^OPa@^SPONQPMLc@b@URQP_@\OPQPc@`@m@l@UTSPM